WorldWideScience

Sample records for astatine 216

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  18. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  19. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  20. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  1. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  2. 22 CFR 216.6 - Environmental assessments.

    Science.gov (United States)

    2010-04-01

    ... considering alternatives will help build an awareness of development associated environmental problems in less... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Environmental assessments. 216.6 Section 216.6 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.6 Environmental...

  3. 50 CFR 216.82 - Dogs prohibited.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Dogs prohibited. 216.82 Section 216.82... Pribilof Islands Administration § 216.82 Dogs prohibited. In order to prevent molestation of fur seal herds, the landing of any dogs at Pribilof Islands is prohibited. ...

  4. 50 CFR 216.87 - Wildlife research.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Wildlife research. 216.87 Section 216.87 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Pribilof Islands Administration § 216.87 Wildlife research. (a) Wildlife research, other than research on...

  5. 25 CFR 216.8 - Performance bond.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Performance bond. 216.8 Section 216.8 Indians BUREAU OF... RECLAMATION OF LANDS General Provisions § 216.8 Performance bond. (a) Upon approval of an exploration plan or mining plan, the operator shall be required to file a suitable performance bond of not less than $2,000...

  6. 31 CFR 0.216 - Privacy Act.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Privacy Act. 0.216 Section 0.216... RULES OF CONDUCT Rules of Conduct § 0.216 Privacy Act. Employees involved in the design, development, operation, or maintenance of any system of records or in maintaining records subject to the Privacy Act of...

  7. 7 CFR 948.216 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 948.216 Section 948.216 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN COLORADO Accounting and Collections § 948.216...

  8. 12 CFR 741.216 - Flood insurance.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Flood insurance. 741.216 Section 741.216 Banks... INSURANCE Regulations Codified Elsewhere in NCUA's Regulations as Applying to Federal Credit Unions That Also Apply to Federally Insured State-Chartered Credit Unions § 741.216 Flood insurance. Any credit...

  9. 50 CFR 216.34 - Issuance criteria.

    Science.gov (United States)

    2010-10-01

    ... at § 216.41, § 216.42, and § 216.43; (3) The proposed activity, if it involves endangered or... likely have a significant adverse impact on the species or stock; (5) Whether the applicant's expertise... application; (6) If a live animal will be held captive or transported, the applicant's qualifications...

  10. 22 CFR 216.5 - Endangered species.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Endangered species. 216.5 Section 216.5 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.5 Endangered species. It is A... endangered or threatened species and their critical habitats. The Initial Environmental Examination for each...

  11. 50 CFR 216.15 - Depleted species.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Depleted species. 216.15 Section 216.15 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Prohibitions § 216.15 Depleted species. The following species or population stocks have been designated by the...

  12. 50 CFR 216.42 - Photography. [Reserved

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Photography. 216.42 Section 216.42 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Special Exceptions § 216.42 Photography. ...

  13. 40 CFR 21.6 - Exclusions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Exclusions. 21.6 Section 21.6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL SMALL BUSINESS § 21.6 Exclusions. (a... for financial assistance in meeting revenue and service charges imposed upon a small business by a...

  14. 10 CFR 216.1 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Introduction. 216.1 Section 216.1 Energy DEPARTMENT OF ENERGY OIL MATERIALS ALLOCATION AND PRIORITY PERFORMANCE UNDER CONTRACTS OR ORDERS TO MAXIMIZE DOMESTIC ENERGY SUPPLIES § 216.1 Introduction. (a) This part describes and establishes the procedures to be used...

  15. 32 CFR 216.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 216.5 Section 216.5 National... § 216.5 Responsibilities. (a) The PDUSD(P&R), under the Under Secretary of Defense for Personnel and... appropriate preparations to carry out their responsibilities should a covered school be determined ineligible...

  16. Bagla JS (3) 216 (GA)

    Indian Academy of Sciences (India)

    Admin

    Ahmed Asma (5) 455, (6) 610 (GA). Ananthasuresh G K (6) 530, (9) 849 (GA). Arakeri Jaywant H (1) 32 (GA). Arunan E (12) 1210; (4) 346 (FA). Athreya K B (1) 66 (GA); (4) 384 (TIO). Bagla J S (3) 216 (GA). Balaji C (12) 1171 (GA). Balaram P (5) 416 (GA). Bhanu K S (11) 1119 (TIO). Bhat B V Rajarama (10) 970 (GA).

  17. 216

    African Journals Online (AJOL)

    2001-04-04

    Apr 4, 2001 ... and totally extraperitoneal repair (TEP) followed(5). The main benefits of laparoscopic hernia repair have been reported as less postoperative pain, early discharge and early, turn to work(6-15). On the other hand, the major disadvantage of the technique seems to be its high cost(6,9-. 17). Although the early ...

  18. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  19. Dicty_cDB: CHF216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHF216 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Original site) CHF...216F 636 - - - - - - Show CHF216 Library CH (Link to library) Clone ID CHF216 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHF2-A/CHF216Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHF216 (CHF216Q) /CSM/CH/CHF2-A/CHF216Q.Seq.d/ TAAAGAAATTTTACCAA...iiiiiiiiitiimkivqnqkr--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHF216 (CHF

  20. 50 CFR 216.204 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.204 Mitigation. The activity identified in § 216.200(a) must be conducted in...

  1. 50 CFR 216.203 - Prohibitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.203 Prohibitions. Notwithstanding takings contemplated in § 216.200 and...

  2. 31 CFR 800.216 - Foreign person.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign person. 800.216 Section 800.216 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS, AND...

  3. 50 CFR 216.274 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Mitigation. 216.274 Section 216.274 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... reconstruction purposes. Logs and records will be kept for a period of 30 days following completion of a major...

  4. 32 CFR 216.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... RECRUITING AND RESERVE OFFICER TRAINING CORPS PROGRAM ACCESS TO INSTITUTIONS OF HIGHER EDUCATION § 216.4... inquiry from a representative of a DoD Component or a representative from the Department of Homeland...

  5. 48 CFR 216.402-2 - Technical performance incentives.

    Science.gov (United States)

    2010-10-01

    ... incentives. 216.402-2 Section 216.402-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Incentive Contracts 216.402-2 Technical performance incentives. See PGI 216.402-2 for guidance on establishing...

  6. 23 CFR 646.216 - General procedures.

    Science.gov (United States)

    2010-04-01

    ... FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS RAILROADS... engineering and engineering services. (1) As mutually agreed to by the State highway agency and railroad, and subject to the provisions of § 646.216(b) (2), preliminary engineering work on railroad-highway projects...

  7. 50 CFR 216.201 - Effective dates.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.201 Effective dates. Regulations in this subpart are effective from April 6...

  8. 50 CFR 216.254 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... detecting marine mammals, detonation must be delayed until adequate sea conditions exist for aerial..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.254...

  9. 32 CFR 552.216 - Violations.

    Science.gov (United States)

    2010-07-01

    ... on the Installation of Aberdeen Proving Ground, Maryland § 552.216 Violations. (a) A person is in violation of the terms of this subpart if: (1) That person enters or remains upon Aberdeen Proving Ground..., Aberdeen Proving Ground pursuant to the terms of § 552.214; or (2) That person enters upon or remains upon...

  10. 24 CFR 1710.216 - Additional information.

    Science.gov (United States)

    2010-04-01

    ... of the United States, the Statement of Record shall be submitted in the English language and all supporting documents, including copies of any laws which restrict the ownership of land by aliens, shall be... § 1710.216 Additional information. (a) Property Owners' Association. (1) If the association has been...

  11. 48 CFR 52.216-21 - Requirements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Requirements. 52.216-21... Requirements. As prescribed in 16.506(d), insert the following clause: Requirements (OCT 1995) (a) This is a requirements contract for the supplies or services specified, and effective for the period stated, in the...

  12. 27 CFR 24.216 - Distilling material.

    Science.gov (United States)

    2010-04-01

    ... containing aldehydes may be used in the fermentation of wine to be used as distilling material. Lees, filter..., DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.216 Distilling material. Wine may be produced on bonded wine premises from grapes and other fruit, natural fruit products, or...

  13. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  14. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  15. 46 CFR 153.216 - Shower and eyewash fountains.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Shower and eyewash fountains. 153.216 Section 153.216... Vessel Requirements § 153.216 Shower and eyewash fountains. (a) Each non-self-propelled ship must have a fixed or portable shower and eyewash fountain that operates during cargo transfer and meets paragraph (c...

  16. 50 CFR 216.83 - Importation of birds or mammals.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Importation of birds or mammals. 216.83 Section 216.83 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... MAMMALS Pribilof Islands Administration § 216.83 Importation of birds or mammals. No mammals or birds...

  17. 49 CFR 195.216 - Welding: Miter joints.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding: Miter joints. 195.216 Section 195.216 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... PIPELINE Construction § 195.216 Welding: Miter joints. A miter joint is not permitted (not including...

  18. 25 CFR 216.7 - Approval of mining plan.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Approval of mining plan. 216.7 Section 216.7 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS SURFACE EXPLORATION, MINING, AND RECLAMATION OF LANDS General Provisions § 216.7 Approval of mining plan. (a) Before surface mining operations...

  19. 10 CFR 216.7 - Conflict in priority orders.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Conflict in priority orders. 216.7 Section 216.7 Energy DEPARTMENT OF ENERGY OIL MATERIALS ALLOCATION AND PRIORITY PERFORMANCE UNDER CONTRACTS OR ORDERS TO MAXIMIZE DOMESTIC ENERGY SUPPLIES § 216.7 Conflict in priority orders. If it appears that the use of assistance...

  20. 40 CFR 2.216-2.300 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false 2.216-2.300 Section 2.216-2.300 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information §§ 2.216-2.300 ...

  1. 50 CFR 216.43 - Public display. [Reserved

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Public display. 216.43 Section 216.43 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Special Exceptions § 216.43 Public display. ...

  2. 216-B-3 expansion ponds closure plan

    Energy Technology Data Exchange (ETDEWEB)

    1994-10-01

    This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA.

  3. Identification of the zinc finger 216 (ZNF216) in human carcinoma cells: a potential regulator of EGFR activity.

    Science.gov (United States)

    Mincione, Gabriella; Di Marcantonio, Maria Carmela; Tarantelli, Chiara; Savino, Luca; Ponti, Donatella; Marchisio, Marco; Lanuti, Paola; Sancilio, Silvia; Calogero, Antonella; Di Pietro, Roberta; Muraro, Raffaella

    2016-11-15

    Epidermal Growth Factor Receptor (EGFR), a member of the ErbB family of receptor tyrosine kinase (RTK) proteins, is aberrantly expressed or deregulated in tumors and plays pivotal roles in cancer onset and metastatic progression. ZNF216 gene has been identified as one of Immediate Early Genes (IEGs) induced by RTKs. Overexpression of ZNF216 protein sensitizes 293 cell line to TNF-α induced apoptosis. However, ZNF216 overexpression has been reported in medulloblastomas and metastatic nasopharyngeal carcinomas. Thus, the role of this protein is still not clearly understood. In this study, the inverse correlation between EGFR and ZNF216 expression was confirmed in various human cancer cell lines differently expressing EGFR. EGF treatment of NIH3T3 cells overexpressing both EGFR and ZNF216 (NIH3T3-EGFR/ZNF216), induced a long lasting activation of EGFR in the cytosolic fraction and an accumulation of phosphorylated EGFR (pEGFR) more in the nuclear than in the cytosolic fraction compared to NIH3T3-EGFR cells. Moreover, EGF was able to stimulate an increased expression of ZNF216 in the cytosolic compartment and its nuclear translocation in a time-dependent manner in NIH3T3-EGFR/ZNF216. A similar trend was observed in A431 cells endogenously expressing the EGFR and transfected with Znf216. The increased levels of pEGFR and ZNF216 in the nuclear fraction of NIH3T3-EGFR/ZNF216 cells were paralleled by increased levels of phospho-MAPK and phospho-Akt. Surprisingly, EGF treatment of NIH3T3-EGFR/ZNF216 cells induced a significant increase of apoptosis thus indicating that ZNF216 could sensitize cells to EGF-induced apoptosis and suggesting that it may be involved in the regulation and effects of EGFR signaling.

  4. 50 CFR 216.73 - Disposition of fur seal parts.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Disposition of fur seal parts. 216.73... MAMMALS Pribilof Islands, Taking for Subsistence Purposes § 216.73 Disposition of fur seal parts. Except... part of a fur seal taken for subsistence uses may be sold or otherwise transferred to any person unless...

  5. 50 CFR 216.81 - Visits to fur seal rookeries.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Visits to fur seal rookeries. 216.81... MAMMALS Pribilof Islands Administration § 216.81 Visits to fur seal rookeries. From June 1 to October 15... any fur seal rookery or hauling grounds nor pass beyond any posted sign forbidding passage. ...

  6. 48 CFR 2052.216-73 - Accelerated task order procedures.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Accelerated task order procedures. 2052.216-73 Section 2052.216-73 Federal Acquisition Regulations System NUCLEAR REGULATORY... the work, the contractor shall proceed with performance of the task order subject to the monetary...

  7. 36 CFR 2.16 - Horses and pack animals.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Horses and pack animals. 2.16... RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.16 Horses and pack animals. The following are prohibited: (a) The use of animals other than those designated as “pack animals” for purposes of transporting...

  8. 48 CFR 1352.216-77 - Ceiling price.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Ceiling price. 1352.216-77... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.216-77 Ceiling price. As prescribed in 48 CFR 1316.601-70 and 1316.602-70, insert the following clause: Ceiling Price (APR 2010) The...

  9. 48 CFR 452.216-74 - Ceiling Price.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Ceiling Price. 452.216-74... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.216-74 Ceiling Price. As prescribed in 416.670, insert the following clause: Ceiling Price (FEB 1988) The ceiling price of this...

  10. 50 CFR 216.91 - Dolphin-safe labeling standards.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Dolphin-safe labeling standards. 216.91... MAMMALS Dolphin Safe Tuna Labeling § 216.91 Dolphin-safe labeling standards. (a) It is a violation of... include on the label of those products the term “dolphin-safe” or any other term or symbol that claims or...

  11. 49 CFR 173.216 - Asbestos, blue, brown or white.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Asbestos, blue, brown or white. 173.216 Section... Class 7 § 173.216 Asbestos, blue, brown or white. (a) Asbestos, blue, brown or white, includes each of the following hydrated mineral silicates: chrysolite, crocidolite, amosite, anthophyllite asbestos...

  12. 48 CFR 752.216-70 - Award fee.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Award fee. 752.216-70 Section 752.216-70 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT CLAUSES AND... final patent and royalty reports, and is not delinquent in submitting final vouchers on prior years...

  13. 48 CFR 216.104-70 - Research and development.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Research and development... Contract Types § 216.104-70 Research and development. Follow the procedures at PGI 216.104-70 for selecting the appropriate research and development contract type. ...

  14. 48 CFR 2052.216-71 - Indirect cost rates.

    Science.gov (United States)

    2010-10-01

    ....216-71 Section 2052.216-71 Federal Acquisition Regulations System NUCLEAR REGULATORY COMMISSION... (JAN 1993) (a) Pending the establishment of final indirect rates which must be negotiated based on... may not be obligated to pay any additional amounts for indirect costs above the ceiling rates set...

  15. 10 CFR 216.3 - Requests for assistance.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Requests for assistance. 216.3 Section 216.3 Energy DEPARTMENT OF ENERGY OIL MATERIALS ALLOCATION AND PRIORITY PERFORMANCE UNDER CONTRACTS OR ORDERS TO MAXIMIZE.... (10) Any known conflicts with rated orders already issued pursuant to the DPA for supplies of the...

  16. Soil/sediment characterization for 216-A-29 ditch

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, R.M.

    1997-03-01

    This document provides a detailed description of the environmental samples collected from the 216-A-29 Ditch in 1988. Tables summarizing the laboratory data for radionuclides, metals, and soil chemistry are included.

  17. 50 CFR 216.189 - Renewal of Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... Array Sensor System Low Frequency Active (SURTASS LFA sonar) Sonar § 216.189 Renewal of Letters of... modification to the Letter of Authorization, NMFS will provide a period of 30 days for public review and...

  18. 50 CFR 216.187 - Applications for Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... Array Sensor System Low Frequency Active (SURTASS LFA sonar) Sonar § 216.187 Applications for Letters of... marine mammal populations. (d) The National Marine Fisheries Service will review an application for a...

  19. 50 CFR 216.119 - Modifications to Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Coastal Commercial Fireworks Displays at... risk to the well-being of the species or stocks of marine mammals specified in § 216.110(b), a Letter...

  20. 216-U-10 Pond and 216-Z-19 Ditch characterization studies

    Energy Technology Data Exchange (ETDEWEB)

    Last, G.V.; Duncan, D.W.; Graham, M.J.; Hall, M.D.; Hall, V.W.; Landeen, D.S.; Leitz, J.G.; Mitchell, R.M.

    1994-02-01

    The chemical, reprocessing of spent nuclear fuels at the US Department of Energy`s Hanford Site has generated large volumes of radioactive liquid effluents. The majority of these effluents have been used strictly for cooling or other supportive functions and have been discharged to ditches and ponds. The 216-U-10 Pond and 216-Z-19 Ditch are two such disposal facilities. These facilities are components of an integrated system of ditches, ponds, and overflow facilities collectively referred to as the U-Pond disposal system. The U-Pond system has been used since 1943 and has received a large variety of radioisotopes from several sources. This study covered tho major aspects of the environment, including wind resuspension, biological uptake and transport, geologic distribution in surface and subsurface sediments, and ground-water impacts. The long-term use of U-Pond and the Z-19 Ditch has resulted in the localized accumulation of transuranic and fission product inventories as a result of sorption and filtration of particulates onto the uppermost sediments.

  1. 48 CFR 252.216-7001 - Economic price adjustment-nonstandard steel items.

    Science.gov (United States)

    2010-10-01

    ...-nonstandard steel items. 252.216-7001 Section 252.216-7001 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.216-7001 Economic price adjustment—nonstandard steel items. As prescribed in 216.203-4-70(b), use the following clause: Economic Price Adjustment—Nonstandard Steel Items...

  2. 9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... cultures for vaccine production. All serials of vaccine shall be prepared from the first through the fifth... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Rhinotracheitis Vaccine, Killed... REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...

  3. 22 CFR 216.7 - Environmental impact statements.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Environmental impact statements. 216.7 Section... Environmental impact statements. (a) Applicability. An Environmental Impact Statement shall be prepared when... Environmental Impact Statement relating to paragraph (a)(2) of this section shall comply with the CEQ...

  4. Nuclear structure of 216 Ra at high spin

    Indian Academy of Sciences (India)

    Bi(10B, 3n) reaction at an incident beam energy of 55 MeV and 209Bi(11B, 4n) reaction at incident beam energies ranging from 65 to 78 MeV. Based on coincidence data, the level scheme for 216Ra has been considerably extended up to ...

  5. 50 CFR 216.208 - Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.208 Letters of Authorization. (a) A Letter of Authorization, unless...

  6. 50 CFR 216.207 - Applications for Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.207 Applications for Letters of Authorization...

  7. 50 CFR 216.209 - Renewal of Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.209 Renewal of Letters of Authorization. (a) A...

  8. 50 CFR 216.206 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.206 Requirements for monitoring and reporting...

  9. 50 CFR 216.202 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.202 Permissible methods of taking. (a) Under Letters of...

  10. 50 CFR 216.210 - Modifications to Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.210 Modifications to Letters of Authorization...

  11. 50 CFR 216.171 - Effective dates and definitions.

    Science.gov (United States)

    2010-10-01

    ... concern listed in next bullet) found dead or live on shore within a two day period and occurring on same... distress. (2) Shutdown (this definition specifically applies only to the word as used in § 216.174(a)(1... live, in the water animal involved in a USE. ...

  12. Adsorption gas chromatography with 150-ms {sup 216}Po

    Energy Technology Data Exchange (ETDEWEB)

    Vogt, A. [Bern Univ. (Switzerland); Gaeggeler, H.W.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-09-01

    A gas chromatography apparatus was developed, which allows experiments with volatile radionuclides having shorter half-lives than one second. This apparatus was tested with the 150-ms isotope {sup 216}Po. Experimental data were compared with a Monte Carlo model to determine the adsorption enthalpy {Delta}H{sub a}. (author) 2 figs., 2 refs.

  13. 48 CFR 1252.216-72 - Performance evaluation plan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance evaluation....216-72 Performance evaluation plan. As prescribed in (TAR) 48 CFR 1216.406(b), insert the following clause: Performance Evaluation Plan (OCT 1994) (a) A Performance Evaluation Plan shall be unilaterally...

  14. 48 CFR 3052.216-72 - Performance evaluation plan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Performance evaluation... CONTRACT CLAUSES Text of Provisions and Clauses 3052.216-72 Performance evaluation plan. As prescribed in... Evaluation Plan (DEC 2003) (a) A Performance Evaluation Plan shall be unilaterally established by the...

  15. 48 CFR 2452.216-73 - Performance evaluation plan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Performance evaluation plan... 2452.216-73 Performance evaluation plan. As prescribed in 2416.406(e)(3), insert the following clause in all award fee contracts: Performance Evaluation Plan (AUG 1987) (a) The Government shall...

  16. Mani (216-276 CE) and Ethiopian Enoch

    National Research Council Canada - National Science Library

    Venter, Pieter M

    2014-01-01

    .... Introduction Mani (216-276 CE) was the founder of Manichaeism. This religion developed out of the JewishChristian Elchasaite1 group. It spread out to North Africa, Egypt, Central Asia, Oxus in the east, and as far east as China. Mani was a prolific writer. His legacy reflects the circumstances under Sasanian Rule in the east during the 3rd cent...

  17. 22 CFR 216.2 - Applicability of procedures.

    Science.gov (United States)

    2010-04-01

    ... transfers; (vi) Contributions to international, regional or national organizations by the United States...) Institution building grants to research and educational institutions in the United States such as those....2 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.2...

  18. 20 CFR 408.216 - Are you a World War II veteran?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Are you a World War II veteran? 408.216 Section 408.216 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS SVB Qualification and Entitlement Military Service § 408.216 Are you a World War II...

  19. 12 CFR 216.12 - Limits on sharing account number information for marketing purposes.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Limits on sharing account number information for marketing purposes. 216.12 Section 216.12 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF... Disclosures § 216.12 Limits on sharing account number information for marketing purposes. (a) General...

  20. 12 CFR 216.13 - Exception to opt out requirements for service providers and joint marketing.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Exception to opt out requirements for service providers and joint marketing. 216.13 Section 216.13 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF... § 216.13 Exception to opt out requirements for service providers and joint marketing. (a) General rule...

  1. 38 CFR 3.216 - Mandatory disclosure of social security numbers.

    Science.gov (United States)

    2010-07-01

    ... social security numbers. 3.216 Section 3.216 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF... Requirements § 3.216 Mandatory disclosure of social security numbers. Any person who applies for or receives..., furnish the Department of Veterans Affairs upon request with his or her social security number and the...

  2. 25 CFR 216.4 - Technical examination of prospective surface exploration and mining operations.

    Science.gov (United States)

    2010-04-01

    ... and mining operations. 216.4 Section 216.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS SURFACE EXPLORATION, MINING, AND RECLAMATION OF LANDS General Provisions § 216... meet for the protection of nonmineral resources during the conduct of exploration or mining operations...

  3. 50 CFR 216.161 - Specified activity and incidental take levels by species.

    Science.gov (United States)

    2010-10-01

    ... levels by species. 216.161 Section 216.161 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE.... Atlantic Coast § 216.161 Specified activity and incidental take levels by species. (a) Regulations in this... species: Minke whale (Balaenoptera acutorostrata), dwarf sperm whale (Kogia simus); pygmy sperm whale (K...

  4. 29 CFR 1910.216 - Mills and calenders in the rubber and plastics industries.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Mills and calenders in the rubber and plastics industries. 1910.216 Section 1910.216 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND... Guarding § 1910.216 Mills and calenders in the rubber and plastics industries. (a) General requirements— (1...

  5. 28 CFR 2.16 - Parole of prisoner in state, local, or territorial institution.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Parole of prisoner in state, local, or territorial institution. 2.16 Section 2.16 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.16 Parole of...

  6. Laparoscopic cholecystectomy for acute cholecystitis: clinical analysis of 216 cases

    Directory of Open Access Journals (Sweden)

    DAI Juntao

    2014-07-01

    Full Text Available ObjectiveTo investigate the clinical experience of laparoscopic cholecystectomy (LC for acute cholecystitis. MethodsA retrospective analysis was performed on the clinical records of 216 patients with acute cholecystitis who underwent LC in Qingpu Branch of Zhongshan Hospital, Fudan University from January 2010 to January 2013. LC was performed under intubation general anaesthesia, with three holes conventionally and four holes if necessary. After operation, the drainage tube was placed for 1-3 d, and antibiotics were administered for 3-5 d. The time of operation, length of postoperative hospital stay, and incidence of postoperative complications were determined. All patients were followed up for at least 0.5 year after operation. ResultsLC was successfully performed in 188 (87.0% of all patients; 28 (13.0% of all patients were converted to open surgery. The mean time of operation was 62.00±11.27 min; the mean length of hospital stay was 4.60±2.16 d; the incidence of postoperative complications was 2.3%(5/216. All patients were cured and discharged. During follow-up, no patients developed other complications and all recovered well. ConclusionLC is safe and feasible in the treatment of acute cholecystitis. Correct manipulation of the Calot's triangle and proper abdominal drainage are the key to successful operation.

  7. Panel 2.16: forensic aspects of disaster fatality management.

    Science.gov (United States)

    Tun, Kan; Butcher, Barbara; Sribanditmongkol, Pongruk; Brondolo, Tom; Caragine, Theresa; Perera, Clifford; Kent, Karl

    2005-01-01

    This is a summary of the presentations and discussion of Panel 2.16, Forensic Aspects of Disaster Fatality Management of the Conference, Health Aspects of the Tsunami Disaster in Asia, convened by the World Health Organization (WHO) in Phuket, Thailand, 04-06 May 2005. The topics discussed included issues related to forensic aspects that pertain to the responses to the deaths created by the Earthquake and Tsunami. It is presented in the following major sections: (1) overview of victim identification; (2) resource factors in mass-fatality management; (3) mass-fatality management in protecting public health; and (4) reasons to use deoyxribose nucleic acid (DNA) to identify the deceased.

  8. Groundwater impact assessment report for the 216-U-14 Ditch

    Energy Technology Data Exchange (ETDEWEB)

    Singleton, K.M.; Lindsey, K.A.

    1994-01-01

    Groundwater impact assessments are conducted at liquid effluent receiving sites on the Hanford Site to determine hydrologic and contaminant impacts caused by discharging wastewater to the soil column. The assessments conducted are pursuant to the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-17-00A and M-17-00B, as agreed by the US Department of Energy (DOE), Washington State Department of Ecology (Ecology), and the US Environmental Protection Agency (EPA) (Ecology et al. 1992). This report assesses impacts on the groundwater and vadose zone from wastewater discharged to the 216-U-14 Ditch. Contemporary effluent waste streams of interest are 242-S Evaporator Steam Condensate and UO{sub 3}/U Plant wastewater.

  9. 30 CFR 77.216-5 - Water, sediment or slurry impoundments and impounding structures; abandonment.

    Science.gov (United States)

    2010-07-01

    ... slurry impoundments and impounding structures; abandonment. (a) Prior to abandonment of any water... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Water, sediment or slurry impoundments and impounding structures; abandonment. 77.216-5 Section 77.216-5 Mineral Resources MINE SAFETY AND HEALTH...

  10. 19 CFR 146.52 - Manipulation, manufacture, exhibition or destruction; Customs Form 216.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Manipulation, manufacture, exhibition or... Merchandise in a Zone § 146.52 Manipulation, manufacture, exhibition or destruction; Customs Form 216. (a... application) on Customs Form 216 for permission to manipulate, manufacture, exhibit, or destroy merchandise in...

  11. 22 CFR 216.9 - Bilateral and multilateral studies and concise reviews of environmental issues.

    Science.gov (United States)

    2010-04-01

    ... reviews of environmental issues. 216.9 Section 216.9 Foreign Relations AGENCY FOR INTERNATIONAL... environmental issues. Notwithstanding anything to the contrary in these procedures, the Administrator may... United States is a member or participant; or (b) Concise reviews of the environmental issues involved...

  12. 50 CFR 216.107 - Incidental harassment authorization for Arctic waters.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Incidental harassment authorization for... Incidental to Specified Activities § 216.107 Incidental harassment authorization for Arctic waters. (a... authorized under § 216.105, incidental harassment authorizations may be issued, following a 30-day public...

  13. 50 CFR 216.108 - Requirements for monitoring and reporting under incidental harassment authorizations for Arctic...

    Science.gov (United States)

    2010-10-01

    ... under incidental harassment authorizations for Arctic waters. 216.108 Section 216.108 Wildlife and... for monitoring and reporting under incidental harassment authorizations for Arctic waters. (a) Holders of an incidental harassment authorization in Arctic waters and their employees, agents, and designees...

  14. 32 CFR Appendix B to Part 216 - ROTC Sample Letter of Inquiry

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false ROTC Sample Letter of Inquiry B Appendix B to... (CONTINUED) MISCELLANEOUS MILITARY RECRUITING AND RESERVE OFFICER TRAINING CORPS PROGRAM ACCESS TO INSTITUTIONS OF HIGHER EDUCATION Pt. 216, App. B Appendix B to Part 216—ROTC Sample Letter of Inquiry (Tailor...

  15. 12 CFR 216.11 - Limits on redisclosure and reuse of information.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Limits on redisclosure and reuse of information. 216.11 Section 216.11 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL... Limits on redisclosure and reuse of information. (a)(1) Information you receive under an exception. If...

  16. 20 CFR 216.67 - “Child in care.”

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false âChild in care.â 216.67 Section 216.67... care.” (a) Railroad Retirement Act. Part 222 of this chapter sets forth what is required to establish that a child is in an individual's care for purposes of the Railroad Retirement Act. This definition is...

  17. 48 CFR 1553.216-70 - EPA Form 1900-41A, CPAF Contract Summary of Significant Performance Observation.

    Science.gov (United States)

    2010-10-01

    ... Contract Summary of Significant Performance Observation. 1553.216-70 Section 1553.216-70 Federal... 1553.216-70 EPA Form 1900-41A, CPAF Contract Summary of Significant Performance Observation. As prescribed in 1516.404-278, EPA Form 1900-41A shall be used to document significant performance observations...

  18. Groundwater Monitoring Plan for the 216-A-29 Ditch

    Energy Technology Data Exchange (ETDEWEB)

    Sweeney, M.D.

    1999-10-07

    This document presents a groundwater monitoring plan, under Resource Conservation and Recovery Act of 1976 (RCRA) regulatory requirements found in WAC 173-303-400, and by reference, requirements in 40 CFR 265.93 (d)(6) for the 216-A-29 Ditch (A-29 Ditch) in the Hanford Site's 200 East Area. The objectives of this monitoring plan are to determine whether any hazardous constituents are detectable in the groundwater beneath the ditch. The groundwater monitoring network described in this plan includes 10 RCRA-compliant wells to monitor the aquifer in the immediate vicinity of the A-29 Ditch. Groundwater assessment activities have been conducted at the A-29 Ditch, the result of elevated specific conductivity and total organic halogens (TOX). A groundwater assessment report (Votava 1995) found that no hazardous constituents had impacted groundwater and the site returned to interim-status indicator-parameter/detection monitoring. This plan describes the process and quality objectives for conducting the indicator-parameter program. The site will be sampled semiannually for indicator parameters including pH, specific conductance, TOX, and total organic carbon. Site-specific parameters include tritium and ICP metals. These constituents, as well as anions, alkalinity, and turbidity will be sampled annually. Groundwater elevations will be recorded semiannually.

  19. 50 CFR 216.191 - Designation of Offshore Biologically Important Marine Mammal Areas.

    Science.gov (United States)

    2010-10-01

    ... Operations of Surveillance Towed Array Sensor System Low Frequency Active (SURTASS LFA sonar) Sonar § 216.191... nominated area warrants further study. If so, NMFS will begin a scientific review of the area. (e)(1) If...

  20. Addiction-Related Effects of DOV 216,303 and Cocaine

    DEFF Research Database (Denmark)

    Sørensen, Gunnar; Husum, Henriette; Brennum, Lise T

    2014-01-01

    DOV 216,303, an inhibitor of serotonin, noradrenaline and dopamine reuptake, belongs to a new line of drugs called 'triple reuptake inhibitors' that have been proposed for treatment of depression. The addictive drug cocaine has similar mechanism of action and exerts rewarding effects by blocking...... of DOV 216,303, we conducted a comparative study of addiction-related effects of DOV 216,303 and cocaine in mice using acute self-administration, conditioned place preference (CPP) and drug-induced hyperlocomotion. Effects on accumbal extracellular dopamine levels were determined using microdialysis...... reuptake of dopamine, leading to increased extracellular concentrations of dopamine in the nucleus accumbens. Thus, DOV 216,303 and other triple reuptake inhibitors might be speculated to exhibit abuse potential, limiting their future therapeutic use. To further elucidate potential addictive properties...

  1. Guillem Fabre, “Pus dels majors” (BdT 216.2; Id., “Hon mais vey, pus truep sordeyor” (BdT 216.1

    Directory of Open Access Journals (Sweden)

    Linda Paterson

    2013-03-01

    Full Text Available The historical circumstances of Guillem Fabre’s two surviving sirventes has given rise to widely divergent views. This essay builds on Parducci’s contextualisation of BdT 216.2 during the War of the Sicilian Vespers and the so-called Aragonese crusade by the French against Pere III of Aragon in 1284-1285. It argues that Guillem is likely to be referring to events say entre nos because Narbonne was the focal point of the gathering French army and preaching of the crusade. All other textual details are compatible with this period and best explained by this context. But while Parducci places the sirventes in May 1285, it must in fact have preceded the death of Martin IV on 29 March, since his speedily-appointed successor Honorius IV could not be blamed for not having preached a crusade against the heathen before the conflict degenerated into further atrocities. Furthermore a slightly earlier timing better explains the allusion to “the best-known man in the world”, the obvious candidate at this time being Charles of Anjou. Guillem probably composed BdT 216.2 during the build-up to war in 1284, before the death of Charles in January 1285, during the period of war preparations and propaganda speeches. It is also argued here that, pace Parducci, BdT 216.1 did not necessarily precede BdT 216.2.

  2. Low molecular weight heparin (CY-216) versus unfractionated heparin in chronic hemodialysis.

    Science.gov (United States)

    Grau, E; Sigüenza, F; Maduell, F; Linares, M; Olaso, M A; Martinez, R; Caridad, A

    1992-01-01

    In 14 patients undergoing chronic hemodialysis, we investigated the safety and efficacy of the low molecular fragment (CY-216) in comparison to unfractionated heparin (UFH) in the prevention of clotting in the extracorporeal circuit (ECC). In this study, 168 hemodialysis sessions were undertaken with UFH in 2 bolus doses (5,437 +/- 1,477 SD IU) and 231 with CY-216 in a single bolus dose [initial dose 150 anti-Xa U Institut Choay (IC)/kg]. There were no clots in the bubble trap in any UFH sessions, and 14.8% had coagulated fibers in the dialyzer. Clotting in the bubble trap was observed in 2 CY-216 sessions (0.8%) and coagulated fibers in 22.6% of the sessions. At the end of the study, the mean dose of CY-216 was 250 anti-Xa UIC/kg but a dose of 350 anti-Xa UIC/kg was needed in the 2 patients treated by recombinant human erythropoietin. Anti-Xa levels at the end of the runs were higher (0.47 +/- 0.1 U/ml) in the CY-216 group than in the UFH group (0.28 +/- 0.1 U/ml). There was a correlation between anti-Xa levels and efficacy in the CY-216 group. An anti-Xa activity above 0.4 U/ml was needed in order to minimize thrombus formation. Antithrombin III-protease complexes (ATM) and D dimer fibrin derivatives (D dimer) were used as thrombotic markers but they were of little value for the detection of fibrin formation in the ECC. Our findings suggest that CY-216 administered as a single bolus dose seems to be of similar effectiveness to UFH.

  3. 77 FR 29682 - Gulf of Mexico, Outer Continental Shelf, Central Planning Area, Oil and Gas Lease Sale 216/222

    Science.gov (United States)

    2012-05-18

    ... operations, except: (1) Blocks that were previously included within the GOM's Eastern Planning Area (EPA) and... Continental Shelf, Central Planning Area, Oil and Gas Lease Sale 216/222 AGENCY: Bureau of Ocean Energy... and Gas Lease Sale: 2012 Central Planning Area (CPA) Lease Sale 216/222 Authority: This NOA is...

  4. 30 CFR 77.216-2 - Water, sediment, or slurry impoundments and impounding structures; minimum plan requirements...

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Water, sediment, or slurry impoundments and impounding structures; minimum plan requirements; changes or modifications; certification. 77.216-2 Section... COAL MINES Surface Installations § 77.216-2 Water, sediment, or slurry impoundments and impounding...

  5. 50 CFR 216.16 - Prohibitions under the General Authorization for Level B harassment for scientific research.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Prohibitions under the General Authorization for Level B harassment for scientific research. 216.16 Section 216.16 Wildlife and Fisheries... Prohibitions under the General Authorization for Level B harassment for scientific research. It shall be...

  6. 50 CFR 216.46 - U.S. citizens on foreign flag vessels operating under the International Dolphin Conservation...

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false U.S. citizens on foreign flag vessels operating under the International Dolphin Conservation Program. 216.46 Section 216.46 Wildlife and Fisheries....46 U.S. citizens on foreign flag vessels operating under the International Dolphin Conservation...

  7. 41 CFR 302-3.216 - When must I begin my first tour renewal travel from Alaska or Hawaii?

    Science.gov (United States)

    2010-07-01

    ... first tour renewal travel from Alaska or Hawaii? 302-3.216 Section 302-3.216 Public Contracts and... must I begin my first tour renewal travel from Alaska or Hawaii? You must begin your first tour renewal travel within 5 years of your first consecutive tours in either Alaska or Hawaii. ...

  8. 30 CFR 77.216-4 - Water, sediment or slurry impoundments and impounding structures; reporting requirements...

    Science.gov (United States)

    2010-07-01

    ....216-4 Water, sediment or slurry impoundments and impounding structures; reporting requirements... reporting period. (4) Storage capacity of the impounding structure. (5) The volume of the impounded water... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Water, sediment or slurry impoundments and...

  9. 30 CFR 77.216-3 - Water, sediment, or slurry impoundments and impounding structures; inspection requirements...

    Science.gov (United States)

    2010-07-01

    ... structures; inspection requirements; correction of hazards; program requirements. (a) All water, sediment, or... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Water, sediment, or slurry impoundments and impounding structures; inspection requirements; correction of hazards; program requirements. 77.216-3 Section...

  10. Fission characteristics of 216 Ra formed in heavy-ion induced ...

    Indian Academy of Sciences (India)

    particles for 216Ra formed in 19F + 197Au reactions and results are compared with the experimental data. To calculate these quantities, the effects of temperature and spin K about the symmetry axis have been considered in the calculations of the ...

  11. 50 CFR 216.95 - Official mark for “Dolphin-safe” tuna products.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Official mark for âDolphin-safeâ tuna... AND IMPORTING OF MARINE MAMMALS Dolphin Safe Tuna Labeling § 216.95 Official mark for “Dolphin-safe... Department of Commerce that may be used to label tuna products that meet the “dolphin-safe” standards set...

  12. 50 CFR 216.200 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    ... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.200 Specified activity and...

  13. THE SUPERLUMINAL CHARACTER OF THE COMPACT STEEP SPECTRUM QUASAR 3C-216

    NARCIS (Netherlands)

    VENTURI, T; PEARSON, TJ; BARTHEL, PD; HERBIG, T

    We report the results of fourth epoch VLBI observations at 4990.99 MHz, with a resolution of approximately 1 mas, of the compact steep-spectrum quasar 3C 216. Superluminal motion in this object is confirmed. Although a constant superluminal expansion at upsilon(app) = 3.9c +/- 0.6 is not ruled out,

  14. Groundwater impact assessment for the 216-U-17 Crib, 200 West Area

    Energy Technology Data Exchange (ETDEWEB)

    Reidel, S.P.; Johnson, V.G.; Kline, N.W.

    1993-06-01

    As required by the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement milestone M-17-00A), this report assesses the impact to groundwater from discharge of process condensate to the ground at the 216-U-17 Crib. The assessment considers impacts associated with moisture movement through soil beneath the crib and the potential transport of contaminants to the groundwater.

  15. 40 CFR 90.903 - Exclusions, application of section 216 (10) and (11) of the Act.

    Science.gov (United States)

    2010-07-01

    ... a motor vehicle is deemed a nonroad engine, if it meets the definition in subpart A of this part. For the purpose of determining the applicability of section 216(11) of the Act, a vehicle powered by a... AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF EMISSIONS FROM NONROAD SPARK-IGNITION ENGINES AT...

  16. 29 CFR 825.216 - Limitations on an employee's right to reinstatement.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Limitations on an employee's right to reinstatement. 825... Family and Medical Leave Act § 825.216 Limitations on an employee's right to reinstatement. (a) An employee has no greater right to reinstatement or to other benefits and conditions of employment than if...

  17. 50 CFR 216.205 - Measures to ensure availability of species for subsistence uses.

    Science.gov (United States)

    2010-10-01

    ... Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.205 Measures to ensure... proposed activities and to resolve potential conflicts regarding timing and methods of operation; (b) A description of what measures the applicant has taken and/or will take to ensure that oil development...

  18. YB-1 expression promotes pancreatic cancer metastasis that is inhibited by microRNA-216a.

    Science.gov (United States)

    Lu, Jingjing; Li, Xiaohong; Wang, Fei; Guo, Yibing; Huang, Yan; Zhu, Hui; Wang, Yao; Lu, Yuhua; Wang, Zhiwei

    2017-10-15

    Pancreatic cancer is one of the most aggressive cancers. The vast majority of patients are diagnosed with advanced, unresectable disease because of early invasive growth and metastatic spread. The aim of this study was to examine YB-1 expression in pancreatic cancer and determine its effects on cell invasion. YB-1 is overexpressed in pancreatic cancer cell lines and patient tissue samples. In patient tissues, high YB-1 levels correlated with perineural invasion. Silencing of YB-1 significantly reduced cell invasion with decreased expression of MMPs in vitro. Furthermore, we found that the expression of YB-1 was suppressed by miR-216a via direct binding to the YB-1 3'-untranslated region. MiR-216a and YB-1 expression levels were inversely correlated in pancreatic cancer cell lines. In addition, ectopic expression of miR-216a inhibited cell invasion in vitro. Taken together, our findings suggest that YB-1 may play an important role in mediating metastatic behaviour and that repression of YB-1 by miR-216a could have a promising therapeutic potential to inhibit tumor metastasis in pancreatic cancer. Copyright © 2017. Published by Elsevier Inc.

  19. 50 CFR 216.250 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    ... Weapon Missions in the Gulf of Mexico § 216.250 Specified activity and specified geographical region. (a... within the Eglin Air Force Base Gulf Test and Training Range within the northern Gulf of Mexico. The... truncatus), Atlantic spotted dolphins (Stenella frontalis), dwarf sperm whales (Kogia simus) and pygmy sperm...

  20. 50 CFR 216.211 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    .... Gulf of Mexico § 216.211 Specified activity and specified geographical region. (a) Regulations in this... Mexico adjacent to the coasts of Texas, Mississippi, Louisiana, Alabama, and Florida. The incidental, but... dolphins, 27 Clymene dolphins, 12 rough-toothed dolphins, 14 striped dolphins, 15 melon-headed whales, 10...

  1. State Environmental Policy Act (SEPA) Environmental Checklist Form 216-B-3 Expansion Ponds Closure Plan. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    1993-12-01

    The 216-B-3 Expansion Ponds Closure Plan (Revision 1) consists of a Part A Dangerous Waste Permit Application and a Resource Conservation and Recovery Act Closure Plan. An explanation of the Part A submitted with this document is provided at the beginning of the Part A Section. The closure plan consists of nine chapters and five appendices. The 216-B-3 Pond System consists of a series of four earthen, unlined, interconnected ponds and the 216-B-3-3 Ditch that receive waste water from various 200 East Area operating facilities. These four ponds, collectively. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the 216-B-3-3 Ditch. Water discharged to the 216-8-3-3 Ditch flows directly into the 216-B-3 Pond. In the past, waste water discharges to B Pond and the 216-B-3-3 Ditch contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the nonradioactive dangerous portion of mixed waste is regulated under RCRA. Mixed waste also may be considered a hazardous substance under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) when considering remediation of waste sites.

  2. Regulation of the P2X7R by microRNA-216b in human breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Luming [Department of Breast and Thyroid, Jinan Military General Hospital, Jinan 250031, Shandong Province (China); Zhang, Xukui [Department of General Surgery, Jinan Military General Hospital, Jinan 250031, Shandong Province (China); Yang, Feng [Department of General Surgery, Shanghai Ninth People’s Hospital, Shanghai 200011 (China); Zhu, Jian; Zhou, Peng; Yu, Fang; Hou, Lei; Xiao, Lei; He, Qingqing [Department of Breast and Thyroid, Jinan Military General Hospital, Jinan 250031, Shandong Province (China); Wang, Baocheng, E-mail: wangbaocheng4w4@163.com [Department of Oncology, Jinan Military General Hospital, Jinan 250031, Shandong Province (China)

    2014-09-12

    Highlights: • We suggest the expression level of miR-216b and P2X7R in breast cancer tissues and cell lines. • We demonstrated that miR-216b directly targets and inhibits P2X7R. • We suggested miR-216b can attenuate ATP/P2X7R signaling pathways and induced Bcl-2/caspase-3 pathway. - Abstract: Breast cancer is the most common cancer in women around the world. However, the molecular mechanisms underlying breast cancer pathogenesis are only partially understood. Here, in this study, we found that P2X7R was up-regulated and miR-216b was down-regulated in breast cancer cell lines and tissues. Using bioinformatic analysis and 3′UTR luciferase reporter assay, we determined P2X7R can be directly targeted by miR-216b, which can down-regulate endogenous P2X7R mRNA and protein levels. Ectopic expression of miR-216b mimics leads to inhibited cell growth and apoptosis, while blocking expression of the miR-216b results in increased cell proliferation. Furthermore, our findings demonstrate that knockdown of P2X7R promotes apoptosis in breast cancer cells through down-regulating Bcl-2 and increasing the cleavage caspase-3 protein level. Finally, we confirmed that down-regulation of miR-216b in breast cancer is inversely associated with P2X7R expression level. Together, these findings establish miR-216b as a novel regulator of P2X7R and a potential therapeutic target for breast cancer.

  3. Endophytic microbes Bacillus sp. LZR216-regulated root development is dependent on polar auxin transport in Arabidopsis seedlings.

    Science.gov (United States)

    Wang, Jianfeng; Zhang, Yongqiang; Li, Ying; Wang, Xiaomin; Nan, Wenbin; Hu, Yanfeng; Zhang, Hong; Zhao, Chengzhou; Wang, Feng; Li, Ping; Shi, Hongyong; Bi, Yurong

    2015-06-01

    Endophytic microbes Bacillus sp. LZR216 isolated from Arabidopsis root promoted Arabidopsis seedlings growth. It may be achieved by promoting the lateral root growth and inhibiting the primary root elongation. Plant roots are colonized by an immense number of microbes, including epiphytic and endophytic microbes. It was found that they have the ability to promote plant growth and protect roots from biotic and abiotic stresses. But little is known about the mechanism of the endophytic microbes-regulated root development. We isolated and identified a Bacillus sp., named as LZR216, of endophytic bacteria from Arabidopsis root. By employing a sterile experimental system, we found that LZR216 promoted the Arabidopsis seedlings growth, which may be achieved by promoting the lateral root growth and inhibiting the primary root elongation. By testing the cell type-specific developmental markers, we demonstrated that Bacillus sp. LZR216 increases the DR5::GUS and DR5::GFP expression but decreases the CYCB1;1::GUS expression in Arabidopsis root tips. Further studies indicated that LZR216 is able to inhibit the meristematic length and decrease the cell division capability but has little effect on the quiescent center function of the root meristem. Subsequently, it was also shown that LZR216 has no significant effects on the primary root length of the pin2 and aux1-7 mutants. Furthermore, LZR216 down-regulates the levels of PIN1-GFP, PIN2-GFP, PIN3-GFP, and AUX1-YFP. In addition, the wild-type Arabidopsis seedlings in the present of 1 or 5 µM NPA (an auxin transport inhibitor) were insensitive to LZR216-inhibited primary root elongation. Collectively, LZR216 regulates the development of root system architecture depending on polar auxin transport. This study shows a new insight on the ability of beneficial endophytic bacteria in regulating postembryonic root development.

  4. Groundwater impact assessment report for the 216-Z-20 Crib, 200 West Area

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, V.G.

    1993-10-01

    As required by the Hanford Federal Facility Agreement and Consent Order ([Tri-Party Agreement] Milestone M-17-00A), this report assesses the impact of wastewater discharges to the 216-Z-20 Crib on groundwater quality. The assessment reported herein extends the initial analysis conducted from 1989 through 1990 for the Liquid Effluent Study Final Project Report. Three primary issues are addressed in response to regulator concerns with the initial analysis: The magnitude and status of the soil column transuranic inventory. Potential interactions of wastewater with carbon tetrachloride from adjacent facilities. Preferential pathways created by unsealed monitoring wells.

  5. A novel β(0)-thalassemia frameshift mutation: [HBB:c.216delT].

    Science.gov (United States)

    Konialis, Christopher; Hagnefelt, Birgitta; Sevastidou, Sophia; Pispili, Katerina; Pangalos, Constantinos

    2012-01-01

    A 33-year-old adult male of Greek ethnicity, with hematological indices suggesting β(0)-thalassemia (β(0)-thal) trait, was investigated for HBB gene mutations in the course of preparation for preimplantation genetic diagnosis (PGD). Application of a routine diagnostic protocol, consisting of sequence analysis of the HBB gene, coupled to multiplex ligation-dependent probe amplification (MLPA), identified a single nucleotide deletion (-T) at codon 72 [HBB: c.216delT], leading to a novel pathogenic frameshift and protein-truncating β(0)-thal mutation (p.Phe72LeufsX18).

  6. φX216, a P2-like bacteriophage with broad Burkholderia pseudomallei and B. mallei strain infectivity.

    Science.gov (United States)

    Kvitko, Brian H; Cox, Christopher R; DeShazer, David; Johnson, Shannon L; Voorhees, Kent J; Schweizer, Herbert P

    2012-12-07

    Burkholderia pseudomallei and B. mallei are closely related Category B Select Agents of bioterrorism and the causative agents of the diseases melioidosis and glanders, respectively. Rapid phage-based diagnostic tools would greatly benefit early recognition and treatment of these diseases. There is extensive strain-to-strain variation in B. pseudomallei genome content due in part to the presence or absence of integrated prophages. Several phages have previously been isolated from B. pseudomallei lysogens, for example φK96243, φ1026b and φ52237. We have isolated a P2-like bacteriophage, φX216, which infects 78% of all B. pseudomallei strains tested. φX216 also infects B. mallei, but not other Burkholderia species, including the closely related B. thailandensis and B. oklahomensis. The nature of the φX216 host receptor remains unclear but evidence indicates that in B. mallei φX216 uses lipopolysaccharide O-antigen but a different receptor in B. pseudomallei. The 37,637 bp genome of φX216 encodes 47 predicted open reading frames and shares 99.8% pairwise identity and an identical strain host range with bacteriophage φ52237. Closely related P2-like prophages appear to be widely distributed among B. pseudomallei strains but both φX216 and φ52237 readily infect prophage carrying strains. The broad strain infectivity and high specificity for B. pseudomallei and B. mallei indicate that φX216 will provide a good platform for the development of phage-based diagnostics for these bacteria.

  7. φX216, a P2-like bacteriophage with broad Burkholderia pseudomallei and B. mallei strain infectivity

    Directory of Open Access Journals (Sweden)

    Kvitko Brian H

    2012-12-01

    Full Text Available Abstract Background Burkholderia pseudomallei and B. mallei are closely related Category B Select Agents of bioterrorism and the causative agents of the diseases melioidosis and glanders, respectively. Rapid phage-based diagnostic tools would greatly benefit early recognition and treatment of these diseases. There is extensive strain-to-strain variation in B. pseudomallei genome content due in part to the presence or absence of integrated prophages. Several phages have previously been isolated from B. pseudomallei lysogens, for example φK96243, φ1026b and φ52237. Results We have isolated a P2-like bacteriophage, φX216, which infects 78% of all B. pseudomallei strains tested. φX216 also infects B. mallei, but not other Burkholderia species, including the closely related B. thailandensis and B. oklahomensis. The nature of the φX216 host receptor remains unclear but evidence indicates that in B. mallei φX216 uses lipopolysaccharide O-antigen but a different receptor in B. pseudomallei. The 37,637 bp genome of φX216 encodes 47 predicted open reading frames and shares 99.8% pairwise identity and an identical strain host range with bacteriophage φ52237. Closely related P2-like prophages appear to be widely distributed among B. pseudomallei strains but both φX216 and φ52237 readily infect prophage carrying strains. Conclusions The broad strain infectivity and high specificity for B. pseudomallei and B. mallei indicate that φX216 will provide a good platform for the development of phage-based diagnostics for these bacteria.

  8. Effect of Lanthanum on Microstructures and Properties of ASTM A216 Steel

    Directory of Open Access Journals (Sweden)

    Aiqin Wang

    2016-01-01

    Full Text Available In order to satisfy the rudder horn casting standards of the International Association of Classification Societies, the properties of ASTM A216 steel should be improved. Therefore, in this article the rudder horn casting and accompanying specimens were cast moulded by arc furnace smelting, external refining, and modification treatment of the molten steel by lanthanum. The samples were first underwent normalizing treatment at 900 °C for 10 hours, then air cooled, followed by tempering treatment at 600 °C for 7 hours and samples were air cooled again. The mechanical properties and microstructures of the samples were measured. The crystallography relationships between lanthanum compounds formed in the molten steel and primary δ-Fe were analysed. The nucleation effect of lanthanum compounds as a heterogeneous nucleation core of primary δ-Fe were calculated and discussed based on two-dimensional mismatch theory. The results indicated that the strip MnS inclusions in ASTM A216 steel became granular rare earth compound inclusions due to La. The refined microstructures were obtained by a synergistic effect of the enhanced condensate depression and the nucleation rate of melt and La compounds as the heterogeneous nucleation caused by La.

  9. The Xinglong 2.16-m Telescope: Current Instruments and Scientific Projects

    Science.gov (United States)

    Fan, Zhou; Wang, Huijuan; Jiang, Xiaojun; Wu, Hong; Li, Hongbin; Huang, Yang; Xu, Dawei; Hu, Zhongwen; Zhu, Yinan; Wang, Jianfeng; Komossa, Stefanie; Zhang, Xiaoming

    2016-11-01

    The Xinglong 2.16-m reflector is the first 2-m class astronomical telescope in China. It was jointly designed and built by the Nanjing Astronomical Instruments Factory (NAIF), Beijing Astronomical Observatory (now National Astronomical Observatories, Chinese Academy of Sciences, NAOC), and Institute of Automation, Chinese Academy of Sciences in 1989. It is a Ritchey-Chrétien (R-C) reflector on an English equatorial mount and the effective aperture is 2.16 m. It had been the largest optical telescope in China for ˜18 years until the Guoshoujing Telescope (also called Large Sky Area Multi-Object Fiber Spectroscopic Telescope, LAMOST) and the Lijiang 2.4-m telescope were built. At present, there are three main instruments on the Cassegrain focus available: the Beijing Faint Object Spectrograph and Camera (BFOSC) for direct imaging and low-resolution (R ˜ 500-2000) spectroscopy, the spectrograph made by Optomechanics Research Inc. (OMR) for low-resolution spectroscopy (the spectral resolutions are similar to those of BFOSC) and the fiber-fed High Resolution Spectrograph (HRS; R ˜ 30,000-65,000). The telescope is widely open to astronomers all over China as well as international astronomical observers. Each year there are more than 40 ongoing observing projects, including 6-8 key projects. Recently, some new techniques and instruments (e.g., astro-frequency comb calibration system, polarimeter, and adaptive optics) have been or will be tested on the telescope to extend its observing abilities.

  10. Hirschsprung′s disease: Role of rectal suction biopsy - data on 216 specimens

    Directory of Open Access Journals (Sweden)

    Rahman Zillur

    2010-01-01

    Full Text Available Background: The diagnosis of Hirschsprung′s disease (HD is dependent on the histological study of rectal ganglion cells, and an open rectal biopsy was the mainstay that required general anaesthesia (GA and carried risk of postoperative rectal bleeding. Suction rectal biopsy later gained wide acceptance and became the choice as there is no requirement of GA and virtual absence of any complications. Materials and Methods: A retrospective review of the histological findings of 216 rectal suction biopsies studied from 2005 to 2009. Results: There were 143 male and 73 female children. 196 (90.7% children were within 1 year of age. Among 216 rectal suction biopsies 181 (83.80% were aganglionic, 27 (12.5% were ganglionic and 8 (3.7% were inadequate. Majority of patients were of less than 1 year of age (94.47%. Conclusions : The rectal suction biopsy is a bed side procedure, safe, cheap and time saving. There is high degree of accuracy, simplicity and absence of complications.

  11. Basal metabolic rate of Colombian children 2-16 y of age: ethnicity and nutritional status.

    Science.gov (United States)

    Spurr, G B; Reina, J C; Hoffmann, R G

    1992-10-01

    Measurements of basal metabolic rate (BMR) were made in 528 children 2-16 y of age living in underprivileged areas of the city of Cali, Colombia (153 control and 186 undernourished boys, 93 control and 96 undernourished girls). The data are related to BMR calculated from the equations of Schofield and to estimates of the lean body mass (LBM). The ethnic composition of the subjects was 80% mestizo (mixed European and South Amerindian ancestry), 15% black, and 5% white. The data do not show any variations due to race in these subjects. The Schofield equations overestimate the BMR of boys by approximately 6% whereas the estimation of BMR in girls is not significantly different from measured values. More than 65% of the variation in BMR of both nutritionally normal and undernourished boys and girls is explained by variation in body size as estimated by the LBM.

  12. miR-216 and miR-217 expression is reduced in transgenic mouse models of pancreatic adenocarcinoma, knockout of miR-216/miR-217 host gene is embryonic lethal.

    Science.gov (United States)

    Azevedo-Pouly, Ana Clara P; Sutaria, Dhruvitkumar S; Jiang, Jinmai; Elgamal, Ola A; Amari, Foued; Allard, David; Grippo, Paul J; Coppola, Vincenzo; Schmittgen, Thomas D

    2017-05-01

    Mice harboring a G12D activating Kras mutation are among the most heavily studied models in the field of pancreatic adenocarcinoma (PDAC) research. miRNAs are differentially expressed in PDAC from patients and mouse models of PDAC. To better understand the relationship that Kras activation has on miRNA expression, we profiled the expression of 629 miRNAs in RNA isolated from the pancreas of control, young, and old P48(+/Cre);LSL-KRAS(G12D) as well as PDX-1-Cre;LSL-KRAS(G12D) mice. One hundred of the differentially expressed miRNAs had increased expression in the advanced disease (old) P48(+/Cre);LSL-KRAS(G12D) compared to wild-type mice. Interestingly, the expression of three miRNAs, miR-216a, miR-216b, and miR-217, located within a ∼30-kbp region on 11qA3.3, decreased with age (and phenotype severity) in these mice. miR-216/-217 expression was also evaluated in another acinar-specific ELa-Kras(G12D) mouse model and was downregulated as well. As miR-216/-217 are acinar enriched, reduced in human PDAC and target KRAS, we hypothesized that they may maintain acinar differentiation or represent tumor suppressive miRNAs. To test this hypothesis, we deleted a 27.9-kbp region of 11qA3.3 containing the miR-216/-217 host gene in the mouse's germ line. We report that germ line deletion of this cluster is embryonic lethal in the mouse. We estimate that lethality occurs shortly after E9.5. qPCR analysis of the miR-216b and miR-217 expression in the heterozygous animals showed no difference in expression, suggesting haplosufficiency by some type of compensatory mechanism. We present the differential miRNA expression in Kras(G12D) transgenic mice and report lethality from deletion of the miR-216/-217 host gene in the mouse's germ line.

  13. 48 CFR 52.216-30 - Time-and-Materials/Labor-Hour Proposal Requirements-Non-Commercial Item Acquisition without...

    Science.gov (United States)

    2010-10-01

    ...-Hour Proposal Requirements-Non-Commercial Item Acquisition without Adequate Price Competition. 52.216... Price Competition. As prescribed in 16.601(e)(2), insert the following provision: Time-and-Materials/Labor-Hour Proposal Requirements—Non-Commercial Item Acquisition Without Adequate Price Competition (FEB...

  14. 50 CFR 216.92 - Dolphin-safe requirements for tuna harvested in the ETP by large purse seine vessels.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Dolphin-safe requirements for tuna... MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Dolphin Safe Tuna Labeling § 216.92 Dolphin-safe requirements for tuna harvested in the ETP by large purse seine vessels. (a) U.S...

  15. Constraints on the size of Asteroid (216) Kleopatra using stress analysis

    Science.gov (United States)

    Hirabayashi, M.; Scheeres, D. J.

    2013-12-01

    We investigate the stable size of Asteroid (216) Kleopatra by considering structural constraints on this body. Comprehensive radar observations (Ostro et al. 2000, Science) were used to estimate a shape model for this asteroid. Their estimation revealed that the shape looks like a dog-bone, the mean radius is 54.3 km (with uncertainty as large as 25%), and the surface seems similar to lunar surface regolith. However, 10 years later, Descamps et al. (2011, Icarus) performed near-infrared adaptive optics (AO) imaging with the W.M. Keck II telescope and found that although the shape may be consistent with their observation result, their size appeared to be larger than the Ostro size (by a factor of about 1.24). Our motivation in this study is to investigate structural stability constraints on the size of this asteroid. Across the stated range of uncertainty we find significant differences in the necessary angle of friction and cohesion for the body to avoid plastic deformation. We use the following physical parameters as fixed: a mass of 4.64e18 kg (Descamps et al. 2011, Icarus), a rotation period of 5.385 hr (Magnusson 1990, Icarus), and the Ostro et al. shape. We use the Drucker-Prager criterion to describe the rheology of the asteroid's material. Furthermore, we determine the friction angle from the fact that the surface of this asteroid is similar to lunar surface regolith, whose porosity ranges from 33% to 55%. According to Scott (1963), a soil with porosity of 44% (the mean value of the lunar surface porosity) has a friction angle of 32 degrees (which we use as our nominal value). Since the interior structure is unknown, we assume that the body is homogeneous. We first analyze the stable size by using the upper bound theorem from limit analysis on the assumption that this asteroid's materials are cohesionless. Based on this theorem, for any static surface traction and body force, the yield due to a smooth and convex yield envelope associated with the volume

  16. Groundwater Monitoring Plan for the Hanford Site 216-B-3 Pond RCRA Facility

    Energy Technology Data Exchange (ETDEWEB)

    Barnett, D BRENT.; Smith, Ronald M.; Chou, Charissa J.; McDonald, John P.

    2005-11-01

    The 216-B-3 Pond system was a series of ponds used for disposal of liquid effluent from past Hanford production facilities. In operation from 1945 to 1997, the B Pond System has been a Resource Conservation and Recovery Act (RCRA) facility since 1986, with RCRA interim-status groundwater monitoring in place since 1988. In 1994 the expansion ponds of the facility were clean closed, leaving only the main pond and a portion of the 216-B-3-3 ditch as the currently regulated facility. In 2001, the Washington State Department of Ecology (Ecology) issued a letter providing guidance for a two-year, trial evaluation of an alternate, intrawell statistical approach to contaminant detection monitoring at the B Pond system. This temporary variance was allowed because the standard indicator-parameters evaluation (pH, specific conductance, total organic carbon, and total organic halides) and accompanying interim status statistical approach is ineffective for detecting potential B-Pond-derived contaminants in groundwater, primarily because this method fails to account for variability in the background data and because B Pond leachate is not expected to affect the indicator parameters. In July 2003, the final samples were collected for the two-year variance period. An evaluation of the results of the alternate statistical approach is currently in progress. While Ecology evaluates the efficacy of the alternate approach (and/or until B Pond is incorporated into the Hanford Facility RCRA Permit), the B Pond system will return to contamination-indicator detection monitoring. Total organic carbon and total organic halides were added to the constituent list beginning with the January 2004 samples. Under this plan, the following wells will be monitored for B Pond: 699-42-42B, 699-43-44, 699-43-45, and 699-44-39B. The wells will be sampled semi-annually for the contamination indicator parameters (pH, specific conductance, total organic carbon, and total organic halides) and annually for

  17. Characterization and antimicrobial activity of bacteriocin 217 produced by natural isolate Lactobacillus paracasei subsp. paracasei BGBUK2-16.

    Science.gov (United States)

    Lozo, Jelena; Vukasinovic, Maja; Strahinic, Ivana; Topisirovic, Ljubisa

    2004-12-01

    The strain Lactobacillus paracasei subsp. paracasei BGBUK2-16. which was isolated from traditionally homemade white-pickled cheese, produces bacteriocin 217 (Bac217; approximately 7 kDa). The onset of Bac217 biosynthesis was observed in the logarithmic phase of growth, and the production plateau was reached after 9 or 12 h of incubation at 37 and 30 degrees C, respectively, when culture entered the early stationary phase. Biochemical characterization showed that Bac217 retained antimicrobial activity within the range of pH 3 to 12 or after treatment at 100 degrees C for 15 min. Bac217 antimicrobial activity also remained unchanged after storage at 4 degrees C for 6 months or -20 degrees C for up to 12 months. However, Bac217 activity was completely lost after treatment with different proteolytic enzymes. BGBUK2-16 contains only one plasmid about 80 kb in size. Plasmid curing indicated that genes coding for Bac217 synthesis and immunity seem to be located on this plasmid. Bac217 exhibited antimicrobial activity against some pathogenic bacteria, such as Staphylococcus aureus and Bacillus cereus. Interestingly, Bac217 showed activity against Salmonella sp. and Pseudomonas aeruginosa ATCC27853. The inhibitory effect of BGBUK2-16 on the growth of S. aureus in mixed culture was observed. S. aureus treatment with Bac217 led to a considerable decrease (CFU/ml) within a short period of time. The mode of Bac217 action on S. aureus was identified as bactericidal. It should be noted that the strain BGBUK2-16 was shown to be resistant to bacteriocin nisin, which is otherwise widely used as a food additive for fermented dairy products.

  18. IRC +10 216 in 3D: morphology of a TP-AGB star envelope

    Science.gov (United States)

    Guélin, M.; Patel, N. A.; Bremer, M.; Cernicharo, J.; Castro-Carrizo, A.; Pety, J.; Fonfría, J. P.; Agúndez, M.; Santander-García, M.; Quintana-Lacaci, G.; Velilla Prieto, L.; Blundell, R.; Thaddeus, P.

    2018-02-01

    During their late pulsating phase, AGB stars expel most of their mass in the form of massive dusty envelopes, an event that largely controls the composition of interstellar matter. The envelopes, however, are distant and opaque to visible and NIR radiation: their structure remains poorly known and the mass-loss process poorly understood. Millimeter-wave interferometry, which combines the advantages of longer wavelength, high angular resolution and very high spectral resolution is the optimal investigative tool for this purpose. Mm waves pass through dust with almost no attenuation. Their spectrum is rich in molecular lines and hosts the fundamental lines of the ubiquitous CO molecule, allowing a tomographic reconstruction of the envelope structure. The circumstellar envelope IRC +10 216 and its central star, the C-rich TP-AGB star closest to the Sun, are the best objects for such an investigation. Two years ago, we reported the first detailed study of the CO(2-1) line emission in that envelope, made with the IRAM 30-m telescope. It revealed a series of dense gas shells, expanding at a uniform radial velocity. The limited resolution of the telescope (HPBW 11″) did not allow us to resolve the shell structure. We now report much higher angular resolution observations of CO(2-1), CO(1-0), CN(2-1) and C4H(24-23) made with the SMA, PdB and ALMA interferometers (with synthesized half-power beamwidths of 3″, 1″ and 0.3″, respectively). Although the envelope appears much more intricate at high resolution than with an 11″ beam, its prevailing structure remains a pattern of thin, nearly concentric shells. The average separation between the brightest CO shells is 16″ in the outer envelope, where it appears remarkably constant. Closer to the star (states), NSF (USA) and NINS (Japan), together with NRC (Canada), NSC and ASIAA (Taiwan) and KASI (Republic of Korea), in cooperation with the Republic of Chile. The Joint ALMA Observatory is operated by ESO, AUI/NRAO and

  19. VizieR Online Data Catalog: Variable stars in the globular cluster DDO 216-A1 (Cole+, 2017)

    Science.gov (United States)

    Cole, A. A.; Weisz, D. R.; Skillman, E. D.; Leaman, R.; Williams, B. F.; Dolphin, A. E.; Johnson, L. C.; McConnachie, A. W.; Boylan-Kolchin, M.; Dalcanton, J.; Governato, F.; Madau, P.; Shen, S.; Vogelsberger, M.

    2017-10-01

    We observed the Pegasus dwarf irregular (PegDIG; DDO216) using the Advanced Camera for Surveys Wide Field Camera (ACS/WFC) as part of the Cycle 22 program GO-13768. The observations, which comprise 34.3 and 37.4ks in the F814W (Broad I band) and F475W (Sloan g band) filters, respectively, were made between 2015 July 23 and 26 using HST. Parallel observations at a distance of ~6' were obtained simultaneously through the equivalent filters on the Wide Field Camera 3. (1 data file).

  20. Vadose Zone Contaminant Fate and Transport Analysis for the 216-B-26 Trench

    Energy Technology Data Exchange (ETDEWEB)

    Ward, Andy L.; Gee, Glendon W.; Zhang, Z. F.; Keller, Jason M.

    2004-10-14

    The BC Cribs and Trenches, part of the 200 TW 1 OU waste sites, received about 30 Mgal of scavenged tank waste, with possibly the largest inventory of 99Tc ever disposed to the soil at Hanford and site remediation is being accelerated. The purpose of this work was to develop a conceptual model for contaminant fate and transport at the 216-B-26 Trench site to support identification and development and evaluation of remediation alternatives. Large concentrations of 99Tc high above the water table implicated stratigraphy in the control of the downward migration. The current conceptual model accounts for small-scale stratigraphy; site-specific changes soil properties; tilted layers; and lateral spreading. It assumes the layers are spatially continuous causing water and solutes to move laterally across the boundary if conditions permit. Water influx at the surface is assumed to be steady. Model parameters were generated with pedotransfer functions; these were coupled high resolution neutron moisture logs that provided information on the underlying heterogeneity on a scale of 3 inches. Two approaches were used to evaluate the impact of remedial options on transport. In the first, a 1-D convolution solution to the convective-dispersive equation was used, assuming steady flow. This model was used to predict future movement of the existing plume using the mean and depth dependent moisture content. In the second approach, the STOMP model was used to first predict the current plume distribution followed by its future migration. Redistribution of the 99Tc plume was simulated for the no-action alternative and on-site capping. Hypothetical caps limiting recharge to 1.0, 0.5, and 0.1 mm yr-1 were considered and assumed not to degrade in the long term. Results show that arrival time of the MCLs, the peak arrival time, and the arrival time of the center of mass increased with decreasing recharge rate. The 1-D convolution model is easy to apply and can easily accommodate initial

  1. 40 CFR 265 interim status indicator-evaluation ground-water monitoring plan for the 216-B-63 trench

    Energy Technology Data Exchange (ETDEWEB)

    Bjornstad, B.N.; Dudziak, S.

    1989-03-01

    This document outlines a ground-water monitoring plan for the 216-B-63 trench located in the northeast corner of the 200-East Area on the Hanford Site in southeastern Washington State. It has been determined that hazardous materials (corrosives) were disposed of to the trench during past operations. Installation of an interim-status ground-water monitoring system is required to determine whether hazardous chemicals are leaching to the ground water from beneath the trench. This document summarizes the existing data that are available from near the 216-B-63 trench and presents a plan to determine the extent of ground-water contamination, if any, derived from the trench. The plan calls for the installation of four new monitoring wells located near the west end of the trench. These wells will be used to monitor ground-water levels and water quality immediately adjacent to the trench. Two existing RCRA monitoring wells, which are located near the trench and hydraulically upgradient of it, will be used as background wells. 46 refs., 15 figs., 12 tabs.

  2. Knockdown of lncRNA CCAT2 inhibits endometrial cancer cells growth and metastasis via sponging miR-216b.

    Science.gov (United States)

    Xie, Pengmu; Cao, Hongying; Li, Ying; Wang, Jianhua; Cui, Zhumei

    2017-12-12

    Colon cancer-associated transcript 2 (CCAT2), a novel lncRNA has been reported as an oncogene in several cancers. This study was aimed to explore whether CCAT2 also exerted oncogenic roles in endometrial cancer cells. The expression of CCAT2 in 30 pairs of endometrial cancer and matched non-cancerous tissues were detected by qRT-PCR. Two endometrial cancer cell lines HEC-1-A and RL95-2 were used throughout this study. CCAT2 in cells was silenced by transfection with shRNA targeted CCAT2, then cell growth and metastasis were assessed by performing trypan blue staining, Transwell assay, and flow cytometry. Dual-luciferase reporter assay was used to detect the combination of miR-216b and CCAT2. Besides, the expression of miR-216b and Bcl-2 in cells were overexpressed or suppressed by transfection with their correspondingly mimic/vector or inhibitor/shRNA. qRT-PCR and western blot analysis were performed to detect the expression of Bcl-2 and main factors in PTEN/PI3K/AKT and mTOR signaling pathways. CCAT2 was highly expressed in endometrial cancer tissues when compared to non-cancerous endometrial tissues. Knockdown of CCAT2 inhibited HEC-1-A and RL95-2 cells viability, migration, invasion, but induced apoptosis. CCAT2 was an endogenous sponge by competing for miR-216b, and miR-216b suppression alleviated CCAT2 silence-diminished cell growth and metastasis. miR-216b negatively regulated Bcl-2 and Bcl-2 could further active PTEN/PI3K/AKT and mTOR signaling pathways. To conclude, these results demonstrated lncRNA CCAT2 was highly expressed in endometrial cancer tissues. Knockdown of CCAT2 inhibited cell growth and metastasis of endometrial cancer cells by sponging miR-216b.

  3. Carbon Tetrachloride Flow and Transport in the Subsurface of the 216-Z-18 Crib and 216-Z-1A Tile Field at the Hanford Site: Multifluid Flow Simulations and Conceptual Model Update

    Energy Technology Data Exchange (ETDEWEB)

    Oostrom, Mart; Rockhold, Mark L.; Thorne, Paul D.; Last, George V.; Truex, Michael J.

    2006-10-31

    Carbon tetrachloride (CT) was discharged to the 216-Z-9, Z-1A, and Z-18 waste sites that are included in the 200-PW-1 Operable Unit in Hanford 200 West Area. Fluor Hanford, Inc. is conducting a Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) remedial investigation/feasibility study (RI/FS) for the 200-PW-1 Operable Unit. As part of this overall effort, Pacific Northwest National Laboratory (PNNL) was contracted to improve the conceptual model of how CT is distributed in the Hanford 200 West Area subsurface through use of numerical flow and transport modeling. This work supports the U.S. Department of Energy's (DOE's) efforts to characterize the nature and distribution of CT in the 200 West Area and subsequently select an appropriate final remedy.

  4. Multi-Frequency Monitoring of the Flat Spectrum Radio Quasar PKS 1222+216 in 2008–2015

    Directory of Open Access Journals (Sweden)

    Ivan Troitskiy

    2016-11-01

    Full Text Available We analyze the broadband activity of the flat spectrum radio quasar PKS 1222+216 from 2008 to 2015 using multi-frequency monitoring which involves γ-ray data from the Fermi Large Area Telescope, total intensity and linear polarization observations from different optical telescopes in R band, and imaging of the inner jet structure with the Very Long Baseline Array (VLBA at 43 GHz. During the observations, the source showed several dramatic flares at γ rays and optical bands, with the rising branch of a γ-ray flare accompanied by a rapid rotation of the polarization position angle (EVPA, a fast increase of the degree of polarization in the optical band, brightening of the VLBI core, and appearance of a new superluminal component in the parsec-scale jet. The rapid variability of the optical linear polarization may be explained by a strong turbulence in the jet plasma. We find a correlation between the γ rays, optical R band, and 43 GHz variability on a long-term scale (months and years, and a good general alignment between EVPAs in R band and at 43 GHz, while the correlation between short-term variations (days and weeks is weaker. Synchronous activity across the bands supports the idea that the emission regions responsible for the γ-ray and optical flares are co-spatial and located in the vicinity of the mm-wave core of the parsec-scale jet. However, these connections do not completely explain the challenging behaviour of PKS 1222+216, since there are some γ-ray flares which are not accompanied by jet events, and vice versa. We need a continuation of multi-frequency monitoring along with high resolution imaging of the parsec-scale jet to understand in detail the origin of high energy emission in blazars.

  5. One Day Every 216 Years, Three Days Each Decan. Rebirth Cycle of Pythagoras, Phoenix, Hazon Gabriel, and Christian Dogma of Resurrection Can Be Explained by the Metonic Cycle

    Science.gov (United States)

    Rothwangl, S.

    2009-08-01

    This article explains how the Metonic cycle is at the base of the period of 216 years Pythagoras believed in being reborn after that period. It shows how this period calendrically is related to other mythological worldviews such as the Phoenix myth, the Hebrean Hazon Gabriel, and the Christian dogma of resurrection on the third day.

  6. 47 CFR 90.259 - Assignment and use of frequencies in the bands 216-220 MHz and 1427-1432 MHz.

    Science.gov (United States)

    2010-10-01

    ... 216-220 MHz and 1427-1432 MHz. 90.259 Section 90.259 Telecommunication FEDERAL COMMUNICATIONS... performed in the 1427-1429 MHz and 1431.5-1432 MHz bands. The maximum ERP limitations are as follows...) For all other locations, primary operations are performed in the 1429.5-1432 MHz band. The maximum ERP...

  7. IUPAC critical evaluation of the rotational-vibrational spectra of water vapor, Part III: Energy levels and transition wavenumbers for H216O

    Science.gov (United States)

    Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Császár, Attila G.; Daumont, Ludovic; Gamache, Robert R.; Hodges, Joseph T.; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Vandaele, Ann Carine; Zobov, Nikolai F.; Al Derzi, Afaf R.; Fábri, Csaba; Fazliev, Alexander Z.; Furtenbacher, Tibor; Gordon, Iouli E.; Lodi, Lorenzo; Mizus, Irina I.

    2013-03-01

    This is the third of a series of articles reporting critically evaluated rotational-vibrational line positions, transition intensities, and energy levels, with associated critically reviewed labels and uncertainties, for all the main isotopologues of water. This paper presents experimental line positions, experimental-quality energy levels, and validated labels for rotational-vibrational transitions of the most abundant isotopologue of water, H216O. The latest version of the MARVEL (Measured Active Rotational-Vibrational Energy Levels) line-inversion procedure is used to determine the rovibrational energy levels of the electronic ground state of H216O from experimentally measured lines, together with their self-consistent uncertainties, for the spectral region up to the first dissociation limit. The spectroscopic network of H216O containstwo components, an ortho (o) and a para (p) one. For o-H216O and p-H216O, experimentally measured, assigned, and labeled transitions were analyzed from more than 100 sources. The measured lines come from one-photon spectra recorded at room temperature in absorption, from hot samples with temperatures up to 3000 K recorded in emission, and from multiresonance excitation spectra which sample levels up to dissociation. The total number of transitions considered is 184 667 of which 182 156 are validated: 68 027 between para states and 114 129 ortho ones. These transitions give rise to 18 486 validated energy levels, of which 10 446 and 8040 belong to o-H216O and p-H216O, respectively. The energy levels, including their labeling with approximate normal-mode and rigid-rotor quantum numbers, have been checked against ones determined from accurate variational nuclear motion computations employing exact kinetic energy operators as well as against previous compilations of energy levels. The extensive list of MARVEL lines and levels obtained are deposited in the supplementary data of this paper, as well as in a distributed information system

  8. The tolerability of a combined hepatitis A and typhoid vaccine in children aged 2-16 years: an observational study.

    Science.gov (United States)

    Lau, Colleen L; Streeton, Catherine L; David, Michael C; Sly, Peter D; Mills, Deborah J

    2016-02-01

    Combined hepatitis A and typhoid vaccines have been widely used globally and proven to be safe, well tolerated and efficacious in adults. The combined hepatitis A and typhoid vaccine (Vivaxim) available in Australia is licenced for use from age 16 years but the monovalent components are approved for use from age 2 years. Advantages of a single injection have led to widespread 'off-label' use of Vivaxim in children. This study aimed to investigate the tolerability of Vivaxim in children aged 2-16 years. A prospective observational study was conducted at Travel Medicine Alliance clinics across Australia. Children who required vaccination for both hepatitis A and typhoid were offered the option of receiving Vivaxim. Parents were contacted 3 days post-vaccination and asked to respond to a questionnaire on adverse events following immunization (AEFIs). Reactions to Vivaxim were compared with reported reactions to the monovalent vaccines. Our study included 425 children who received Vivaxim, including 189 (44.5%) who received other vaccines on the same day. No serious AEFIs were reported, and 26.8% did not experience any side effects. In children who did not receive other vaccines in the same arm as Vivaxim (n = 325), most common local reactions were sore arm (70.5%), redness (16.0%) and swelling (11.1%). Reports of local AEFIs in our subjects was significantly more common than those reported for the individual monovalent vaccines. In children who did not receive other vaccines on the same day (n = 236), the most common systemic reactions were tiredness/lethargy/malaise (5.9%), headache (4.2%), fever (3.4%) and sore muscles and joints (3.4%). Fever was more common in children aged <6 years. Less than 5% of children reported missing school, sport or other regular activities. Vivaxim was well tolerated in children aged 2-16 years. Parents should be advised about AEFIs to Vivaxim so that they can make informed decisions about vaccination options. © International

  9. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2013. Scientific Opinion on Flavouring Group Evaluation 216, Revision 1 (FGE.216Rev1). Consideration of genotoxic potential for α,β-unsaturated 2-Phenyl -2-Alkenals from Subgroup 3.3 of FGE.19

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of five flavouring substances from subgroup 3.3 of FGE.19. In the Flavouring Group Evaluation 216 (FGE.216) additional genotoxicity...... data were requested. Additional genotoxicity studies have now been provided for the representative substance 2-phenylcrotonaldehyde [FL-no: 05.062]. Based on these new data the Panel concluded that the concern for genotoxicity could not be ruled out and requests a proof of sufficient systemic exposure...

  10. A simulation study of the performance of the NASA (2,1,6) convolutional code on RFI/burst channels

    Science.gov (United States)

    Perez, Lance C.; Costello, Daniel J., Jr.

    1993-11-01

    In an earlier report, the LINKABIT Corporation studied the performance of the (2,1,6) convolutional code on the radio frequency interference (RFI)/burst channel using analytical methods. Using an R(sub 0) analysis, the report concluded that channel interleaving was essential to achieving reliable performance. In this report, Monte Carlo simulation techniques are used to study the performance of the convolutional code on the RFI/burst channel in more depth. The basic system model under consideration is shown. The convolutional code is the NASA standard code with generators g(exp 1) = 1+D(exp 2)+D(exp 3)+D(exp 5)+D(exp 6) and g(exp 2) = 1+D+D(exp 2)+D(exp 3)+D(exp 6) and d(sub free) = 10. The channel interleaver is of the convolutional or periodic type. The binary output of the channel interleaver is transmitted across the channel using binary phase shift keying (BPSK) modulation. The transmitted symbols are corrupted by an RFI/burst channel consisting of a combination of additive white Gaussian noise (AWGN) and RFI pulses. At the receiver, a soft-decision Viterbi decoder with no quantization and variable truncation length is used to decode the deinterleaved sequence.

  11. Urinary tract changes in obstetric vesico-vaginal fistulae: a report of 216 cases studied by intravenous urography.

    Science.gov (United States)

    Lagundoye, S B; Bell, D; Gill, G; Ogunbode, O

    1976-10-01

    Intravenous urographies carried out routinely on 216 cases of vesico-vaginal fistulae were reviewed. All the patients had suffered from urinary incontinence following obstructed labour for periods varying from immediate post-partum period to as long as 35 years with the majority (48%) presenting in the first year of the disease. One hundred and eleven patients (51-4%) showed no urinary tract abnormality. Calyceal abnormality was graded from 1-5 in ascending order of severity. The most frequent abnormality was Grade 1 (or minimal calyceal blunting) found in 75 (71%) of 105 cases showing lesions. Ten patients had non-functioning kidneys. There was no correlation of severity of calyceal grading with duration of the disease. Other notable changes were hydroureter in 75 (34%), medial deviation of the terminal ureters in 21 (9-7%) and bladder calculi in four. The study reveals a high risk of morbidity to the kidneys in patients with vesico-vaginal fistulae and the predominant role of fibrous itssue in tis genesis is postulated.

  12. Influence of intermartensitic transitions on transport properties of Ni$_{2.16}Mn_{0.84}$Ga alloy

    CERN Document Server

    Khovailo, V V; Wedel, C; Takagi, T; Abe, T; Sugiyama, K

    2004-01-01

    Magnetic, transport, and x-ray diffraction measurements of ferromagnetic shape memory alloy Ni$_{2.16}$Mn$_{0.84}$Ga revealed that this alloy undergoes an intermartensitic transition upon cooling, whereas no such a transition is observed upon subsequent heating. The difference in the modulation of the martensite forming upon cooling from the high-temperature austenitic state [5-layered (5M) martensite], and the martensite forming upon the intermartensitic transition [7-layered (7M) martensite] strongly affects the magnetic and transport properties of the alloy and results in a large thermal hysteresis of the resistivity $\\rho$ and magnetization $M$. The intermartensitic transition has an especially marked influence on the transport properties, as is evident from a large difference in the resistivity of the 5M and 7M martensite, $(\\rho_{\\mathrm{5M}} - \\rho_{\\mathrm{7M}})/\\rho _{\\mathrm{5M}} \\approx 15%$, which is larger than the jump of resistivity at the martensitic transition from the cubic austenitic phase ...

  13. Advanced Hodgkin's lymphoma: results in 216 patients treated with ABVD in Brazil Linfoma de Hodgkin em estádio avançado: resultados do tratamento em 216 pacientes tratados com ABVD no Brasil

    Directory of Open Access Journals (Sweden)

    Luciana Britto

    2010-01-01

    Full Text Available The outcome of Hodgkin's lymphoma (HL has markedly improved over the last few decades, placing HL among the human cancers with highest cure rates. However, data about treatment outcomes in developing countries are scarce. From 1996 to 2005, 370 consecutive patients with HL treated in three public institutions in Rio de Janeiro were identified. A total of 216 patients who presented with advanced stage (IIB-IV HL were selected for the present analysis. Patients with advanced disease were treated with ABVD, complemented or not by radiation therapy. The median follow-up time of survivors was 6.3 years (1-11.8. Fifteen patients died during first-line treatment. The complete remission rate was 80%. The 5-year progression-free survival (PFS and the 5-year overall survival (OS probabilities were 69% and 83%, respectively. The 5-year PFS in low-risk and high-risk patients were 81% and 62% (p=0.003, respectively. The 5-year OS in low-risk and high-risk International Prognostic Score patients were 89% and 78% (p=0.02, respectively. The present study provides a representative estimate of current treatment results for advanced HL in public institutions in an urban area in Brazil. It is clear that full treatment can be given to most patients, although those with very low socio-economic status might require special attention and support. Since Brazil is a large country, with substantial interregional heterogeneity, a nationwide registry of HL patients is currently being implemented.Os resultados do tratamento do linfoma de Hodgkin (LH melhoraram substancialmente ao longo das últimas décadas e tornaram o LH uma das neoplasias humanas com maior chance de cura. Entretanto, os dados sobre tratamento em países em desenvolvimento são escassos. Entre 1996 e 2005, 370 pacientes consecutivos com LH tratados em três instituições públicas no Rio de Janeiro foram identificados. Destes, 216 em estádio avançado (IIB-IV foram selecionados para esta análise. Os

  14. 1,25-(OH)2-16ene-23yne-D3 reduces secondary hyperparathyroidism in uremic rats with little calcemic effect.

    Science.gov (United States)

    Lippuner, Kurt; Perrelet, Romain; Casez, Jean-Paul; Popp, Albrecht; Uskokovic, Milan R; Jaeger, Philippe

    2004-01-01

    To compare the effects of vitamin D analogs versus calcitriol on serum levels of Ca, P and parathyroid hormone (PTH). A compound better than calcitriol should increase the Ca x P product less than calcitriol for an equivalent decrease in PTH levels. Biological activity of 4 vitamin D analogs, 1,25-(OH)(2)-16ene- D(3) (RO(1)), 1,25-(OH)(2)-16ene-23yne-D(3) (RO(2)), 1,25-(OH)(2)-26,27-hexafluoro-16ene-23yne-D(3) (RO(3)) and 1,25-(OH)(2)-16ene-23yne-26,27-hexafluoro-19nor-D(3) (RO(4)) was tested vs. calcitriol in parathyroidectomized rats. In a second set of experiments, the effects of RO(2), RO(4) and calcitriol were studied in 5/6 nephrectomized rats with secondary hyperparathyroidism. In parathyroidectomized rats, all analogs (250 pmol/day) led calcemia to rise after 7 days. In uremic rats, all treatments reduced PTH levels. RO(4) revealed toxicity. RO(2) was as effective as calcitriol in suppressing PTH in a dose dependent manner. Mean plasma ionized calcium did not change from baseline to day 14 and day 28 on RO(2) (250 or 500 pmol/day) whereas it increased significantly on RO(2) (1,000 pmol/day) and calcitriol (125 or 250 pmol/day). Increasing the dose of calcitriol led Ca x P to rise more dramatically than increasing the dose of RO(2), which appears to have a wider therapeutic window than calcitriol. 1,25-(OH)(2)-16ene-23yne-D(3) (RO(2)) may represent a novel candidate for the treatment of renal osteodystrophy in humans. Copyright 2004 S. Karger AG, Basel

  15. Eclampsia a 5 years retrospective review of 216 cases managed in two teaching hospitals in Addis Ababa.

    Science.gov (United States)

    Abate, Misganaw; Lakew, Zufan

    2006-01-01

    to measure the magnitude of eclampsia and its maternal and perinatal outcome. A 5 years retrospective descriptive study was conducted on 216 eclamptic cases diagnosed, admitted and managed from October 1994 to September 1999 in the two teaching hospitals of Addis Ababa; namely Tikur Anbessa and St Paul's Hospitals. There were 257 mothers with eclampsia treated in the given period and 35741 deliveries making the incidence of eclampsia 7.1/1000 deliveries. Eighty-four women (38.9%) had any antenatal care, 157 (72.7%) were nulli-parous and 69 (31.8%) were aged below 20. Convulsion occurred ante-partum in 133 (61.6%), intrapartum in 49 (22.7%) and postpartum in 34 (15.7%) mothers. The most frequently sited symptoms before convulsion include headache in 83.8%, visual disturbance in 41.6% and epigastric pain in 38.4% of the cases. Ninety nine (45.8%) women were delivered by cesarean section making the cesarean section rate among eclamptic mothers significantly higher than the rate among the general population, which was 16.6% at the same period. (P = 0.0001). The multiple pregnancy rate was 5.7%, which was significantly higher than the rate among the general population of 1.5% at the same time. Seventy-four mothers had repeated convulsion after admission to the hospitals and initiation of the standard treatment. Twenty-eight mothers with eclampsia died making the case fatality rate 13%. Seven mothers (3.2%) died before delivery. Forty-four Stillbirths and twenty-five early neonatal deaths occurred making the perinatal mortality rate 312.2/1000 deliveries. Eclampsia is a common complication still associated with high level of maternal and perinatal mortality as well as morbidity. ANC coverage should be strengthened to detect preclampsia, and prevent eclampsia. Management in the hospital should be optimized to prevent recurrent convulsions and complications after admission.

  16. Sm21.6 a novel EF-hand family protein member located on the surface of Schistosoma mansoni adult worm that failed to induce protection against challenge infection but reduced liver pathology.

    Science.gov (United States)

    Lopes, Debora O; Paiva, Leonardo F; Martins, Mauricio A; Cardoso, Fernanda C; Rajão, Matheus A; Pinho, Jean M; Caliari, Marcelo V; Correa-Oliveira, Rodrigo; Mello, Samantha M; Leite, Luciana C C; Oliveira, Sergio C

    2009-06-24

    Schistosomiasis continues to be a significant public health problem that affects 200 million people worldwide. This is one of the most important parasitic diseases, and one whose effective control is unlikely in the absence of a vaccine. In this study, we have isolated a cDNA clone encoding the Schistosoma mansoni Sm21.6 protein that has 45% and 44% identity with Sm22.6 and Sj21.7 EF-hand containing antigens, respectively. Confocal microscopy analysis revealed that Sm21.6 is a membrane-associated protein localized on the S. mansoni adult worm. Mouse immunization with rSm21.6 induced a mixed Th1/Th2 cytokine profile and no protection against infection. However, vaccination with rSm21.6 reduced by 28% of liver granuloma numbers, 21% of granuloma area and 34% of fibrosis. Finally, rSm21.6 was recognized by sera from individuals resistant to reinfection compared with patients susceptible to reinfection and this molecule should be further studied as potential biomarker for disease resistance. In conclusion, Sm21.6 is a new tegument protein from S. mansoni that plays an important role in reducing pathology induced by parasite infection.

  17. SOLVENT HOLD TANK SAMPLE RESULTS FOR MCU-14-135/136 AND MCU-14-214/215/216: FEBRUARY AND MARCH 2014 MONTHLY SAMPLES

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F.; Taylor-Pashow, K.

    2014-06-30

    SRNL received two sets of SHT samples (MCU-14-135-136 in February 2014 and MCU-14-214-216 in March 2014) for analysis. The samples were analyzed for composition. As with the previous solvent sample results, these analyses indicate that the solvent does not require Isopar® L trimming at this time. However, the addition of TiDG (suppressor) to the blended solvent is recommended. Evidence of possible (slight) isomerization of the solvent, probably Isopar®L or TiDG degradation products, was observed.

  18. STR loci D19S216, D20S502 and D20S842 analysis in the Serbian population using dentin DNA

    Directory of Open Access Journals (Sweden)

    Puzović Dragana

    2011-01-01

    Full Text Available Dentin provides a protective enclosure for genomic and mitochondrial DNA. In the present study, DNA was obtained from pulverized or ground teeth. The quality of the DNA extracted from the teeth of 70 unrelated individuals was tested in the context of assessing the allelic and genotypic frequencies of autosomal loci D19S216, D20S502 and D20S842, and calculating a number of parameters of population genetics and forensic interest. This study illustrates that teeth can be a convenient tissue to extract DNA from large numbers of individuals for population genetic studies as well as for forensic case work.

  19. Incubation of MDCO-216 (ApoA-IMilano/POPC with Human Serum Potentiates ABCA1-Mediated Cholesterol Efflux Capacity, Generates New Prebeta-1 HDL, and Causes an Increase in HDL Size

    Directory of Open Access Journals (Sweden)

    Herman J. Kempen

    2014-01-01

    Full Text Available MDCO-216 is a complex of dimeric ApoA-IMilano and palmitoyl oleoyl phosphatidylcholine (POPC, previously shown to reduce atherosclerotic plaque burden. Here we studied the effect of incubation of human plasma or serum with MDCO-216 on cholesterol efflux capacity from J774 cells, on prebeta-1 high density lipoprotein (prebeta-1 HDL and on HDL size assessed by proton nuclear magnetic resonance (1H-NMR. MDCO-216 incubated in buffer containing 4% human serum albumin stimulated both ABCA1-mediated efflux and ABCA1-independent cholesterol efflux from J774 macrophages. When incubated with human serum a dose- and time-dependent synergistic increase of the ABCA1-mediated efflux capacity were observed. Using a commercially available ELISA for prebeta-1 HDL, MDCO-216 as such was poorly detected (12–15% of nominal amount of protein. Prebeta-1 HDL was rapidly lost when human plasma alone is incubated at 37°C. In contrast, incubation of human plasma with MDCO-216 at 37°C produced a large amount of new prebeta-1 HDL. Native 2D electrophoresis followed by immunoblotting with an apoA-I antibody, which also detects ApoA-I Milano, confirmed the increase in prebeta-1 HDL upon incubation at 37°C. With the increase of prebeta-1 HDL, the concomitant disappearance of the small alpha-3 and alpha-4 HDL and MDCO-216 and an increase in the large alpha-1 and alpha-2 HDL were observed. Immunoblotting with Mab 17F3 specific for ApoA-I Milano showed the appearance of ApoA-I Milano in alpha-1 and alpha-2, but not in prebeta-1 HDL. 1H-NMR analysis of plasma incubated with MDCO-216 confirmed rapid disappearance of small-sized HDL particles and increase of medium- and large-sized HDL particles accompanied with a decrease in total HDL particle number. In conclusion, incubation of human plasma or serum with MDCO-216 strongly enhanced ABCA1-mediated cholesterol efflux, caused a strong increase of prebeta-1 HDL, and drastically changed the distribution of HDL subpopulations

  20. Down-regulation of KIAA1199/CEMIP by miR-216a suppresses tumor invasion and metastasis in colorectal cancer.

    Science.gov (United States)

    Zhang, Dejun; Zhao, Lei; Shen, Qiong; Lv, Qing; Jin, Min; Ma, Hong; Nie, Xiu; Zheng, Xiumei; Huang, Shaoyi; Zhou, Pengfei; Wu, Gang; Zhang, Tao

    2017-05-15

    Colorectal cancer is one of the major causes of death from cancer. Metastasis is the leading cause of treatment failure, in which cancer stem cells and circulating tumor cells play crucial roles. Identifying the involved metastatic biomarkers and clarifying the regulation mechanisms are of great importance for targeting tumor metastasis. In the current research, we discovered that KIAA1199, a cell-migration inducing protein, showed higher expression in CD44+ cancer cells from metastatic compared with the paired primary tissues, and was upregulated in colorectal cancer and positively correlated with numbers and mesenchymal phenotype of circulating tumor cells, and predicted shorter progress-free survival. Moreover, we indicated that down-regulation of KIAA1199 suppressed migration and invasion of colorectal cancer cells in vitro, and inhibited metastasis in vivo. Furthermore, we demonstrated that KIAA1199 was one of the direct and functional targets of miR-216a, and miR-216a overexpression led to decreased migration and invasion of colorectal cancer cells in vitro, and inhibited metastasis in vivo. Collectively, KIAA1199 plays a critical role in maintaining an aggressive phenotype of tumor cells, and suppression of KIAA1199-related motilities of tumor cells contributes to reduced tumor metastasis in colorectal cancer. © 2017 UICC.

  1. Heparin-induced platelet aggregation (H-IPA): dose/response relationship for two low molecular weight (LMW) heparin preparations (CY 216 and CY 222)

    Energy Technology Data Exchange (ETDEWEB)

    Brace, L.D.; Fareed, J.

    1986-03-01

    The authors have previously demonstrated that heparin and a LMW heparin derivative (PK 10169) causes platelet aggregation in a dose-dependent manner that can be inhibited by antagonists of the thromboxane pathway. Using fractions of these agents separated on the basis of molecular weight (MW) by gel permeation chromatography, the authors showed that H-IPA was directly dependent upon the MW of the agents tested. In order to further examine this MW dependence, the authors tested two other LMW heparin preparations, CY 216 and CY 222 and subfractions of these agents separated on the basis of MW. Citrate anticoagulated whole blood was drawn from drug-free normal healthy donors whose platelets aggregated when heparin was added to their platelet-rich plasma (PRP). PRP was prepared, various concentrations of the agents or their subfractions were added and aggregation was monitored for 40 minutes at 37/sup 0/C. The results demonstrate that like heparin and PK 10169, CY 216 and CY 222 caused platelet aggregation in a dose and MW dependent manner. Fractions with MW less than 2500 daltons caused aggregation only at concentrations exceeding the therapeutic range of the agents. The authors conclude that the ability to cause H-IPA is an inherent property of heparin and its fractions.

  2. Examining the nature of very-high-energy gamma-ray emission from the AGN PKS 1222+216 and 3C 279

    Science.gov (United States)

    Price, Sharleen; Brill, Ari; Mukherjee, Reshmi; VERITAS

    2018-01-01

    Blazars are a type of active galactic nuclei (AGN) that emit jets of ionized matter which move towards the Earth at relativistic speeds. In this research we carried out a study of two objects, 3C 279 and PKS 1222+216, which belong to the subset of blazars known as FSRQs (flat spectrum radio quasars), the most powerful TeV-detected sources at gamma-ray energies with bolometric luminosities exceeding 1048 erg/s. The high-energy emission of quasars peaks in the MeV-GeV band, making these sources very rarely detectable in the TeV energy range. In fact, only six FSRQs have ever been detected in this range by very-high-energy gamma-ray telescopes. We will present results from observing campaigns on 3C 279 in 2014 and 2016, when the object was detected in high flux states by Fermi-LAT. Observations include simultaneous coverage with the Fermi-LAT satellite and the VERITAS ground-based array spanning four decades in energy from 100 MeV to 1 TeV. We will also report VERITAS observations of PKS 1222+216 between 2008 and 2017. The detection/non-detection of TeV emission during flaring episodes at MeV energies will further contribute to our understanding of particle acceleration and gamma-ray emission mechanisms in blazar jets.

  3. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  4. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  5. Characterization of Vadose Zone Sediment: Borehole C3103 Located in the 216-B-7A Crib Near the B Tank Farm

    Energy Technology Data Exchange (ETDEWEB)

    Lindenmeier, Clark W.; Serne, R JEFFREY.; Bjornstad, Bruce N.; Last, George V.; Lanigan, David C.; Lindberg, Michael J.; Clayton, Ray E.; Legore, Virginia L.; Kutnyakov, Igor V.; Baum, Steven R.; Geiszler, Keith N.; Valenta, Michelle M.; Vickerman, Tanya S.

    2002-12-01

    This report summarizes data collected from samples in borehole C3103. Borehole C3103 was completed to further characterize the nature and extent of vadose zone contaminants supplied by intentional liquid discharges into the crib 216-B7A/7B between 1954 and 1967. These cribs received dilute waste streams from the bismuth phosphate fuel reprocessing program in the 1950's and decontamination waste in the 1960's. Elevated concentrations of several constituents were primarily measured at different depth intervals. The primary radionuclides present in this borehole are cesium-137 and uranium near the top of the borehole. Chemical characteristics attributed to wastewater-soil interaction at different locations within this zone are elevated pH, sodium, fluoride, carbonate nitrate, and sulphate

  6. Overexpression of CDC25B, CDC25C and phospho-CDC25C (Ser216 in vulvar squamous cell carcinomas are associated with malignant features and aggressive cancer phenotypes

    Directory of Open Access Journals (Sweden)

    Flørenes Vivi

    2010-05-01

    Full Text Available Abstract Background CDC25 phosphatases are important regulators of the cell cycle. Their abnormal expression detected in a number of tumors implies that their dysregulation is involved in malignant transformation. However, the role of CDC25s in vulvar cancer is still unknown. To shed light on their roles in the pathogenesis and to clarify their prognostic values, expression of CDC25A, CDC25B and CDC25C in a large series of vulvar squamous cell carcinomas were examined. Methods Expression of CDC25A, CDC25B, CDC25C and phosphorylated (phospho-CDC25C (Ser216 were examined in 300 vulvar carcinomas using immunohistochemistry. Western blot analysis was utilized to demonstrate CDC25s expression in vulvar cancer cell lines. Kinase and phosphatase assays were performed to exclude cross reactivity among CDC25s isoform antibodies. Results High nuclear CDC25A and CDC25B expression were observed in 51% and 16% of the vulvar carcinomas, respectively, whereas high cytoplasmic CDC25C expression was seen in 63% of the cases. In cytoplasm, nucleus and cytoplasm/nucleus high phospho-CDC25C (Ser216 expression was identified in 50%, 70% and 77% of the carcinomas, respectively. High expression of CDC25s correlated significantly with malignant features, including poor differentiation and infiltration of vessel for CDC25B, high FIGO stage, presence of lymph node metastases, large tumor diameter, poor differentiation for CDC25C and high FIGO stage, large tumor diameter, deep invasion and poor differentiation for phospho-CDC25C (Ser216. In univariate analysis, high expression of phospho-CDC25C (Ser216 was correlated with poor disease-specific survival (p = 0.04. However, such an association was annulled in multivariate analysis. Conclusions Our results suggest that CDC25C and phospho-CDC25C (Ser216 play a crucial role and CDC25B a minor role in the pathogenesis and/or progression of vulvar carcinomas. CDC25B, CDC25C and phospho-CDC25C (Ser216 were associated with

  7. Tropospheric water vapour isotopologue data (H216O, H218O, and HD16O) as obtained from NDACC/FTIR solar absorption spectra

    Science.gov (United States)

    Barthlott, Sabine; Schneider, Matthias; Hase, Frank; Blumenstock, Thomas; Kiel, Matthäus; Dubravica, Darko; García, Omaira E.; Sepúlveda, Eliezer; Mengistu Tsidu, Gizaw; Takele Kenea, Samuel; Grutter, Michel; Plaza-Medina, Eddy F.; Stremme, Wolfgang; Strong, Kim; Weaver, Dan; Palm, Mathias; Warneke, Thorsten; Notholt, Justus; Mahieu, Emmanuel; Servais, Christian; Jones, Nicholas; Griffith, David W. T.; Smale, Dan; Robinson, John

    2017-01-01

    We report on the ground-based FTIR (Fourier transform infrared) tropospheric water vapour isotopologue remote sensing data that have been recently made available via the database of NDACC (Network for the Detection of Atmospheric Composition Change; MUSICA/" target="_blank">ftp://ftp.cpc.ncep.noaa.gov/ndacc/MUSICA/) and via doi:10.5281/zenodo.48902. Currently, data are available for 12 globally distributed stations. They have been centrally retrieved and quality-filtered in the framework of the MUSICA project (MUlti-platform remote Sensing of Isotopologues for investigating the Cycle of Atmospheric water). We explain particularities of retrieving the water vapour isotopologue state (vertical distribution of H216O, H218O, and HD16O) and reveal the need for a new metadata template for archiving FTIR isotopologue data. We describe the format of different data components and give recommendations for correct data usage. Data are provided as two data types. The first type is best-suited for tropospheric water vapour distribution studies disregarding different isotopologues (comparison with radiosonde data, analyses of water vapour variability and trends, etc.). The second type is needed for analysing moisture pathways by means of H2O, δD-pair distributions.

  8. IUPAC critical evaluation of the rotational-vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O

    Science.gov (United States)

    Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Császár, Attila G.; Daumont, Ludovic; Gamache, Robert R.; Hodges, Joseph T.; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Vandaele, Ann Carine; Zobov, Nikolai F.; Dénes, Nóra; Fazliev, Alexander Z.; Furtenbacher, Tibor; Gordon, Iouli E.; Hu, Shui-Ming; Szidarovszky, Tamás; Vasilenko, Irina A.

    2014-07-01

    This paper is the fourth of a series of papers reporting critically evaluated rotational-vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D216O, D217O, and D218O. The MARVEL (Measured Active Rotational-Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0-14 016, 0-7969, and 0-9108 cm-1 for D216O, D217O, and D218O, respectively. For D216O, D217O, and D218O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D216O, D217O, and D218O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm-1, from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved.

  9. PROSPECTS FOR DETECTION OF SYNCHROTRON EMISSION FROM SECONDARY ELECTRONS AND POSITRONS IN STARLESS CORES: APPLICATION TO G0.216+0.016

    Energy Technology Data Exchange (ETDEWEB)

    Jones, D. I., E-mail: d.jones@astro.ru.nl [Department of Astrophysics/IMAPP, Radboud University, Heijendaalseweg 135, 6525-AJ Nijmegen (Netherlands)

    2014-09-01

    We investigate the diffusion of cosmic rays into molecular cloud complexes. Using the cosmic-ray diffusion formalism of Protheroe et al., we examine how cosmic rays diffuse into clouds exhibiting different density structures, including a smoothed step-function, as well as Gaussian and inverse-r density distributions, which are well known to trace the structure of star-forming regions. These density distributions were modeled as an approximation to the Galactic center cloud G0.216+0.016, a recently discovered massive dust clump that exhibits limited signs of massive star formation and thus may be the best region in the Galaxy to observe synchrotron emission from secondary electrons and positrons. Examination of the resulting synchrotron emission, produced by the interaction of cosmic-ray protons interacting with ambient molecular matter producing secondary electrons and positrons reveals that, due to projection effects, limb-brightened morphology results in all cases. However, we find that the Gaussian and inverse-r density distributions show much broader flux density distributions than step-function distributions. Significantly, some of the compact (compared to the 2.''2 resolution, 5.3 GHz Karl G. Jansky Very Large Array (JVLA) observations) sources show non-thermal emission, which may potentially be explained by the density structure and the lack of diffusion of cosmic rays into the cloud. We find that we can match the 5.3 and 20 GHz flux densities of the non-thermal source JVLA 1 and 6 from Rodríguez and Zapata with a local cosmic-ray flux density, a diffusion coefficient suppression factor of χ = 0.1-0.01 for a coefficient of 3 × 10{sup 27} cm{sup –2} s{sup –1}, and a magnetic field strength of 470 μG.

  10. Perfusion pattern and time of vascularisation with CEUS increase accuracy in differentiating between benign and malignant tumours in 216 musculoskeletal soft tissue masses

    Energy Technology Data Exchange (ETDEWEB)

    De Marchi, Armanda, E-mail: armanda.demarchi@tiscali.it [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Prever, Elena Brach del, E-mail: elena.brach@unito.it [Department of OrthopaedicOncology and ReconstructiveSurgery, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Cavallo, Franco, E-mail: franco.cavallo@unito.it [Department of Public health and Paediatrics, University of Turin, Via Santena 5-bis, 10126 Torino (Italy); Pozza, Simona, E-mail: simona.pozza@tin.it [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Linari, Alessandra, E-mail: linaralessandra@libero.it [Department of Pathology, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, Regina Margherita Hospital, Piazza Polonia, 10126 Torino (Italy); Lombardo, Paolo, E-mail: pao.lombardo82@gmail.com [Department of DiagnosticImaging and Radiotherapy of the University of Turin, Azienda Ospedaliero-Universitaria Città della Salute e della Scienza di Torino, Via Genova 3, 10126 Torino (Italy); Comandone, Alessandro, E-mail: alessandro.comandone@gradenigo.it [Department of Oncology, Gradenigo Hospital, Corso Regina Margherita, 8/10.10153 Torino (Italy); Piana, Raimondo, E-mail: raimondo.piana@libero.it [Department of OrthopaedicOncology and ReconstructiveSurgery, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Faletti, Carlo [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy)

    2015-01-15

    Introduction: Musculoskeletal Soft Tissue Tumours (STT) are frequent heterogeneous lesions. Guidelines consider a mass larger than 5 cm and deep with respect to the deep fascia potentially malignant. Contrast Enhanced Ultrasound (CEUS) can detect both vascularity and tumour neoangiogenesis. We hypothesised that perfusion patterns and vascularisation time could improve the accuracy of CEUS in discriminating malignant tumours from benign lesions. Materials and methods: 216 STT were studied: 40% benign lesions, 60% malignant tumours, 56% in the lower limbs. Seven CEUS perfusion patterns and three types of vascularisation (arterial-venous uptake, absence of uptake) were applied. Accuracy was evaluated by comparing imaging with the histological diagnosis. Univariate and multivariate analysis, Chi-square test and t-test for independent variables were applied; significance was set at p < 0.05 level, 95% computed CI. Results: CEUS pattern 6 (inhomogeneous perfusion), arterial uptake and location in the lower limb were associated with high risk of malignancy. CEUS pattern has PPV 77%, rapidity of vascularisation PPV 69%; location in the limbs is the most sensitive indicator, but NPV 52%, PPV 65%. The combination of CEUS-pattern and vascularisation has 74% PPV, 60% NPV, 70% sensitivity. No correlation with size and location in relation to the deep fascia was found. Conclusion: US with CEUS qualitative analysis could be an accurate technique to identify potentially malignant STT, for which second line imaging and biopsy are indicated in Referral Centers. Intense inhomogeneous enhancement with avascular areas and rapid vascularisation time could be useful in discriminating benign from malignant SST, overall when the lower limbs are involved.

  11. Spectrum of Molecular Defects in 216 Chinese Families With Hemophilia A: Identification of Noninversion Mutation Hot Spots and 42 Novel Mutations.

    Science.gov (United States)

    Guo, Zhiping; Yang, Linhua; Qin, Xiuyu; Liu, Xiue; Zhang, Yaofang

    2018-01-01

    Hemophilia A (HA) is an X-linked bleeding disorder caused by heterogeneous mutations in the factor VIII gene ( F8). Our aim is to identify the causative mutations in a large HA cohort from China. We studied 216 unrelated HA families. Molecular analyses of F8 were performed using a combination of molecular techniques, including polymerase chain reaction, direct sequencing, and multiplex ligation-dependent probe amplification. The deleterious consequences of the unreported missense mutations were evaluated using various bioinformatics approaches. Causative mutations in F8 were identified in 209 families, intron 22 inversion (Inv22) was identified in 89 severe families, and intron 1 inversion (Inv1) was positive in 5 severe families; 95 mutations were detected among 115 noninversion families, of which 42 were novel, including 29 null variations and 13 missense mutations for which causality was demonstrated via bioinformatics. Among the 53 previously reported mutations, more nonsense (5 of 9) and missense (10 of 26) mutation sites were found to occur at Arginine (Arg) sites and multiple small deletions/insertions (5 of 10) located within the poly-A runs of the B domain. The majority of these sequence variants frequently recurred in the database. The odds ratios for the likelihood of developing inhibitors significantly increased in the presence of nonsense mutation. Our F8 defect spectrum was heterogeneous. Small deletions/insertions in the poly-A runs of the B domain and nonsense and missense mutations at Arg sites were identified as mutation hot spots. Nonsense mutation increased the risk of developing inhibitors.

  12. Outcomes with same-day cervical preparation with Dilapan-S osmotic dilators and vaginal misoprostol before dilatation and evacuation at 18 to 21+6 weeks' gestation.

    Science.gov (United States)

    Lyus, Richard; Lohr, Patricia A; Taylor, Jeanette; Morroni, Chelsea

    2013-01-01

    Cervical preparation has been shown to reduce complications with dilatation and evacuation (D&E), but the optimal regimen is unknown. While most published reports are from North America and describe overnight cervical preparation, recent research suggests the safety of same-day cervical preparation up to a gestational age of 18 weeks. We investigated the safety and efficacy of a same-day preparation protocol using a combination of Dilapan-S and misoprostol for gestations of 18-22 weeks. This retrospective chart review evaluated 281 consecutive women who had a D&E from 18+0 to 21+6 weeks' gestation at the British Pregnancy Advisory Service clinic in Richmond, London, between January and December 2010. Misoprostol and Dilapan-S osmotic dilators were used in combination for approximately 3 h prior to evacuation. Women who had induced fetal demise were excluded. We evaluated procedure success, duration and the frequency of adverse events. A total of 274 cases were included in this analysis. In 97% of cases, 400 mcg vaginal misoprostol was used, and in 85% of cases, three Dilapan dilators were inserted. Mean cervical preparation time was 3 h and 40 min (SD 41.2 min), and mean procedure time was 10 min (SD 4.2). There were two immediate complications: one cervical laceration [0.36%, 95% confidence interval (CI) 0.01-2.01] and one extramural delivery in the clinic after cervical preparation agents were placed (0.36%, 95% CI 0.01-2.01). There were no cases of uterine perforation, hemorrhage or inability to complete the procedure. This study suggests that same-day cervical preparation with Dilapan-S and misoprostol is safe and feasible for second-trimester surgical abortion up to 22 weeks' gestation. Copyright © 2013 Elsevier Inc. All rights reserved.

  13. Impact of mother tongue and gender on overweight, obesity and extreme obesity in 24,989 Viennese children/adolescents (2-16 years).

    Science.gov (United States)

    Segna, Daniel; Widhalm, Harald; Pandey, Maitrayee P; Zehetmayer, Sonja; Dietrich, Sabine; Widhalm, Kurt

    2012-11-01

    The present survey aims at determining the prevalence of extreme obesity (defined as a body mass index (BMI) ≥ 99.5th percentile) for the first time in Austria and at investigating the relationship between weight status and mother tongue in a representative Viennese sample of 24,989 children and adolescents (2-16 years) with a percentage of approximately 46 % of migration background.Directly measured anthropometric data on body weight and height were collected and BMI was calculated. Prevalence of overweight, obesity and extreme obesity was determined for every subgroup according to mother tongue using the German national reference criteria by Kromeyer-Hauschild et al.In this sample, 2.1 % of all children and adolescents had to be classified as being extremely obese. More boys (2.3 %) than girls (1.9 %) suffered from extreme obesity (p = 0.048). Total 1.7 % of children and adolescents with German as their native language, 2.5 % of Turkish native speakers and 2.9 % of children and adolescents with another mother tongue were extremely obese (p ≤ 0.001). The highest prevalence of overweight or obesity was found in Turkish-native-speaking children and adolescents (p ≤ 0.001), whereas the lowest one was found in German-native-speaking children and adolescents (p ≤ 0.001).This large study clearly shows that extreme obesity is a common disease and largely neglected. Apparently, another native language than German, as an indicator for a migration background, may be associated with a substantially higher probability for the development of extreme obesity in Vienna, Austria. Thus, effective preventive measures to overcome obesity are urgently needed.

  14. Produção de brotos de soja utilizando a cultivar BRS 216: caracterização físico-química e teste de aceitabilidade Production of soybean sprouts from the cultivar BRS 216: physical and chemical characterization and acceptability test

    Directory of Open Access Journals (Sweden)

    Marcelo Alvares de Oliveira

    2013-03-01

    Full Text Available O presente trabalho teve por objetivo avaliar os parâmetros físico-químicos e os processos para a produção de brotos de soja a partir de sementes da cultivar BRS 216, bem como sua composição química e aceitabilidade. Foram avaliados o comprimento e o peso dos brotos viáveis, a composição centesimal e os teores de isoflavonas e de inibidor de tripsina. O desenho experimental foi ao acaso com três repetições e os tratamentos foram avaliados num esquema fatorial 3 × 3: três frequências de irrigação (a cada quatro, oito e 12 horas e três períodos de crescimento (cinco, seis e sete dias. O teste de aceitabilidade dos brotos de soja foi realizado utilizando-se a escala hedônica estruturada de nove pontos, avaliando-se cor, aparência, odor, textura, sabor e avaliação global, além da intenção de compra. A frequência de irrigação com intervalos de quatro horas e o período de sete dias de crescimento foram ideais para produção dos brotos de soja, favorecendo maior produtividade, teores mais elevados de proteínas e menores teores de inibidor de tripsina. O índice de aceitabilidade dos brotos de soja foi superior a 70 em todas as características avaliadas, com exceção do odor.The aim of the present study was to evaluate the physical and chemical parameters and process for the production of soybean sprouts from the BRS 216 cultivar, as well as determining their chemical composition and acceptability. The length and weight of viable sprouts, proximate composition, and the isoflavone and trypsin inhibitor contents were evaluated. The experimental design was completely randomized with three replications, and the treatments were evaluated using a 3 × 3 factorial design: three irrigation frequencies (four, eight and 12 hours and three growth periods (five, six and seven days. The soybean sprout acceptability was determined using a nine point structured hedonic scale, evaluating colour, appearance, aroma, texture, flavour

  15. Antidiabetic effect of propolis: reduction of expression of glucose-6-phosphatase through inhibition of Y279 and Y216 autophosphorylation of GSK-3α/β in HepG2 cells.

    Science.gov (United States)

    Kang, Li-Jung; Lee, Hwanghee Blaise; Bae, Hyeun-Jong; Lee, Seong-Gene

    2010-10-01

    Propolis is a sticky, resinous material that honey bees collect from various plants, and mix with wax and other secretions. The aim of this study was to evaluate the antidiabetic effect of propolis through an analysis of the expression and enzyme activity of glucose-6-phosphatase (G6Pase) and to elucidate the mechanism by which propolis inhibits G6Pase gene expression. When HepG2 cells were incubated in high glucose media (25 mm), G6Pase expression was induced. Propolis significantly reduced the expression and enzyme activity of G6Pase; however, the hypoglycemic effect was not abolished by the phosphoinositide 3-kinase inhibitor, LY294002, and by the mitogen-activated protein kinase (MAPK) inhibitor, U0126. Propolis inhibited the activity of GSK3α and β via the inhibition of serine and tyrosine phosphorylation, specifically, Y279 for GSK3α and Y216 for GSK3β. The phosphorylations of Y279 and Y216 occur through autophosphorylation by GSK3α/β and are involved in their own activity. Although propolis showed antioxidant activity, antidiabetic effect of propolis was not influenced by hydrogen peroxide and N-acetylcysteine. These results suggest that propolis inhibits the expression of G6Pase by inhibiting the autophosphorylation of Y279 and Y216 of GSK3α and β, respectively, which are involved in the activation of GSK3. These findings suggest that propolis may be a potential antidiabetic agent for the treatment of insulin-insensitive diabetes. Copyright © 2010 John Wiley & Sons, Ltd.

  16. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  17. Experimental and theoretical study of the longitudinal aerodynamic characteristics of delta and double-delta wings at Mach numbers of 1.60, 1.90, and 2.16

    Science.gov (United States)

    Wood, R. M.; Covell, P. F.

    1985-01-01

    An experimental and theoretical study was conducted to investigate the supersonic aerodynamic characteristics of delta and double-delta wings. Testing was conducted in the Langley Unitary Plan Wind Tunnel at Mach numbers of 1.60, 1.90, and 2.16. The double-delta wings exhibited lower zero-lift drag values than the delta wings having the same aspect ratio, whereas delta wings provided the lower drag due to lift. Deflections of the trailing-edge flaps for pitch control revealed that the induced aerodynamic forces were only a function of the flap planform and were independent of wing planform. The supporting theoretical analysis showed that the supersonic design and analysis system (SDAS) did not consistently predict all the longitudinal aerodynamic characteristics of the low-sweep, low-fineness-ratio wing-body configurations under investigation.

  18. Wind Tunnel Tests of Ailerons at Various Speeds I : Ailerons of 0.20 Airfoil Chord and True Contour with 0.35 Aileron-chord Extreme Blunt Nose Balance on the NACA 66,2-216 Airfoil

    Science.gov (United States)

    Letko, W; Denaci, H. G.; Freed, C

    1943-01-01

    Hinge-moment, lift, and pressure-distribution measurements were made in the two-dimensional test section of the NACA stability tunnel on a blunt-nose balance-type aileron on an NACA 66,2-216 airfoil at speeds up to 360 miles per hour corresponding to a Mach number of 0.475. The tests were made primarily to determine the effect of speed on the action of this type of aileron. The balance-nose radii of the aileron were varied from 0 to 0.02 of the airfoil chord and the gap width was varied from 0.0005 to 0.0107 of the airfoil chord. Tests were also made with the gap sealed.

  19. The Big-Wheel TGC-1 being moved against the Barrel Muon Spectrometer. The 216 trigger chambers are supported by a thin structure of 22 m diameter and 0.4 m thickness, weighting 44 tons and supported on two rails.

    CERN Multimedia

    Claudia Marcelloni

    2006-01-01

    The Big-Wheel TGC-1 being moved against the Barrel Muon Spectrometer. The 216 trigger chambers are supported by a thin structure of 22 m diameter and 0.4 m thickness, weighting 44 tons and supported on two rails.

  20. Poly(perfluoroalkylation) of metallic nitride fullerenes reveals addition-pattern guidelines: synthesis and characterization of a family of Sc3N@C80(CF3)n (n = 2-16) and their radical anions.

    Science.gov (United States)

    Shustova, Natalia B; Peryshkov, Dmitry V; Kuvychko, Igor V; Chen, Yu-Sheng; Mackey, Mary A; Coumbe, Curtis E; Heaps, David T; Confait, Bridget S; Heine, Thomas; Phillips, J Paige; Stevenson, Steven; Dunsch, Lothar; Popov, Alexey A; Strauss, Steven H; Boltalina, Olga V

    2011-03-02

    A family of highly stable (poly)perfluoroalkylated metallic nitride cluster fullerenes was prepared in high-temperature reactions and characterized by spectroscopic (MS, (19)F NMR, UV-vis/NIR, ESR), structural and electrochemical methods. For two new compounds, Sc(3)N@C(80)(CF(3))(10) and Sc(3)N@C(80)(CF(3))(12,) single crystal X-ray structures are determined. Addition pattern guidelines for endohedral fullerene derivatives with bulky functional groups are formulated as a result of experimental ((19)F NMR spectroscopy and single crystal X-ray diffraction) studies and exhaustive quantum chemical calculations of the structures of Sc(3)N@C(80)(CF(3))(n) (n = 2-16). Electrochemical studies revealed that Sc(3)N@C(80)(CF(3))(n) derivatives are easier to reduce than Sc(3)N@C(80), the shift of E(1/2) potentials ranging from +0.11 V (n = 2) to +0.42 V (n = 10). Stable radical anions of Sc(3)N@C(80)(CF(3))(n) were generated in solution and characterized by ESR spectroscopy, revealing their (45)Sc hyperfine structure. Facile further functionalizations via cycloadditions or radical additions were achieved for trifluoromethylated Sc(3)N@C(80) making them attractive versatile platforms for the design of molecular and supramolecular materials of fundamental and practical importance.

  1. THE FIRST Hi-GAL OBSERVATIONS OF THE OUTER GALAXY: A LOOK AT STAR FORMATION IN THE THIRD GALACTIC QUADRANT IN THE LONGITUDE RANGE 216. Degree-Sign 5 {approx}< l {approx}< 225. Degree-Sign 5

    Energy Technology Data Exchange (ETDEWEB)

    Elia, D.; Molinari, S.; Schisano, E.; Pestalozzi, M.; Benedettini, M.; Di Giorgio, A. M.; Pezzuto, S.; Rygl, K. L. J. [Istituto di Astrofisica e Planetologia Spaziali-INAF, Via Fosso del Cavaliere 100, I-00133 Roma (Italy); Fukui, Y.; Hayakawa, T.; Yamamoto, H. [Department of Physics, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); Olmi, L. [Osservatorio Astrofisico di Arcetri-INAF, Largo E. Fermi 5, I-50125 Firenze (Italy); Veneziani, M. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Schneider, N.; Piazzo, L. [IRFU/SAp CEA/DSM, Laboratoire AIM CNRS, Universit Paris Diderot, F-91191 Gif-sur-Yvette (France); Ikhenaode, D. [DIET-Dipartimento di Ingegneria dell' Informazione, Elettronica e Telecomunicazioni, Universita di Roma La Sapienza, via Eudossina 18, I-00184 Roma (Italy); Mizuno, A. [Solar-Terrestrial Environment Laboratory, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8601 (Japan); Onishi, T. [Department of Physical Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan); Polychroni, D. [Department of Astrophysics, Astronomy and Mechanics, Faculty of Physics, University of Athens, Panepistimiopolis, 15784 Zografos, Athens (Greece); Maruccia, Y., E-mail: davide.elia@iaps.inaf.it [Dipartimento di Matematica e Fisica, Universita del Salento, CP 193, I-73100 Lecce (Italy)

    2013-07-20

    We present the first Herschel PACS and SPIRE photometric observations in a portion of the outer Galaxy (216. Degree-Sign 5 {approx}< l {approx}< 225. Degree-Sign 5 and -2 Degree-Sign {approx}< b {approx}< 0 Degree-Sign ) as a part of the Hi-GAL survey. The maps between 70 and 500 {mu}m, the derived column density and temperature maps, and the compact source catalog are presented. NANTEN CO(1-0) line observations are used to derive cloud kinematics and distances so that we can estimate distance-dependent physical parameters of the compact sources (cores and clumps) having a reliable spectral energy distribution that we separate into 255 proto-stellar and 688 starless sources. Both typologies are found in association with all the distance components observed in the field, up to {approx}5.8 kpc, testifying to the presence of star formation beyond the Perseus arm at these longitudes. Selecting the starless gravitationally bound sources, we identify 590 pre-stellar candidates. Several sources of both proto- and pre-stellar nature are found to exceed the minimum requirement for being compatible with massive star formation based on the mass-radius relation. For the pre-stellar sources belonging to the Local arm (d {approx}< 1.5 kpc) we study the mass function whose high-mass end shows a power law N(log M){proportional_to}M {sup -1.0{+-}0.2}. Finally, we use a luminosity versus mass diagram to infer the evolutionary status of the sources, finding that most of the proto-stellar sources are in the early accretion phase (with some cases compatible with a Class I stage), while for pre-stellar sources, in general, accretion has not yet started.

  2. 50 CFR 216.180 - Specified activity.

    Science.gov (United States)

    2010-10-01

    ... sperm whales (Kogia simus and K. breviceps), and short-finned and long-finned pilot whales (Globicephala macrorhynchus and G. melas). (3) Pinnipeds—hooded seal (Cystophora cristata), harbor seal (Phoca vitulina...

  3. 22 CFR 216.1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... activities address such basic problems as hunger, malnutrition, overpopulation, disease, disaster... to select, implement and manage effective environmental programs; (3) Identify impacts resulting from... Environmental Impact Statement will be required. (3) Threshold Decision. A formal Agency decision which...

  4. 32 CFR 216.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... MILITARY RECRUITING AND RESERVE OFFICER TRAINING CORPS PROGRAM ACCESS TO INSTITUTIONS OF HIGHER EDUCATION... further explained that “the statute does not call for an inquiry into why or how the ‘other employer...

  5. 32 CFR 216.6 - Information requirements.

    Science.gov (United States)

    2010-07-01

    ...) MISCELLANEOUS MILITARY RECRUITING AND RESERVE OFFICER TRAINING CORPS PROGRAM ACCESS TO INSTITUTIONS OF HIGHER...—Military Recruiting Sample Letter of Inquiry (Tailor letter to situation presented) Dr. John Doe, President...

  6. 50 CFR 216.163 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... mammals are present; (3) If the sea state exceeds 3 on the Beaufort scale (i.e., whitecaps on 33 to 50..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Shock Testing the USS MESA VERDE (LPD 19) by Detonation of...

  7. 22 CFR 216.3 - Procedures.

    Science.gov (United States)

    2010-04-01

    ... the funds are to be disbursed (e.g. long lead times for the delivery of goods or services), the... has occurred or is imminent; and (b) Significant health problems (either human or animal) or..., treated crops will not be used for human or animal consumption unless appropriate tolerances have been...

  8. Publications | Page 216 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Researching the urban dilemma : urbanization, poverty and violence (open access). Agencies such as the Organization for Economic Cooperation and Development (OECD), the United Nations and the World Bank continue to privilege national over municipal statistical datasets. The paucity of reliable subnational data and ...

  9. 216 MERGING OF THE TWO ASSOCIATIONS OF ...

    African Journals Online (AJOL)

    2001-09-02

    Sep 2, 2001 ... Previously, there were two associations of anthropologists in South. Africa, namely the South African Society of Cultural Anthropologists. (SASCA) and the Association for Anthropology in Southern Africa. (AASA). SASCA ... I managed to attend the AASA business meeting where van'ous issues were raised.

  10. 38 CFR 21.216 - Special equipment.

    Science.gov (United States)

    2010-07-01

    ... capability for blinded persons. (2) Sensory aids and prostheses. This category includes items which are specifically designed to mitigate or overcome the effects of disability. They range from eyeglasses and hearing aids to closed-circuit TV systems which amplify reading material for veterans with severe visual...

  11. 50 CFR 216.174 - Mitigation.

    Science.gov (United States)

    2010-10-01

    .../are dead), location, time of first discovery, observed behavior (if alive), and photo or video (if... and conditions. (xxx) When marine mammals have been sighted in the area, Navy vessels shall increase...

  12. 50 CFR 216.244 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ..., consistent with the safety of the ship. (xxx) The Navy shall abide by the letter of the “Stranding Response... video (if available). Based on the information provided, NMFS shall determine if, and advise the Navy.../are dead), location, time of first discovery, observed behaviors (if alive), and photo or video (if...

  13. 216 ORGANISATIONA L CHANGE MANAGEMENT AND WORKERS ...

    African Journals Online (AJOL)

    having the will of others imposed upon them. Nevertheless, since no organisation can afford to stand still in the ever dynamic whirlpool of the global business environment, organisational change management is therefore important to secure, modify and elicit the behaviour of workers in line with the changing business needs ...

  14. 18 CFR 157.216 - Abandonment.

    Science.gov (United States)

    2010-04-01

    ... notify, in writing, the State public service commission having regulatory authority over retail service... to provide: (i) Interruptible transportation service during the one year period prior to the effective date of the proposed abandonment, or (ii) Firm transportation service during the one year period...

  15. 29 CFR 1603.216 - Summary decision.

    Science.gov (United States)

    2010-07-01

    ... EXEMPT STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION UNDER SECTION 304 OF... party or after notice to the parties, the administrative law judge may issue a summary decision without...

  16. Publications | Page 216 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Reliability of Community Health Worker Collected Data for Planning and Policy in a Peri-Urban Area of Kisumu, Kenya (open access). As reliable and timely health information is essential for public health action and health systems strengthening, the study investigates the validity and reliability of Community Based ...

  17. 12 CFR 216.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... primarily for personal, family, or household purposes. (2) Examples—(i) Continuing relationship. A consumer... connects directly to the notice and is labeled appropriately to convey the importance, nature, and... from you that is to be used primarily for personal, family, or household purposes, or that individual's...

  18. Publications | Page 216 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dengue is the most important mosquito-borne disease in the Philippines, especially in Metropolitan Manila where communities are socially and economically diverse, and city governments struggle to provide basic services such as continuously available, piped water supply to residents. We examined... Industrial clusters ...

  19. 50 CFR 216.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... are morphologically adapted to the marine environment, and whether alive or dead, and any part thereof...: (1) If the specimen is dead, and is on a beach or shore, or is in the water within the Exclusive Economic Zone of the United States; or (2) If the specimen is alive, and is on a beach or shore and is...

  20. 25 CFR 216.1 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS SURFACE EXPLORATION, MINING, AND RECLAMATION OF... development of the mineral resources underlying Indian lands where mining is authorized. However, interest of... surface mining of, such minerals, adequate measures be taken to avoid, minimize, or correct damage to the...

  1. 25 CFR 216.2 - Scope.

    Science.gov (United States)

    2010-04-01

    ... AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS SURFACE EXPLORATION, MINING, AND RECLAMATION OF... regulations in this part provide for the protection and conservation of nonmineral resources during operations for the discovery, development, surface mining, and onsite processing of minerals under permits or...

  2. 50 CFR 216.23 - Native exceptions.

    Science.gov (United States)

    2010-10-01

    ...) The Anchorage Field Office of NMFS is located in room 517 of the Federal Office Building, 222 West 7th... to each 5-year interval. Criteria for categorizing growth rates are presented below as an algorithm... Harvest Table and the following algorithm will be used to determine harvest levels for each 5-year period...

  3. Reference: 216 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ntification of the HCF107 gene that is involved in the 5'-end processing/stability ...transcripts which are further regulated by differential stability and expression. Here we describe the ide

  4. 25 CFR 216.9 - Reports.

    Science.gov (United States)

    2010-04-01

    ... for reclamation and the results thereof. (6) A statement and description of reclamation work remaining... report shall— (i) Identify the permit or lease; (ii) Show the type of planting or seeding, including mixtures and amounts; (iii) Show the date of planting or seeding; (iv) Identify or describe the areas of...

  5. 41 CFR 101-6.216 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...) grants and loans of Federal funds, (2) the grant or donation of Federal property and interests in... organization, or sole proprietorship as a whole; or (B) Which is principally engaged in the business of... the construction, expansion, renovation, remodeling, alteration or acquisition of facilities. (h) The...

  6. 20 CFR 216.70 - General.

    Science.gov (United States)

    2010-04-01

    ... living employee can establish another individual's eligibility for a spouse annuity or cause an increase... child in care; (b) To establish annuity eligibility for a widow(er), or surviving divorce spouse or...

  7. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  8. 49 CFR 571.216a - Standard No. 216a; Roof crush resistance; Upgraded standard.

    Science.gov (United States)

    2010-10-01

    ... S7.1 through S7.6. S7.1Support the vehicle off its suspension and rigidly secure the sills and the... is parallel to the vertical plane through the vehicle's longitudinal centerline; (b) Its transverse... the lower surface of the test device is within 10 mm of the transverse vertical plane 254 mm forward...

  9. 49 CFR 571.216 - Standard No. 216; Roof crush resistance; Applicable unless a vehicle is certified to § 571.216a.

    Science.gov (United States)

    2010-10-01

    ... roof has been removed, in part or in total, and replaced by a roof that is higher than the original.... S7.1 Place the sills or the chassis frame of the vehicle on a rigid horizontal surface, fix the... lower surface of the test device at a rate of not more than 13 millimeters per second until reaching the...

  10. Demonstration of high responsivity(~2.16 A/W) and detectivity(~1011 Jones) in the long wavelength (~10.2μm) from InGaAs/GaAs quantum dot infrared photodetector with quaternary InAlGaAs capping

    Science.gov (United States)

    Chakrabarti, Subhananda; Adhikary, Sourav; Halder, Nilanjan; Aytac, Yigit; Perera, A. G. U.

    2012-06-01

    The Self-assembled InGaAs/GaAs quantum dot infrared detectors (QDIPs) have emerged as a promising technology in many applications such as missile tracking, night vision, medical diagnosis, environmental monitoring etc. On account of the 3-D confinement of carriers in QDs, a number of advantages arise over the QW counterparts. Here we report a quaternary (InAlGaAs) capped In(Ga)As/GaAs QDIP. The samples were grown on a semi-insulating (001) GaAs substrate by solid source molecular beam epitaxy (MBE), and the dots were then capped with a combination of 30A quaternary (In0.21Al0.21Ga0.58As) and 500Å of GaAs layer. Both the QD layer and the combination capping were repeated for 35 periods. The device was fabricated by conventional photolithography, ICP etching and metal evaporation technique. XTEM image of the sample depicted nice stacking of defect free quantum dot layers. The dark current is symmetric both for positive and negative bias with a low dark current density of 4.32x10-6A/cm2 at 77K and 1.6 x10 -3A/cm2 at 200K at a bias of 2V. The high intense peak response observed at 10.2μm, with a very narrow spectral width (▵λ/λ) of 14% (▵λ is the FWHM), is probably due to bound-to-bound transition of carriers in the QDs. A very high responsivity of 2.16 A/W was measured at a bias of -0.40 Volt bias. The highest value of detectivity is measured to be ~1011 cm.Hz1/2/W at a bias of 0.3V.

  11. All projects related to | Page 216 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-07-09

    As African countries move toward universal health coverage, it is clear there is a shortage of African experts with applied research skills in health financing such as fiscal space analysis, needs-based resource allocation methods, and benefit incidence analysis of the equity impact of health funding. Start Date: July 9, 2012.

  12. Page 1 216 Nalini Venkatasubramanian et all of determinacy issues ...

    Indian Academy of Sciences (India)

    1-19) and used as needed. 5.2 Concurrent object oriented programming. Object Oriented Programming (OOP) is another programming paradigm whose roots go as far back as Simula (a simulation language), with significant contributions made by developments in languages such as Smalltalk and Flavors (Wegner 1990).

  13. Dicty_cDB: SFL216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6. 1 Translated Amino Acid sequence fsfflsphflflyyilslflfyi*inff*kn*kknlkqliqngkhwwnsrkmycmc*nci lnrkdcs*r*rr*enfp...lkqliqngkhwwnsrkmycmc*nci lnrkdcs*r*rr*enfpqimfkmysl*ayiksw*lciikwxill*ttfqtiirhqr*lr* rfr*iktf*kmdttshpnwyf

  14. Dicty_cDB: SHD216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CD169096.1 MM1-0024G-M078-E11-U.B MM1-0024 Schistosoma mansoni cDNA cloneMM1-0024G-M078-E11.B, mRNA...|CD169707.1 MM1-0024T-M086-B01-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024T-M086-B01.B, mRNA...|CD169077.1 MM1-0024G-M078-D02-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024G-M078-D02.B, mRNA...|CD169818.1 MM1-0024T-M087-D03-U.B MM1-0024 Schistosoma mansoni cDNA clone MM1-0024T-M087-D03.B, mRNA...|CD168683.1 MM1-0023U-M091-D09-U.B MM1-0023 Schistosoma mansoni cDNA clone MM1-0023U-M091-D09.B, mRNA

  15. Dicty_cDB: CHO216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 119091G10.y1 1119 - RescueMu Grid AA Zea mays genomic, genomic survey sequence. 3...4 0.13 2 CG721744 |CG721744.1 1119068G10.x1 1119 - RescueMu Grid AA Zea mays genomic, genomic survey sequenc...e. 34 0.13 2 CG731059 |CG731059.1 1119133A07.y1 1119 - RescueMu Grid AA Zea mays genomic, genomic survey seq

  16. 50 CFR 216.232 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Rocket Launches from the Kodiak Launch Complex, Kodiak... not intentionally, take Steller sea lions by Level B harassment, take adult Pacific harbor seals by...

  17. 50 CFR 216.234 - Mitigation, monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Rocket Launches from the Kodiak Launch... five replicate fixed-wing aerial surveys of all hauled out Steller sea lions and harbor seals at Ugak...

  18. Dicty_cDB: SSE216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (Q54UK7) RecName: Full=HssA/B-like protein 51; 56 5e-07 (Q54UN3) RecName: Full=HssA/B-like protein 36; 52 9e-06...(Q54UN1) RecName: Full=HssA/B-like protein 38; 52 9e-06 (Q54UM7) RecName: Full=HssA/B-like protein 41; 52 9e-06...(Q54UL4) RecName: Full=HssA/B-like protein 45; 50 2e-05 (Q54UK9) RecName: Full=HssA/B-like protein 49; 50 2e-05...(Q54UK8) RecName: Full=HssA/B-like protein 50; 50 2e-05 (Q54UL3) RecName: Full=HssA/B-like protein 46; 47 2e-04...(Q54UL0) RecName: Full=HssA/B-like protein 48; 46 5e-04 (Q54UM6) RecName: Full=HssA/B-like protein 42; 43 0

  19. (216-IJBCS-Article-A B Béchir)

    African Journals Online (AJOL)

    RHUMSIKI

    L'évaluation de la disponibilité saisonnière du fourrage ligneux en zone soudanienne du Tchad a été menée dans le terroir de N'Guetté 1. L'objectif de cette étude a été d'analyser les variations saisonnières des ressources fourragères ligneuses dans ce terroir. La méthode de sondage systématique a été utilisée pour la.

  20. 48 CFR 1652.216-71 - Accounting and Allowable Cost.

    Science.gov (United States)

    2010-10-01

    ... indirectly imposed on FEHB premiums by any State, the District of Columbia, or the Commonwealth of Puerto... following clause shall be inserted in all FEHBP contracts based on cost analysis (experience rated...) Based on the results of either the independent audit prescribed by the Guide or a Government audit, OPM...

  1. 50 CFR 216.217 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico... Requirements For All Explosive Severance Scenarios.1 Blasting Category Configuration (Charge wt/ placement...) Post Post Det Aerial Survey (Yes/No) Waiting Period (min) BML Shelf ( 200 m) A2 (856 ft) 90 N/A N/A 30...

  2. 12 CFR Appendix A to Part 216 - Model Privacy Form

    Science.gov (United States)

    2010-01-01

    ... information to market to me.” A financial institution that chooses to offer an opt-out for joint marketing... institutions to jointly market to me.” (h) Barcodes. A financial institution may elect to include a barcode and..., at the option of a financial institution, including a group of financial institutions that use a...

  3. Dicty_cDB: SSK216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available WLSNTLTSSSK*mt*evnlie firffnylii*lnycclilk*kkkkpxlyk***ik*****k Translated Amino Acid sequence (All Frames) ...LNEDELRDAVLLVFCNKQDLPN AMSVAEVTDKLNLHSLRSRKWYIQSTCATSGDGLYEGLDWLSNTLTSSSK*mt*evnlie firffnylii*lnycclil

  4. Dicty_cDB: SHF216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 85 |BI863585.1 kx46a06.y1 Parastrongyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides tric...e. 66 5e-18 4 BI863575 |BI863575.1 kx45h07.y1 Parastrongyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides...e-15 3 BI451383 |BI451383.1 kx23e09.y1 Parastrongyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastr...ongyloides trichosuri cDNA 5' similar to SW:EF2_CAEEL P29691 ELONGATION FACTOR 2 ;,

  5. 42 CFR 57.216a - Performance standard.

    Science.gov (United States)

    2010-10-01

    ... share of the revolving fund to the Department. A school terminated for failure to comply with the..., except as provided in paragraph (b) of this section, each school must have a default rate (as calculated under paragraph (a) of this section) of not more than 5 percent. (a) The default rate for each school...

  6. 50 CFR 216.104 - Submission of requests.

    Science.gov (United States)

    2010-10-01

    ... potential conflicts regarding any aspects of either the operation or the plan of cooperation; (iii) A... conflicts and to notify the communities of any changes in the operation; (13) The suggested means of... of marine mammals near the activity site(s) including migration and other habitat uses, such as...

  7. 50 CFR 216.271 - Effective dates and definitions.

    Science.gov (United States)

    2010-10-01

    ... whale of any species, dwarf or pygmy sperm whales, short-finned pilot whales, humpback whales, sperm whales, blue whales, fin whales, or sei whales. (iii) A group of 2 or more cetaceans of any species...

  8. Education in Healthy Lifestyles: Curriculum Implications. Fastback 216.

    Science.gov (United States)

    Seffrin, John R.; Torabi, Mohammad R.

    The nature of a healthy lifestyle and its significance to quality of life is examined. Following a discussion on what is involved in a healthy lifestyle, major health problems are described: (1) smoking; (2) alcohol and drug abuse; (3) sexually transmitted diseases; (4) diet and obesity; (5) stress; and (6) inadequate sleep. Recommendations are…

  9. Aeronautical Engineering: A Continuing Bibliography with Indexes (Supplement 216)

    Science.gov (United States)

    1987-08-01

    obstacles that are not time related suggests that used in the escape maneuver on the Flight Director Displays. remedial actions, in addition to an...FREQUENCY vibration-damping components of gas turbine engines made of [MINIMIZATSIIA AMPLITUDY KOLEBANII SIMMETRICHNOGO MR material, a nonwoven porous

  10. 50 CFR 216.175 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... Communication Plan, the Holder of the Authorization must notify NMFS immediately (or as soon as clearance... of, any Navy training exercise utilizing MFAS, HFAS, or underwater explosive detonations. The Navy...

  11. 50 CFR 216.50 - Importation at designated ports.

    Science.gov (United States)

    2010-10-01

    ..., Calif. Los Angeles, Calif. New Orleans, La. Seattle, Wash. Honolulu, Hi. (c) Additionally, marine... or the Virgin Islands and which are not to be forwarded or transhipped within the United States may... Rico—San Juan Guam—Honolulu, Hi. American Samoa—Honolulu, Hi. Virgin Islands—San Juan, P.R. (d...

  12. Dicty_cDB: VFK216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 001 (Q9Y512) RecName: Full=Sorting and assembly machinery component ... 47 0.001 BC011681_1( BC011681...assembly machinery component ... 46 0.003 (Q8BGH2) RecName: Full=Sorting and assembly machinery component

  13. Dicty_cDB: CHE216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Z28234 |Z28234.1 S.cerevisiae chromosome XI reading frame ORF YKR009c. 40 9.6 1 X65124 |X65124.1 S...1 Z28235 |Z28235.1 S.cerevisiae chromosome XI reading frame ORF YKR010c. 40 9.6 1 AZ888441 |AZ888441

  14. 50 CFR 216.275 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... outlined in the SOCAL Range Complex Stranding Communication Plan, the Navy must notify NMFS immediately (or..., and how long the delay was. (M) If source in use (i.e., in paragraph (f)(1)(ii)(J) of this section) is... detonations/exercise, and how many minutes before or after (J) Distance of marine mammal from actual...

  15. Paolo Sortino, Elisabeth, Torino, Einaudi, 2011, pp. 216.

    African Journals Online (AJOL)

    User

    arte e della storia hanno il loro teatro di elezione, è facile pronosticare al mito di Partenope, affascinante e ingombrante, attraente e irritante, un lungo futuro. Franco Arato. (Università di Torino). Paolo Sortino, Elisabeth, Torino, Einaudi, 2011, ...

  16. 50 CFR 216.241 - Effective dates and definitions.

    Science.gov (United States)

    2010-10-01

    ... detonation of explosives within 14 nm nm (Atlantic Ocean) or 17 nm (Gulf of Mexico) of any live, in the water... sperm whales, melon-headed whales, pilot whales, right whales, humpback whales, sperm whales, blue...

  17. 48 CFR 52.216-7 - Allowable Cost and Payment.

    Science.gov (United States)

    2010-10-01

    ... Contractor's practice is to make contributions to the retirement fund quarterly or more frequently; and (ii...) Shall be the anticipated final rates; and (2) May be prospectively or retroactively revised by mutual... of the fee (if any) not previously paid. (2) The Contractor shall pay to the Government any refunds...

  18. 27 CFR 40.216 - Notice for smokeless tobacco.

    Science.gov (United States)

    2010-04-01

    ... BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS..., the designation “chewing tobacco” or “snuff.” As an alternative, packages of chewing tobacco may be... product contained therein. As an alternative, the shipping cases containing packages of chewing tobacco or...

  19. Dicty_cDB: CFK216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sllmkinselhqamkp*wklsri*kprttefqslkmkl ml*iyy*mksqkvlkscalavvplmksvsrkfisvmilhsst...sllmkinselhqamkp*wklsri*kprtte fqslkmklml*iyy*mksqkvlkscalavvplmksvsrkfisvmilhsstfikrf*lyql inklmlvkml*phntf

  20. 48 CFR 52.216-10 - Incentive Fee.

    Science.gov (United States)

    2010-10-01

    ... Government options under this contract, compensation for spare parts or other supplies and services ordered... Infringement clause; (iv) The purchase and maintenance of additional insurance not in the target cost and...

  1. 10 CFR 216.4 - Evaluation by DOE of applications.

    Science.gov (United States)

    2010-01-01

    ... considers relevant including, but not limited to, the following: (1) Quantity of energy involved; (2..., but not limited to, the following: (1) Availability and utility of substitute materials and equipment...

  2. Dicty_cDB: VSG216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A sequence. 50 2e-08 2 CD477300 |CD477300.1 eca01-12ms1-h08 Eca01 Eschscholzia californica cDNA clone eca01-...12ms1-h08 5', mRNA sequence. 42 6e-05 2 CD476897 |CD476897.1 eca01-7ms1-c05 Eca01 Eschscholzia californica c...DNA clone eca01-7ms1-c05 5', mRNA sequence. 42 6e-05 2 CD477145 |CD477145.1 eca01...|AY087862.1 Arabidopsis thaliana clone 39018 mRNA, complete sequence. 36 2e-04 3 CD477559 |CD477559.1 eca01-...quence. 50 5e-09 2 BG259081 |BG259081.1 602379133F1 NIH_MGC_92 Homo sapiens cDNA clone IMAGE:4509608 5', mRN

  3. Dicty_cDB: SHH216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Frame A: iiiyfyyffi*lkk*lytsynhyshfffffxnxiffxxlkkxggxknk*nxxxlx*xkx* nkik*xkix**xkxxnxx*xxinxk*inx*ink*i...xk*ink*ixx*ixk*xnx*x--- Frame B: llfifiiflfn*knnytllttithtffffxxixffsxxxkxxgvxkinkxxxx*xkxkxk ik*nkxkxfnkxxxkixxnxx

  4. 47 CFR Appendix to Part 216 - NCS Directives

    Science.gov (United States)

    2010-10-01

    ... Telecommunications Program (NLP) Funding NCS Directive 3-1—Telecommunications Operations—Telecommunications Service... Program (NLP) Funding,” November 30, 1987. c. “National Security Emergency Preparedness (NSEP.... Definitions. a. The National Level NSEP Telecommunications Program (NLP). Those NSEP telecommunications...

  5. 50 CFR 216.165 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... one who has graduated from a veterinary school accredited by the American Veterinary Medical Association Council on Education, has a certificate by the American Veterinary Graduates Association's Education Commission for Foreign Veterinary Graduates, or has received equivalent formal education, as...

  6. 48 CFR 1352.216-76 - Placement of orders.

    Science.gov (United States)

    2010-10-01

    ... of order; (2) Contract number and order number; (3) Item number and description, quantity, and unit price or estimated cost or fee; (4) Delivery or performance date; (5) Place of delivery or performance... contact information for the DOC task and delivery order ombudsman is ____. (End of clause) ...

  7. 27 CFR 21.6 - Incorporations by reference.

    Science.gov (United States)

    2010-04-01

    ..._locations.html. (c) Material from the “Official Methods of Analysis of the Association of Official Analytical Chemists (13th Edition 1980)” (AOAC) is incorporated by reference in this part. This incorporation... the Association of Official Analytical Chemists, 11 North 19th Street, Suite 210, Arlington, Virginia...

  8. 50 CFR 216.242 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ...). (J) Striped dolphin (Stenella coeruleoalba)—873620 (an average of 174274 annually). (K) Common... (Stenella attenuata)—696530 (an average of 139306 annually). (G) Atlantic spotted dolphin (Stenella frontalis)—1881805 (an average of 376361 annually). (H) Spinner dolphin (Stenella longirostris)—105775 (an...

  9. 50 CFR 216.172 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... average of 421 annually). (K) Striped dolphins (Stenella coeruleoalba)—16045 (an average of 3209 annually...), Short-finned pilot whale (Globicephala macrorynchus), Striped dolphin (Stenella coeruleoalba), and... dolphin (Tursiops truncatus)—3670 ( an average of 734 annually). (I) Pan-tropical dolphins (Stenella...

  10. 50 CFR 216.272 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... 1516 annually) (J) Pan-tropical spotted dolphin (Stenella attenuata)—100 (an average of 20 annually) (K) Spinner dolphin (Stenella longirostris)—100 (an average of 20 annually) (L) Striped dolphin (Stenella coeruleoalba)—9190 (an average of 1838 annually) (M) Long-beaked common dolphin (Delphinus capensis)—23145 (an...

  11. 50 CFR 216.245 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... to categorize in any way, the observed behavior of the animals (such as animal closing to bow ride... explosive detonations. The Navy shall provide NMFS with species or description of the animal(s), the condition of the animal(s) (including carcass condition if the animal is dead), location, time of first...

  12. 20 CFR 216.15 - Special current connection test.

    Science.gov (United States)

    2010-04-01

    ... or craft as his or her most recent railroad service, regardless of the location where that service... allowance. An employee who accepts a separation allowance and in so doing relinquishes his or her seniority... paragraph (c) of this section, receipt of a separation allowance will not affect a current connection under...

  13. Dicty_cDB: VSD216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HSP's gapped (non-prelim): 0 length of query: 90 length of database: 80,480,566 effective... HSP length: 16 effective length of query: 74 effective length of database: 78,918,790 effective se...uery: 90 length of database: P,794,892,705 effective HSP length: 21 effective length of query: 69 effective ...length of database: P,261,936,330 effective search space: 2226073606770 effective search space used: 2226073...arch space: 5839990460 effective search space used: 5839990460 T: 0 A: 0 X1: 6 (11.9 bits) X2: 15 (29.7 bits

  14. Publications | Page 216 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  15. 48 CFR 352.216-70 - Additional cost principles.

    Science.gov (United States)

    2010-10-01

    ... clause: Additional Cost Principles (January 2006) (a) Bid and proposal (B & P) costs. (1) B & P costs are the immediate costs of preparing bids, proposals, and applications for potential Federal and non-Federal contracts, grants, and agreements, including the development of scientific, cost, and other data...

  16. 48 CFR 3452.216-70 - Additional cost principles.

    Science.gov (United States)

    2010-10-01

    ... scientific, cost and other data needed to support the bids, proposals and applications. Bid and proposal... as prescribed in 3416.307(b): Additional Cost Principles (AUG 1987) (a) Bid and Proposal Costs. Bid and proposal costs are the immediate costs of preparing bids, proposals, and applications for...

  17. 50 CFR 216.22 - Taking by State or local government officials.

    Science.gov (United States)

    2010-10-01

    ... sick, it shall be permissible to place it in temporary captivity until such time as it is able to be... in accordance with this subsection whether the animal is dead at the time of taking or dies... Secretary, the report shall contain a description of: (1) The animal involved; (2) The circumstances...

  18. 216 Ficus Benjamina Sensitization in Adult Patients with Rhinitis

    Science.gov (United States)

    González-Díaz, Sandra; Arias-Cruz, Alfredo; Valdes, Dora; Gallego, Claudia; del Carmen Zarate, Maria; Galindo, Gabriela; Garcia-Calderin, Diego; Mejia, Karla; Dominguez, Luis; Calva, Maricruz

    2012-01-01

    Background In Monterrey there are a considerable number of Ficus benjamina trees, but the awareness-related information to this plant is scarce. The objective of this study is to determine the frequency of sensitization to Ficus benjamina in patients with rhinitis who were attended the Regional Centre of Allergy and Clinical Immunology of Monterrey, Mexico. Methods Observational, transversal and descriptive study. We included patients over 18 years old with chronic rhinitis, which completed a questionnaire to assess exposure to Ficus benjamina. Skin prick tests (SPT) to common aeroallergens in our region with extract of Ficus benjamina (Allerstand Company) had done in all subjects. Results A total of 177 patients were included, mean age was 38 years, 65% (115) were female, 135 (76%) reported contact with a Ficus benjamina tree in their home or neighbor. 12 (17%) patients had a positive skin test to Ficus benjamina, but up to 15% (26) had clinical manifestations when they were close to a tree of Ficus benjamina. Most patients with positive skin test to Ficus benjamina (76.9%, 9) had positive test more than one of the aeroallergen tested. The association between Ficus benjamina and sensitization to other aeroallergens, as well as the symptoms associated to the contact with the tree was not statistically significant. Conclusions Sensitization to Ficus benjamina is common and was similar to that reported in European countries. To demonstrate the association between sensitization to Ficus benjamina and symptoms should be made studies with nasal challenge test.

  19. 216 Ficus Benjamina Sensitization in Adult Patients with Rhinitis

    OpenAIRE

    González-Díaz, Sandra; Arias-Cruz, Alfredo; Valdes, Dora; Gallego, Claudia; del Carmen Zarate, Maria; Galindo, Gabriela; Garcia-Calderin, Diego; Mejia, Karla; Dominguez, Luis; Calva, Maricruz

    2012-01-01

    Background In Monterrey there are a considerable number of Ficus benjamina trees, but the awareness-related information to this plant is scarce. The objective of this study is to determine the frequency of sensitization to Ficus benjamina in patients with rhinitis who were attended the Regional Centre of Allergy and Clinical Immunology of Monterrey, Mexico. Methods Observational, transversal and descriptive study. We included patients over 18 years old with chronic rhinitis, which completed a...

  20. 48 CFR 52.216-17 - Incentive Price Revision-Successive Targets.

    Science.gov (United States)

    2010-10-01

    ... this contract, using the statement of costs incurred plus an estimate of costs to complete performance... of the total initial target cost. (3) If the total firm target cost plus the total firm target profit... total firm target cost, the adjustment is the total firm target profit, plus _ percent of the amount by...

  1. Page 1 216 - - L. D. Sanghvi The same ratio for American Indians is ...

    Indian Academy of Sciences (India)

    8. Ikin, E. W., Prior, A. M., “The distribution of the A1A,BO blood groups in England,”. Race, R. R., and Taylor, Ann, Eugenics, 1939, 9,409. -. G. I. * -. 9. Landsteiner, K., and . “On the cold agglutinins in human serum,” J. Immunol,. Levine, Ph. 1926, 12, 441. 10, − ... “On the inheritance and racial distribution of agglutinable.

  2. Page 1 216 M N Chandrasekharaiah o Mechanical strength of the ...

    Indian Academy of Sciences (India)

    steels are amenable to all welding processes if a few of the factors are taken into account. Solidification cracking is the most frequently encountered problem; autogenous welds may be subjected to variable penetration; the welding procedure may affect corrosion resistance; several factors must be considered if post weld ...

  3. 30 CFR 77.216 - Water, sediment, or slurry impoundments and impounding structures; general.

    Science.gov (United States)

    2010-07-01

    ... structures which impound water, sediment, or slurry shall be required if such an existing or proposed impounding structure can: (1) Impound water, sediment, or slurry to an elevation of five feet or more above... design and construction of all new water, sediment, or slurry impoundments and impounding structures...

  4. 30 CFR 77.216-1 - Water, sediment or slurry impoundments and impounding structures; identification.

    Science.gov (United States)

    2010-07-01

    ..., operating, or controlling the structure, shall be located on or immediately adjacent to each water, sediment... applicable. (a) For existing water, sediment or slurry impounding structures, markers shall be placed before May 1, 1976. (b) For new or proposed water, sediment, or slurry impounding structures, markers shall...

  5. 14 CFR 21.6 - Manufacture of new aircraft, aircraft engines, and propellers.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Manufacture of new aircraft, aircraft... Manufacture of new aircraft, aircraft engines, and propellers. (a) Except as specified in paragraphs (b) and (c) of this section, no person may manufacture a new aircraft, aircraft engine, or propeller based on...

  6. 33 CFR 110.216 - Pacific Ocean at Santa Catalina Island, Calif.

    Science.gov (United States)

    2010-07-01

    ... place are prohibited. (4) The instructions of the Captain of the Port requiring vessels to anchor bow and stern, or with two bow anchors, or requiring shifting the anchorage of any vessel within the...

  7. 18 CFR 380.16 - Environmental reports for section 216 Federal Power Act Permits.

    Science.gov (United States)

    2010-04-01

    ... milepost, wetland crossings as determined by field delineations using the current Federal methodology. (5... properties, and types and amounts of relocation assistance payments. (6) Conduct a fiscal impact analysis... could place the proposed facilities at risk, the potential effects of those hazards on the facility, and...

  8. 48 CFR 52.216-4 - Economic Price Adjustment-Labor and Material.

    Science.gov (United States)

    2010-10-01

    ... time during contract performance, the rates of pay for labor (including fringe benefits) or the unit... resulting from the adjustment. The Contractor shall continue performance pending agreement on, or.... (d) The Contracting Officer may examine the Contractor's books, records, and other supporting data...

  9. 216 election in lesotho: voting patterns and voter apathy of basotho ...

    African Journals Online (AJOL)

    2007-02-17

    Feb 17, 2007 ... Two smaller parties outside parliament; Sefate Democratic Congress [SDC], United Party [UP],. Social Democratic Party [SDP], Lesotho Education Party [LEP], Kopanang Basotho Party [KBP], New Lesotho. Freedom Party [NLFP] and National Democratic Party [NDP],also participated in by-elections on the ...

  10. Yeast Interacting Proteins Database: YBR216C, YML007W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available s bait as bait (1) Rows with this bait as prey (0) YML007W YAP1 Basic leucine zipper (bZIP) transcription fa...me YAP1 Prey description Basic leucine zipper (bZIP) transcription factor required for oxidative stress tole

  11. Page 1 216 K. Bhaskaran Nair away. The difficulty of sectioning the ...

    Indian Academy of Sciences (India)

    Material to be sectioned was dehydrated rapidly through alcohol up to 90% strength and then cleared in methyl salicylate. Before embedding it was passed through ... particularly of the early stages. For these the embryonic area was dissected out free from yolk, stained in picrocarmine and mounted in strong glycerine.

  12. 10 CFR 1021.216 - Procurement, financial assistance, and joint ventures.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Procurement, financial assistance, and joint ventures... joint ventures. (a) This section applies to DOE competitive and limited-source procurements, to awards of financial assistance by a competitive process, and to joint ventures entered into as a result of...

  13. 32 CFR Appendix A of Part 216 - Military Recruiting Sample Letter of Inquiry

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Military Recruiting Sample Letter of Inquiry A... DEFENSE (CONTINUED) MISCELLANEOUS MILITARY RECRUITING AND RESERVE OFFICER TRAINING CORPS PROGRAM ACCESS TO... Recruiting Sample Letter of Inquiry (Tailor letter to situation presented) Dr. John Doe, President, ABC...

  14. 7 CFR 2.16 - Under Secretary for Farm and Foreign Agricultural Services.

    Science.gov (United States)

    2010-01-01

    ... policy for, and issue, receipts under section 2501A(e) of the Food, Agriculture, Conservation, and Trade... the Department of State, the United States Trade Representative, the Trade Policy Committee, the.... (iii) Conduct studies of worldwide production, trade, marketing, prices, consumption, and other factors...

  15. Aviation Program Administrators' Perceptions of Specialized Aviation Accreditation under Public Law 111-216

    Science.gov (United States)

    Christensen, Cody

    2013-01-01

    Sherman (2006) and Prather (2007) studied why so few of the schools offering aviation-related curriculum leading to an associate's or bachelor's degree do not seek specialized accreditation. The goal of this study was to update the field of specialized aviation accreditation in the new environment of the Airline Safety and Federal Aviation…

  16. 12 CFR 216.6 - Information to be included in privacy notices.

    Science.gov (United States)

    2010-01-01

    ... method(s) by which the consumer may exercise that right at that time; (7) Any disclosures that you make... nonaffiliated companies: (1) For your everyday business purposes, such as to process transactions, maintain...

  17. 50 CFR 216.41 - Permits for scientific research and enhancement.

    Science.gov (United States)

    2010-10-01

    ... ecology of the species or stock, or to identifying, evaluating, or resolving conservation problems for the...) Personnel involved in research activities shall be reasonable in number and limited to: (A) Individuals who...

  18. 77 FR 49851 - Nineteenth Meeting: RTCA Special Committee 216, Aeronautical Systems Security (Joint Meeting With...

    Science.gov (United States)

    2012-08-17

    ...-326A and ED-204 Open Consultation/FRAC requirements & expectations Coordination between drafting... resolution of Blocking Points. Interaction with ED-201/ED-204 drafting groups, where necessary: Segregation... Change to Type Design Consistency of (Table of) Contents between ED-202 & ED-203 ED-204 11h30 to 17h00...

  19. Weapons and Tactics Instructor Course 2-16 Sleep and Performance Study

    Science.gov (United States)

    2017-03-01

    demonstrate mastery of basic aviation knowledge. Additionally, during this time, Tactical Risk Management (TRM) training educates students on how to...participant to look up a definition if they are confused by a vocabulary word (which occurred on a few of the POMS questionnaires). c. Measuring

  20. 50 CFR 226.216 - Critical habitat for elkhorn (Acropora palmata) and staghorn (A. cervicornis) corals.

    Science.gov (United States)

    2010-10-01

    ... MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE... macroalgae cover and sediment cover. (b) Critical Habitat Areas. Critical habitat includes one specific area...

  1. 47 CFR 15.241 - Operation in the band 174-216 MHz.

    Science.gov (United States)

    2010-10-01

    ... MHz. (a) Operation under the provisions of this section is restricted to biomedical telemetry devices... meters. The emission limits in this paragraph are based on measurement instrumentation employing an...

  2. Page 1 216 R Ashiya et al command Selector switches any one of ...

    Indian Academy of Sciences (India)

    Set with address in the command console and transmitted with a single depression of the “GO' switch provided in the console. Seven banks of 5 key piano switches are provided to select any one of the 35 commands. The code is first converted into a decimal form and then it is displayed on the front panel. Subcarrier level ...

  3. 50 CFR 216.45 - General Authorization for Level B harassment for scientific research.

    Science.gov (United States)

    2010-10-01

    ... research is to be conducted, e.g., geographic name or lat./long.; (iv) The period(s) of time over which the... part of the research described in the letter of intent is likely to result in a taking of a marine... the General Authorization, and that a scientific research permit is required to conduct all or part of...

  4. Yeast Interacting Proteins Database: YNL216W, YLR453C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available nscription, depending on binding site context; also binds telomere sequences and plays a role in telomeric p...NA-binding protein involved in either activation or repression of transcription, depending on binding site context

  5. 50 CFR 216.120 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    ...) Launching up to 30 space and missiles vehicles each year from Vandenberg Air Force Base, for a total of up to 150 missiles and rockets over the 5-year period of the regulations in this subpart, (2) Launching up to 20 rockets each year from Vandenberg Air Force Base, for a total of up to 100 rocket launches...

  6. 216. Experiencia con la terapia de aspiración continua como tratamiento de la mediastinitis

    Directory of Open Access Journals (Sweden)

    S. Ramis

    2010-01-01

    Conclusiones: La terapia VAC es un método seguro, que permite lograr una estabilidad torácica completa, logrando disminuir las complicaciones, tanto sépticas como respiratorias, en los pacientes con mediastinitis aguda.

  7. 48 CFR 3452.216-71 - Negotiated overhead rates-fixed.

    Science.gov (United States)

    2010-10-01

    ... provisions of the clause entitled “Allowable Cost and Payment”, the allowable indirect costs under this... amount greater or less than the indirect costs determined for that period, the greater or lesser amount(s... acceptability of cost allocation methods shall be determined in accordance with part 31 of the Federal...

  8. 29 CFR 780.216 - Nursery activities generally and Christmas tree production.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Nursery activities generally and Christmas tree production... Nursery activities generally and Christmas tree production. (a) The employees of a nursery who are engaged... horticultural commodities such as the following are employed in agriculture: (1) Planting seedlings in a nursery...

  9. 48 CFR 1852.216-77 - Award fee for end item contracts.

    Science.gov (United States)

    2010-10-01

    ... award fee or base fee will be paid to the Contractor if the final award fee evaluation is “poor... Government will advise the Contractor in writing of the evaluation results. The plan may be revised... substantially exceed the anticipated final evaluation score, or (ii) the prior interim evaluation is “poor...

  10. 50 CFR 216.47 - Access to marine mammal tissue, analyses, and data.

    Science.gov (United States)

    2010-10-01

    ... and the contributor; and the sequences of tissue specimen samples that are used/released for genetic... animal; and (ix) Agreement that credit and acknowledgment will be given to U.S. Fish and Wildlife Service... recommendations on the request and an evaluation of the study plan to the Director, Office of Protected Resources...

  11. 42 CFR 457.216 - Treatment of uncashed or canceled (voided) CHIP checks.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Treatment of uncashed or canceled (voided) CHIP... canceled (voided) CHIP checks. (a) Purpose. This section provides rules to ensure that States refund the... section— Canceled (voided) check means an CHIP check issued by a State or fiscal agent that prior to its...

  12. 26 CFR 1.216-2 - Treatment as property subject to depreciation.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Treatment as property subject to depreciation. 1... property subject to depreciation. (a) General rule. For taxable years beginning after December 31, 1961... subject to the allowance for depreciation under section 167(a) in the manner and to the extent prescribed...

  13. W-026 acceptance test plan plant control system hardware (submittal {number_sign} 216)

    Energy Technology Data Exchange (ETDEWEB)

    Watson, T.L., Fluor Daniel Hanford

    1997-02-14

    Acceptance Testing of the WRAP 1 Plant Control System Hardware will be conducted throughout the construction of WRAP I with the final testing on the Process Area hardware being completed in November 1996. The hardware tests will be broken out by the following functional areas; Local Control Units, Operator Control Stations in the WRAP Control Room, DMS Server, PCS Server, Operator Interface Units, printers, DNS terminals, WRAP Local Area Network/Communications, and bar code equipment. This document will contain completed copies of each of the hardware tests along with the applicable test logs and completed test exception reports.

  14. W-026 acceptance test plan plant control system software (submittal {number_sign} 216)

    Energy Technology Data Exchange (ETDEWEB)

    Watson, T.L., Fluor Daniel Hanford

    1997-02-14

    Acceptance Testing of the WRAP 1 Plant Control System software will be conducted throughout the construction of WRAP 1 with final testing on the glovebox software being completed in December 1996. The software tests will be broken out into five sections; one for each of the four Local Control Units and one for the supervisory software modules. The acceptance test report will contain completed copies of the software tests along with the applicable test log and completed Exception Test Reports.

  15. Length-weight relationships of 216 North Sea benthic invertebrates and fish

    NARCIS (Netherlands)

    Robinson, L.; Greenstreet, S.P.R.; Reiss, H.; Callaway, R.; Craeymeersch, J.A.M.; Boois, de I.J.

    2010-01-01

    Size-based analyses of marine animals are increasingly used to improve understanding of community structure and function. However, the resources required to record individual body weights for benthic animals, where the number of individuals can reach several thousand in a square metre, are often

  16. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (216-0611-332211)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  17. Yeast Interacting Proteins Database: YNL189W, YHR216W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available g, expression is repressed by nutrient limitation Rows with this prey as prey (1) Rows with this prey as bai...osynthesis, expression is induced by mycophenolic acid resulting in resistance to the drug, expression is repressed by nutrient limit

  18. 36 CFR 216.3 - Applicability; relationship to other public participation opportunities.

    Science.gov (United States)

    2010-07-01

    ... requirements of the Administrative Procedure Act, 5 U.S.C. 553; (2) Instructions, procedures, and other... procedures on administrative support activities such as personnel matters, procurement, service contracting... developed with public participation during land and resource management planning part 219, and other...

  19. 50 CFR 216.33 - Permit application submission, review, and decision procedures.

    Science.gov (United States)

    2010-10-01

    ... submitted through the Convention on International Trade in Endangered Fauna and Flora management authority... included regarding the environmental impact of the proposed activity to enable the Office Director: (A) To make an initial determination under the National Environmental Policy Act (NEPA) as to whether the...

  20. 20 CFR 216.23 - Work which does not affect eligibility.

    Science.gov (United States)

    2010-04-01

    ... equipment tends to show the existence of an employer-employee relationship. (15) Investment in facilities. If the worker invests in facilities which are used by the worker in performing services and which are... relationship. Facilities include equipment or premises necessary for the work, other than items such as tools...

  1. 23 CFR 450.216 - Development and content of the statewide transportation improvement program (STIP).

    Science.gov (United States)

    2010-04-01

    ...; pedestrian walkways; and bicycle facilities), except the following that may (but are not required to) be..., right-of-way, design, or construction) the following: (1) Sufficient descriptive material (i.e., type of...

  2. Strategic Forum. U.S.-Australia Alliance Relations: An Australian View. August 2005, Number 216

    Science.gov (United States)

    2005-08-01

    ease with many of the traditions and attitudes of old Europe. There are, however, important differences that arise from history and geography...of the English language and inhabit continent-sized New World countries that are ill at ease with many of the traditions and attitudes of old Europe...English language and inhabit continent-sized New World countries that are ill at ease with many of the traditions and attitudes of old Europe. There are

  3. U.S.-Australia Alliance Relations: An Australian View. Number 216

    Science.gov (United States)

    2005-08-01

    ease with many of the traditions and attitudes of old Europe. There are, however, important differences that arise from history and geography...sized New World countries that are ill at ease with many of the traditions and attitudes of old Europe. There are, however, important differences...World countries that are ill at ease with many of the traditions and attitudes of old Europe. There are, however, important differences that arise

  4. Jean-Pierre Dupuy, Pour un catastrophisme éclairé, Paris : Seuil, 2002, 216 p.

    Directory of Open Access Journals (Sweden)

    Stéphane Callens

    2003-01-01

    Full Text Available callens@univ-lille1.frJean-Pierre Dupuy prend l’exact contre-pied de toute la littérature sur les risques et le principe de précaution. Il propose un cadre théorique pour l’opposition au principe de précaution. Ce cadre est basé sur l’ argument que le problème ne serait pas celui d’une incertitude mais celui d’une absence de crédibilité de la catastrophe.Comment peut-on soutenir, comme Dupuy le fait, "qu’une catastrophe n’est pas crédible"? Ce qui n’est pas crédible, cela peut être un engagem...

  5. 75 FR 16901 - Thirteenth Meeting: EUROCAE WG-72: RTCA Special Committee 216: Aeronautical Systems Security...

    Science.gov (United States)

    2010-04-02

    .... FOR FURTHER INFORMATION CONTACT: RTCA Secretariat, 1828 L Street, NW., Suite 805, Washington, DC 20036; telephone (202) 833-9339; fax (202) 833-9434; Web site http://www.rtca.org . SUPPLEMENTARY INFORMATION...:15: Break. 11:15 to 11:30: Discuss collaboration and associated topics with other organisations...

  6. 75 FR 28319 - Thirteenth Meeting: EUROCAE WG-72: RTCA Special Committee 216: Aeronautical Systems Security...

    Science.gov (United States)

    2010-05-20

    .... FOR FURTHER INFORMATION CONTACT: RTCA Secretariat, 1828 L Street, NW., Suite 805, Washington, DC 20036; telephone (202) 833-9339; fax (202) 833-9434; Web site http://www.rtca.org . SUPPLEMENTARY INFORMATION...:15 to 11:30: Discuss collaboration and associated topics with other organisations (Arinc, DSWG, ICAO...

  7. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (216-0611-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  8. 19 CFR 10.216 - Maintenance of records and submission of Certificate by importer.

    Science.gov (United States)

    2010-04-01

    ..., quality, and reputation. (c) Correction and nonacceptance of Certificate. If the port director determines... importation of an article whose value does not exceed US$2,500, provided that, unless waived by the port...

  9. 12 CFR 216.9 - Delivering privacy and opt out notices.

    Science.gov (United States)

    2010-01-01

    ... telephone. (e) Retention or accessibility of notices for customers-(1) For customers only, you must provide..., if the customer agrees, electronically. (2) Examples of retention or accessibility. You provide a.... You may reasonably expect that a customer will receive actual notice of your annual privacy notice if...

  10. 50 CFR 216.24 - Taking and related acts incidental to commercial fishing operations by tuna purse seine vessels...

    Science.gov (United States)

    2010-10-01

    ... from the backdown channel apex to the stern tiedown point. The dolphin safety panel must consist of... that begins at the outboard end of the last bow bunch pulled and continues to at least two-thirds the distance from the backdown channel apex to the stern tiedown point. (7) Experimental fishing operations...

  11. Socioeconomic variation in diet and activity-related behaviours of Australian children and adolescents aged 2-16 years.

    Science.gov (United States)

    Cameron, A J; Ball, K; Pearson, N; Lioret, S; Crawford, D A; Campbell, K; Hesketh, K; McNaughton, S A

    2012-08-01

    Evidence for age-related variation in the relationship between obesity-related behaviours and socioeconomic position may assist in the targeting of dietary and physical activity interventions among children. To investigate the relationship between different indicators of socioeconomic position and obesity-related behaviours across childhood and adolescence. Data were from 4487 children aged 2 to 16 years participating in the cross-sectional 2007 Australian National Children's Nutrition and Physical Activity Survey. Socioeconomic position was defined by the highest education of the primary or secondary carer and parental income. Activity was assessed using recall methods with physical activity also assessed using pedometers. Intake of energy-dense drinks and snack foods, fruits and vegetables was assessed using 2 × 24-h dietary recalls. A socioeconomic gradient was evident for each dietary measure (although in age-specific analyses, not for energy-dense snacks in older children), as well as television viewing, but not physical activity. Whether each behaviour was most strongly related to parental income or education of the primary or secondary carer was age and sex dependent. The socioeconomic gradient was strongest for television viewing time and consumption of fruit and energy-dense drinks. A strong socioeconomic gradient in eating behaviours and television viewing time was observed. Relationships for particular behaviours differed by age, sex and how socioeconomic position was defined. Socioeconomic indicators define different population groups and represent different components of socioeconomic position. These findings may provide insights into who should be targeted in preventive health efforts at different life stages. © 2012 The Authors. Pediatric Obesity © 2012 International Association for the Study of Obesity.

  12. 21 CFR 216.24 - Drug products withdrawn or removed from the market for reasons of safety or effectiveness.

    Science.gov (United States)

    2010-04-01

    ... trichloroethane. Urethane: All drug products containing urethane. Vinyl chloride: All aerosol drug products containing vinyl chloride. Zirconium: All aerosol drug products containing zirconium. Zomepirac sodium: All... use as a patient preoperative skin preparation. Chlormadinone acetate: All drug products containing...

  13. 8 CFR 216.6 - Petition by entrepreneur to remove conditional basis of lawful permanent resident status.

    Science.gov (United States)

    2010-01-01

    ... conditions. Children who have reached the age of twenty-one or who have married during the period of... full-time jobs for qualifying employees. In the case of a “troubled business” as defined in 8 CFR 204.6... demonstrates to the director's satisfaction that failure to file a timely petition was for good cause and due...

  14. 20 CFR 216.74 - When a child is a full-time elementary or secondary school student.

    Science.gov (United States)

    2010-04-01

    .... If he or she is in a home schooling program as described in paragraph (a)(2) of this section, he or... education at home in accordance with a home school law of the State or other jurisdiction in which the child...

  15. In Situ Raman Spectroscopy of Supported Chromium Oxide Catalysts: 18O2-16O2 Isotopic Labeling Studies

    NARCIS (Netherlands)

    Weckhuysen, B.M.; Wachs, I.E.

    1997-01-01

    The isothermal isotopic exchange reaction of 18O2 with 16O of chromium(VI) oxide supported on zirconia, alumina, and titania has been investigated with in situ laser Raman spectroscopy. The isotopic exchange reaction is dependent on the support type, the Cr loading, and the reaction temperature.

  16. Oahu Hyperspectral Imagery 2000 (216-0611-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  17. 5 CFR 551.216 - Law enforcement activities and 7(k) coverage for FLSA pay and exemption determinations.

    Science.gov (United States)

    2010-01-01

    ... pay); (5) Employees in positions properly classified in the Correctional Officer series, Guard series... under a statutorily prescribed arrest authority; (4) Security functions in a correctional institution... Patrol Officers, and other employees whose primary duties involve similar patrol and control functions...

  18. VizieR Online Data Catalog: ExoMol line lists for H216O2 (Al-Refaie+, 2016)

    Science.gov (United States)

    Al-Refaie, A. F.; Polyansky, O. L.; Tennyson, J.; Yurchenko, S. N.

    2016-06-01

    The data are in two parts. The first, h2o20-85.dat contains a list of 7,560,352 rovibrational states. Each state is labelled with: six normal mode vibrational quantum numbers the torsional symmetry number (tau) and the vibrational symmetry; three rotational quantum numbers including the total angular momentum J and rotational symmetry; the total symmetry quantum number Gamma and the running number in the same J,Gamma block. In addition there are six local mode vibrational numbers and the largest coefficient used to assign the state in question. Each rovibrational state has a unique number, which is the number of the row in which it appears in the file. This number is the means by which the state is related to the second part of the data system, the transitions files. The total degeneracy is also given to facilitate the intensity calculations. Because of their size, the transitions are listed in 60 separate files, each containing all the transitions in a 100cm-1 frequency range. These and their contents are ordered by increasing frequency. The name of the file includes the lowest frequency in the range; thus the a-0500.dat file contains all the transitions in the frequency range 500-600cm-1. The transition files contain three columns: the reference number in the energy file of the upper state; that of the lower state; and the Einstein A coefficient of the transition. The energy file and the transitions files are zipped, and need to be extracted before use. There is a Fortran 90 programme, s_APTY.f90 which may be used to generate synthetic spectra (see s_APTY.txt for details). Using this, it is possible to generate absorption or emission spectra in either 'stick' form or else cross-sections convoluted with a gaussian with the half-width at half maximum being specified by the user, or with a the temperature-dependent doppler half-width. Sample input files s*.inp for use with sAPTY.f90 are supplied. (10 data files).

  19. [Galen of Pergamum (129-216/217 AD) and his contribution to urology: part I: life, work and medical system].

    Science.gov (United States)

    Marx, F J

    2013-04-01

    Galen of Pergamum was, along with Hippocrates, the most influential physician and undoubtedly the most important medical scholar of classical antiquity. His anatomy and his concept of humoral pathology dominated western medicine until the sixteenth century and influenced all fields of medicine until after the seventeenth century. After referring to some biographical data the philosophical and epistemic fundamentals of Galen's"medical system" are outlined and brought into relation with the prevailing medical sects of the second century AD. The very treatises of his enormous work which are the most relevant with reference to the issue are briefly characterized.In the second part of the paper to be published in one of the next issues of this journal, Galen's significant contributions to the speciality we today define as urology are presented and analyzed. In addition pertinent case reports based on the Greek original texts will illustrate and substantiate his theoretical and clinical approach to the urology patient. Finally the significance of Galen's thinking for the present day physician will be evaluated.

  20. Three-Dimensional Modeling of DNAPL in the Subsurface of the 216-Z-9 Trench at the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Oostrom, Mart; Rockhold, Mark L.; Thorne, Paul D.; Last, George V.; Truex, Michael J.

    2004-11-02

    This work describes numerical modeling for simulating carbon tetrachloride flow and transport as outlined in two DOE reports for the 200-PW-1 Operable Unit and the 200-PW-1, 200-PW-3, and 200-PW-6 Operable Units. Simulations using the multifluid flow model STOMP were conducted to estimate how disposed dense nonaqueous phase liquid migrates in the vadose zone.

  1. P2-16: Dual-Bound Model and the Role of Time Bound in Perceptual Decision Making

    Directory of Open Access Journals (Sweden)

    Daeseob Lim

    2012-10-01

    Full Text Available The diffusion model (DM encapsulates the dynamics of perceptual decision within a ‘diffusion field’ that is defined by a basis with sensory-evidence (SE and time vectors. At the core of the DM, it assumes that a decision is not made until an evidence particle drifts in the diffusion field and eventually hits one of the two pre-fixed bounds defined in the SE axis. This assumption dictates when and which choice is made by referring to when and which bound will be hit by the evidence particle. What if urgency pressures the decision system to make a choice even when the evidence particle has yet hit the SE bound? Previous modeling attempts at coping with time pressure, despite differences in detail, all manipulated the coordinate of SE bounds. Here, we offer a novel solution by adopting another bound on the time axis. This ‘dual-bound’ model (DBM posits that decisions can also be made when the evidence particle hits a time bound, which is determined on a trial-by-trial basis by a ‘perceived time interval’ – how long the system can stay in the ‘diffusion’ field. The classic single-bound model (SBM exhibited systematic errors in predicting both the reaction time distributions and the time-varying bias in choice. Those errors were not corrected by previously proposed variants of the SBM until the time bound was introduced. The validity of the DBM was further supported by the strong across-individual correlation between observed precision of interval timing and the predicted trial-by-trial variability of the time bound.

  2. Session 21.6: Preserving Dark Skies and Protecting Against Light Pollution in a World Heritage Framework

    Science.gov (United States)

    Smith, Malcolm G.

    2016-10-01

    This session opened with a crucial explanation by Michel Cotte of how astronomers first need to understand how to apply UNESCO World Heritage Criteria if they want to motivate their government(s) to make the case to UNESCO for World Heritage recognition. UNESCO World Heritage cannot be obtained just to protect dark skies. Much more detail of this and the other presentations in this session, along with many images, can be found at the session website: http://www.noao.edu/education/IAUGA2015FM21. The next speaker, John Hearnshaw, described the Aoraki Mackenzie International Dark Sky Reserve and the work it carries out . This was followed by a wide-ranging summary (by Dan Duriscoe and Nate Ament) of the U.S. National Park Service (NPS) Night Skies Program. The abstract of Cipriano's Marin's paper, ``Developing Starlight connections with UNESCO sites through the Biosphere Smart" was shown in his absence. The final presentation (by Arkadiusz Berlicki, S. Kolomanksi and T. Mrozek) discussed the bi-national Izera Dark Sky Park.

  3. 8 CFR 216.5 - Waiver of requirement to file joint petition to remove conditions by alien spouse.

    Science.gov (United States)

    2010-01-01

    ... conditional resident but during the marriage the alien spouse or child was battered by or subjected to extreme... alien obtained permanent residence; (iii) Birth certificates of children born to the marriage; and (iv... qualifying marriage in good faith, and who was battered or was the subject of extreme cruelty or whose child...

  4. 12 CFR 216.14 - Exceptions to notice and opt out requirements for processing and servicing transactions.

    Science.gov (United States)

    2010-01-01

    ...) Servicing or processing a financial product or service that a consumer requests or authorizes; (2... maintain the consumer's account in the ordinary course of providing the financial service or financial... transaction, or information on the status or value of the financial service or financial product to the...

  5. 77 FR 29683 - Outer Continental Shelf (OCS) Consolidated Central Gulf of Mexico Planning Area Sale; 216/222

    Science.gov (United States)

    2012-05-18

    ... joint bidder in such a bid, must submit at the time of bid submission a Geophysical Data and Information... geophysical data and information generated or used as part of the decision to bid or participate in a bid on... in a bid, but for which it did not use enhanced or reprocessed pre- or post-stack geophysical data...

  6. 8 CFR 216.4 - Joint petition to remove conditional basis of lawful permanent resident status for alien spouse.

    Science.gov (United States)

    2010-01-01

    ... of the marriage through annulment, divorce, or the death of the petitioning spouse, or if the... satisfaction of the director, in writing, that there was good cause for the failure to file Form I-751 within... rescheduled or that the interview be waived, and the director determines that there is good cause for granting...

  7. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  8. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  9. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  10. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  11. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  12. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  13. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  14. Early detection of response to experimental chemotherapeutic Top216 with [18F]FLT and [18F]FDG PET in human ovary cancer xenografts in mice

    DEFF Research Database (Denmark)

    Jensen, Mette Munk; Erichsen, Kamille Dumong; Björkling, Fredrik

    2010-01-01

    3'-Deoxy-3'-[(18)F]fluorothymidine ((18)F-FLT) is a tracer used to assess cell proliferation in vivo. The aim of the study was to use (18)F-FLT positron emission tomography (PET) to study treatment responses to a new anti-cancer compound. To do so, we studied early anti-proliferative effects...

  15. Optical Materials, Adhesive and Encapsulant, III-V, and Optical Characterization Evaluation: Cooperative Research and Development Final Report, CRADA Number CRD-07-216

    Energy Technology Data Exchange (ETDEWEB)

    Kempe, M.

    2012-11-01

    SolFocus is currently developing solar technology for utility scale application using Winston collector based concentrating photovoltaics (CPV). Part of that technology development includes small mirror dishes and front surface reflectors, and bonding the separate parts to the assembly. Mirror panels must meet rigid optical specifications in terms of radius of curvature, slope errors and specularity. The reflective surfaces must demonstrate long term durability and maintain high reflectivity. Some bonded surfaces must maintain adhesion and transparency under high concentrations and high temperatures. Others will experience moderate temperatures and do not require transparency. NREL researchers have developed methods and tools that address these related areas.

  16. Diana Elvira Soto Arango. La escuela rural en Colombia. Historias de vida de maestras. Mediados del siglo xx. Tunja: fudesa, 2014. 216 páginas.

    Directory of Open Access Journals (Sweden)

    Doris Lilia Torres

    2015-01-01

    Full Text Available Me honra presentar este libro por dos razones: la primera es personal. Porque he tenido el asunto de la identidad del mestizo como una de mis preocupaciones, a través de la cual he tratado de encontrar las voces que hablan sobre lo que somos y cómo somos. Aunque Gabriel García Márquez universalizó nuestra cultura latinoamericana, no me deja de sorprender que cuando los escritores y periodistas de la Costa Atlántica se refieren a su vida y obra, lo hacen de una manera tan personal y cercana, que se siente cómo experimentan ese realismo mágico correr por su venas. De igual manera, leer el libro La Escuela rural en Colombia. Historias de vida de maestra. Mediados del siglo xx, de la Dra. Diana Elvira Soto, hizo que las emociones surgieran y brotaran con las imágenes, símbolos, descripciones y narraciones de las educadoras que vivieron en este altiplano cundiboyacense. Pude sentir el olor de la vereda, el sonido de la quebrada, la soledad de la escuela, lo mitos de la llorona y la patasola escondidos en los rincones de los salones de clase para apaciguar los ánimos, el frío del páramo del Vijagual en Rondón y la frescura del valle de los Ocobos en Miraflores. También sentí la zozobra y el miedo por la violencia y el desplazamiento de Yacopí a Bogotá. Allí la maestra, la mujer, la líder y madre va caminando por las veredas y municipios de una tierra abandonada y asediada por la corrupción política centralista, buscando un ideal y construyendo comunidades que avanzan con la elaboración mental que da el aprendizaje de la lectura y escritura, en manos de maestras como Amparo y Andrea, que creyeron en la construcción de comunidades más justas y menos discriminadas a través de la enseñanza de las letras y el lenguaje.

  17. Optoacoustic Spectroscopy of C2H4 at the 9 micrometers and 10 micrometers C12O2(16) Laser Wavelengths.

    Science.gov (United States)

    1981-03-01

    Activity National Scinece Foundation ATTN: DRXSY-MP 1800 G Street, N.W. APG, MD 21005 Washington, DC 20550 Commander Commanding Officer ERADCOM Naval...Technical Library AFGL/LY Chemical Systems Laboratory Hanscom AFB, MA 01731 Aberdeen PYr’ving Ground, MD 21010 4 The Environmental Research Commander...R&D Command Environmental Protection Agency ATTN: DELCS-S Meteorology Laboratory, MD 80 Fort Monmouth, NJ 07703 Rsch Triangle Park, NC 27711 US Army

  18. 5 CFR 792.216 - Are Federal employees with children who are enrolled in summer programs and part-time programs...

    Science.gov (United States)

    2010-01-01

    ... are enrolled in summer programs and part-time programs eligible for the child care subsidy program... summer programs and part-time programs eligible for the child care subsidy program? Federal employees... enrolled in daytime summer programs and part-time programs such as before and after school programs are...

  19. Using SPSS syntax: a beginner's guide Jacqueline Collier Using SPSS syntax: a beginner's guide Sage Pages: 216 £24.99 9781412922180 1412922186 [Formula: see text].

    Science.gov (United States)

    2011-01-21

    As someone who is comfortable with analysing data in SAS using coding language, it is perplexing that I run from the use of syntax in SPSS. But, my apprehension has subsided with the Collier's guide. Syntax command can automate processes, increase reproducibility and give the user broader access to features otherwise unavailable in SPSS.

  20. Installation Restoration Program. Preliminary Assessment: 216th Engineering Installation Squadron and 234th Combat Communications Squadron, Hayward Air National Guard Station, California Air National Guard, Hayward, California

    Science.gov (United States)

    1991-01-01

    foot to O𔃿 oill’y clsay r Ich, in orgsenc mstrsly wilth sait aste r. Yiel d: a I Ilsy _.j s .ssh as 120 -st.,Wt. hon- lense , of s it ane quantity im...Report 205J. Figure 111.3 U Generalized Stratigraphic Column of the Area I 111-5 ’UD Of CONTCT -00fA~m~eIYloctedCORRELATION OF MAP UNITS HAYWARD FAULT...separators. Two of these are connected to the storm sewer. The oil/water separator for the 234th EIS is connected to the sanitary sewer. o A monitoring well

  1. A regional registry study of 216 patients investigating if patient satisfaction after total knee arthroplasty changes over a time period of five to 20years.

    Science.gov (United States)

    Shannak, Odei; Palan, Jeya; Esler, Colin

    2017-08-01

    To determine the temporal changes in patient dissatisfaction following primary knee arthroplasty surgery (TKA). Three hundred and ninety patients that had previously indicated they were either dissatisfied or unsure with their TKA at one-year post-surgery in our region were mailed a simple questionnaire in addition to the Oxford Knee Score and EQ-5D. A 55% response rate was achieved. The mean follow-up time period was 9.1years. Of the 120 patients who were initially dissatisfied, 46.7% remained so. Of the 96 patients who were initially unsure, 20.8% remained so, 21.9% and 57.3% became dissatisfied and satisfied, respectively. The primary reason for continued dissatisfaction was persistent pain. Of the 19.4% of patients who had revision surgery, 47.6% remained dissatisfied. 54.2% of patients stated that they would be happy to have a primary TKA again and 55.6% indicated that they would recommend one to a friend. Patients who had concurrent hip pain were six times more likely to remain unsure or dissatisfied over time (OR 6.7, p-value 0.0000). Patients who had back pain or contralateral knee pain were two or three times as likely to remain unsure or dissatisfied. In time half of the patients who stated that they were not satisfied with their arthroplasty, at one year, go on to be satisfied with their knee. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. The Mycoplasma hominis P120 membrane protein contains a 216 amino acid hypervariable domain that is recognized by the human humoral immune response

    DEFF Research Database (Denmark)

    Nyvold, Charlotte Guldborg; Birkelund, Svend; Christiansen, Gunna

    1997-01-01

    domain. Based on restriction endonuclease cleavage patterns of the hypervariable domain the 18 isolates could be divided into four cases. Reactivity with both mAb 26.7D and pAb 121 confirmed these classes. The hypervariable, but not the constant, part of P120 was recognized by the human humoral immune...

  3. Airborne in situ vertical profiling of HDO / H216O in the subtropical troposphere during the MUSICA remote sensing validation campaign

    Science.gov (United States)

    Dyroff, C.; Sanati, S.; Christner, E.; Zahn, A.; Balzer, M.; Bouquet, H.; McManus, J. B.; Gonzalez-Ramos, Y.; Schneider, M.

    2015-05-01

    Vertical profiles of water vapor (H2O) and its isotope ratio D / H expressed as δD(H2O) were measured in situ by the ISOWAT II diode-laser spectrometer during the MUlti-platform remote Sensing of Isotopologues for investigating the Cycle of Atmospheric water (MUSICA) airborne campaign. We present recent modifications of the instrument design. The instrument calibration on the ground as well as in flight is described. Based on the calibration measurements, the humidity-dependent uncertainty of our airborne data is determined. For the majority of the airborne data we achieved an accuracy (uncertainty of the mean) of Δ(δD) ≈10‰. Vertical profiles between 150 and ~7000 m were obtained during 7 days in July and August 2013 over the subtropical North Atlantic Ocean near Tenerife. The flights were coordinated with ground-based (Network for the Detection of Atmospheric Composition Change, NDACC) and space-based (Infrared Atmospheric Sounding Interferometer, IASI) FTIR remote sensing measurements of δD(H2O) as a means to validate the remote sensing humidity and δD(H2O) data products. The results of the validation are presented in detail in a separate paper (Schneider et al., 2014). The profiles were obtained with a high vertical resolution of around 3 m. By analyzing humidity and δD(H2O) correlations we were able to identify different layers of air masses with specific isotopic signatures. The results are discussed.

  4. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  5. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  6. (Cy2NH2O2CPh3(SnCl42 AND (SnBu24(O2CPh16Cl6(OH2(Cy2NH216: SYNTHESIS AND SPECTROSCOPIC CHARACTERIZATION

    Directory of Open Access Journals (Sweden)

    Dinora De Barros

    2011-09-01

    Full Text Available The two title compounds have been synthesized, their IR and Mössbauer studies carried out. The structures are discrete and contain mono- and bidentate PhCO2-, the environment around the tin (IV centre being octahedral (in SnCl4 adduct, trapezoidal bipyramidal (in the SnBu2 residue containing derivative. A tetranuclear monomeric or an oligomeric structure is suggested in the tetranuclear SnBu2 residue containing derivative.

  7. Kõnetehnoloogiat edendades : [rets. : Meister, Einar. Promoting Estonian speech technology : from resources to prototypes. Dissertationes linguisticae Universitatis Tartuensis 4. Tartu : Tartu Ülikooli Kirjastus, 2003. 216 lk.] / Meelis Mihkla

    Index Scriptorium Estoniae

    Mihkla, Meelis

    2004-01-01

    Retsenseeritava raamatu põhjal kaitses Tallinna Tehnikaülikooli Küberneetika Instituudi foneetika ja kõnetehnoloogia labori juhataja Einar Meister 26. juunil 2003 Tartu Ülikoolis doktoriväitekirja

  8. Modeling of Carbon Tetrachloride Flow and Transport in the Subsurface of the 200 West Disposal Sites: Large-Scale Model Configuration and Prediction of Future Carbon Tetrachloride Distribution Beneath the 216-Z-9 Disposal Site

    Energy Technology Data Exchange (ETDEWEB)

    Oostrom, Mart; Thorne, Paul D.; Zhang, Z. F.; Last, George V.; Truex, Michael J.

    2008-12-17

    Three-dimensional simulations considered migration of dense, nonaqueous phase liquid (DNAPL) consisting of CT and co disposed organics in the subsurface as a function of the properties and distribution of subsurface sediments and of the properties and disposal history of the waste. Simulations of CT migration were conducted using the Water-Oil-Air mode of Subsurface Transport Over Multiple Phases (STOMP) simulator. A large-scale model was configured to model CT and waste water discharge from the major CT and waste-water disposal sites.

  9. Plutarhove ženske. Ur. Maja Sunčič. Ljubljana: Institutum Studiorum Humanitatis – Fakulteta za podiplomski humanistični študij, 2004. (Zbirka Dialog z antiko 216 strani. (recenzija

    Directory of Open Access Journals (Sweden)

    Nada Grošelj

    2006-12-01

    Full Text Available Po zaslugi prevajalskih in analitičnih prizadevanj Maje Sunčič je v slovenskem prostoru končno postal deležen nekoliko večje pozornosti orjaški segment Plutarhovega opusa, ki je bil doslej skoraj povsem zanemarjen. To je zbirka 78 poljudnih in strokovnih razprav z raznovrstno tematiko od filozofije do naravoslovja, ohranjenih pod skupnim latinskim naslovom Moralia oz. grško Ethika, Etični spisi (med njimi je tudi nekaj nepristnih.

  10. AcEST: DK951040 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ) Frame = +1 Query: 1 EKELRGKALMKRVMQTWLPASDALLEMMVFHLPSPAKAQRYRVENLYEGPLDDQYANAIR 180 EK+L G+ LMKRVMQTWLPAS... ALLEMM+ HLPSPA AQRYRVENLYEGP+DD YA AIR Sbjct: 309 EKDLMGRPLMKRVMQTWLPASSALLEMMIHHLPSPATAQRYRVENLYEGPMDDVYAT...216 (76%), Positives = 186/216 (86%) Frame = +1 Query: 1 EKELRGKALMKRVMQTWLPASDAL...LEMMVFHLPSPAKAQRYRVENLYEGPLDDQYANAIR 180 ++EL GK LMKRVMQTWLPA +ALLEMM++HLPSPAKAQ+YRV+ LYEGPLDD YA A+R Sbjct: 311 DRELMGKPLMKRVM...ties = 128/216 (59%), Positives = 158/216 (73%) Frame = +1 Query: 1 EKELRGKALMKRVMQTWLPASDALLEMMVFHLPSPAKAQR

  11. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  12. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  13. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  14. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  15. 76 FR 71922 - Defense Federal Acquisition Regulation Supplement: Separation of Combined Provisions and Clauses...

    Science.gov (United States)

    2011-11-21

    ... Military Recruiting on Campus, in all solicitations and contracts with institutions of higher education... Military Campus. Recruiting on Campus-- Representation. 252.216-7000, Economic Price 252.216-70XX, Economic..., Reserve Officer Training Corps and Military Recruiting on Campus--Representation. (iv) 252.216-70YY...

  16. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  17. Dicty_cDB: SSH838 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 630 e-177 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 8e-55 2 X85119 |X85119.1 Artificial sequences cloning... vector DNA pDXA-3H. 216 8e-55 2 X85122 |X85122.1 Artificial sequences cloning...X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 8e-55 2 X85123 |X85123.1 Artificial sequences cloning...FLAG, complete sequence. 216 8e-55 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 9

  18. Hot wire production of single-wall and multi-wall carbon nanotubes

    Science.gov (United States)

    Dillon, Anne C.; Mahan, Archie H.; Alleman, Jeffrey L.

    2010-10-26

    Apparatus (210) for producing a multi-wall carbon nanotube (213) may comprise a process chamber (216), a furnace (217) operatively associated with the process chamber (216), and at least one filament (218) positioned within the process chamber (216). At least one power supply (220) operatively associated with the at least one filament (218) heats the at least one filament (218) to a process temperature. A gaseous carbon precursor material (214) operatively associated with the process chamber (216) provides carbon for forming the multi-wall carbon nanotube (213). A metal catalyst material (224) operatively associated with the process (216) catalyzes the formation of the multi-wall carbon nanotube (213).

  19. Dicty_cDB: SSE603 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ector pDXA-3strep. 216 9e-54 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 9e-54 2... X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 9e-54 2 AJ510165 |AJ510165.1 Cloning ...vector pDXA-3FLAG. 216 9e-54 2 X85118 |X85118.1 Artificial sequences cloning vect...or DNA pDXA-3C. 216 9e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 9e-54 2 AF...269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 9e-54 2 X85120 |X85120.1 Artificial sequences cloning

  20. Dicty_cDB: SSH692 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pDXA-3strep. 216 7e-55 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 7e-55 2 X8512...2 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 7e-55 2 AJ510165... |AJ510165.1 Cloning vector pDXA-3FLAG. 216 7e-55 2 X85118 |X85118.1 Artificial sequences cloning vector DNA... pDXA-3C. 216 7e-55 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 7e-55 2 AF269236...120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 8e-55 2 AJ510166 |AJ510166.1 Cloning vector pDXA-

  1. Dicty_cDB: SSE437 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 64 |AJ510164.1 Cloning vector pDXA-3strep. 216 6e-54 2 X85119 |X85119.1 Artificial sequences cloning vector ...DNA pDXA-3H. 216 6e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 6e-54 2 AJ510...165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 6e-54 2 X85118 |X85118.1 Artificial... sequences cloning vector DNA pDXA-3C. 216 6e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA... pDXA-HC. 216 6e-54 2 AF269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 6e-54 2 X85120 |X85120.1 Artificial

  2. Dicty_cDB: SSH804 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available loning vector pDXA-3strep. 216 4e-54 2 X85119 |X85119.1 Artificial sequences clon...ing vector DNA pDXA-3H. 216 4e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 4e...-54 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 4e-54 2 X85118 |X85118.1 Artificial sequences clon...ing vector DNA pDXA-3C. 216 4e-54 2 X85123 |X85123.1 Artificial sequences cloning... vector DNA pDXA-HC. 216 4e-54 2 AF269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 4e-54 2 X85120 |X85120.1 Artif

  3. Dicty_cDB: SSE172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available trep. 216 3e-54 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3...H. 216 3e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 3e-54 2 AJ510165 |AJ510...165.1 Cloning vector pDXA-3FLAG. 216 3e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3...C. 216 3e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. ...216 3e-54 2 AF269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 3e-54 2 X85120 |X85120.1 Artificial

  4. Quality-controlled sea surface temperature, salinity and other measurements from thermosalinographs (TSG) from the CORNIDE DE SAAVEDRA, METEOR and 216 other platforms in the Atlantic, Pacific, Indian Oceans and other locations from 1989-7-20 to 2016-7-31 (NCEI Accession 0156189)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To facilitate understanding of, and access to, the information available for in situ sea surface measurements, NOAA NCEI has constructed a Global Thermosalinographs...

  5. Erratum to: Magnetic field-induced modification of selection rules for Rb D2 line monitored by selective reflection from a vapor nanocell. Eur. Phys. J. D 71: 216 (2017), DOI: 10.1140/epjd/e2017-80291-6

    Science.gov (United States)

    Klinger, Emmanuel; Sargsyan, Armen; Tonoyan, Ara; Hakhumyan, Grant; Papoyan, Aram; Leroy, Claude; Sarkisyan, David

    2018-01-01

    The two technical points below are corrected by this erratum: 1. The publisher apologizes for a technical problem occurring in the scale numbering of Figure 2. The figure is corrected below. [Figure not available: see fulltext.] 2. Page 6, line 14 of the Conclusion section " F g = 2, m F = -3 → F e = 4, m F = -2" should be replaced by " F g = 2, m F = -2 → F e = 4, m F = -1".

  6. Dicty_cDB: SSL190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 Cloning vector pDXA-3strep. 216 3e-67 3 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H.... 216 3e-67 3 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 2...16 3e-67 3 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 3e-67 3 X85118 |X85118.1 Artificial sequences cloning... vector DNA pDXA-3C. 216 3e-67 3 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 2...3e-67 3 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 3e-67 3 AJ510166 |AJ510166.1 C

  7. Dicty_cDB: SSL359 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ficial sequences cloning vector DNA pDXA-3H. 216 2e-54 2 X85122 |X85122.1 Artificial...ficial sequences cloning vector DNA pDXA-3C. 216 2e-54 2 X85123 |X85123.1 Artific...vector pDXA-FLAG, complete sequence. 216 2e-54 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pD...scoideum mRNA for cysteine proteinase 1. 436 0.0 3 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 2e-54 2 X85119 |X85119.1 Arti... sequences cloning vector DNA pDXA-HY. 216 2e-54 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 2e-54 2 X85118 |X85118.1 Arti

  8. Dicty_cDB: SSM804 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ficial sequences cloning vector DNA pDXA-3H. 216 3e-54 2 X85122 |X85122.1 Artific...vector pDXA-3FLAG. 216 3e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 3e-54 2 X85123 |X85123.1 Artific...269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 3e-54 2 X85120 |X85120.1 Artificial sequ...coideum mRNA for cysteine proteinase 1. 1233 0.0 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 3e-54 2 X85119 |X85119.1 Arti...ial sequences cloning vector DNA pDXA-HY. 216 3e-54 2 AJ510165 |AJ510165.1 Cloning

  9. Dicty_cDB: SSK793 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available teinase 1. 1084 0.0 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 3e-54 2 X85119 |X85119.1 Artificial... sequences cloning vector DNA pDXA-3H. 216 3e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DN...cial sequences cloning vector DNA pDXA-3C. 216 3e-54 2 X85123 |X85123.1 Artificial ...quence. 216 3e-54 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD...A pDXA-HY. 216 3e-54 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 3e-54 2 X85118 |X85118.1 Artifi

  10. Synthetic Environments for HSI Application, Assessment, and Improvement (Environnements synthetiques pour l’application, l’evaluation et l’amelioration de l’integration homme-systeme)

    Science.gov (United States)

    2015-06-01

    REPORT TR-HFM-216 Synthetic Environments for HSI Application, Assessment, and Improvement ( Environnements synthétiques pour l’application, l’évaluation...216 Synthetic Environments for HSI Application, Assessment, and Improvement ( Environnements synthétiques pour l’application, l’évaluation et...crossed to realize SEA in its fullest form. STO-TR-HFM-216 ES - 1 Environnements synthétiques pour l’application, l’évaluation et

  11. 48 CFR 5119.1005 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... SMALL BUSINESS AND SMALL DISADVANTAGED BUSINESS CONCERNS Small Business Competitiveness Demonstration... Z216. This includes both maintenance dredging and new start (new work) construction dredging. Dredging...

  12. Dicty_cDB: SSH510 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 1e-54 2 X85122 |X85122.1 Artificial sequences cloning...118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 1e-54 2 X85123... |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 1e-54 2 AF269236 |AF269236.1 Cloning vector ...pDXA-FLAG, complete sequence. 216 1e-54 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H.

  13. ORF Alignment: NC_002516 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GDSFDLFIGETPVNLSGSPAAAMTINGSLPGPTLRWREGDNVTLRVRNRLAEDT 66 ... Query: 157 VIDAREPEPFS...YDRDYVVLLSDWSDEKPQRILAKLKKQSDYYNFHKRTVGDFIDDVSANG 216 ... VIDAREPEPFSYDRDYVVLLSDWSDEKPQRILAKLKKQSDYYN...FHKRTVGDFIDDVSANG Sbjct: 127 VIDAREPEPFSYDRDYVVLLSDWSDEKPQRILAKLKKQSDYYNFHKRTVGDFIDDVSANG 186 ... Query: 277 AM

  14. Plume Delineation in the BC Cribs and Trenches Area

    Energy Technology Data Exchange (ETDEWEB)

    Rucker, Dale F.; Sweeney, Mark D.

    2004-11-30

    HydroGEOPHYSICS, Inc. and Pacific Northwest National Laboratory (PNNL) were contracted by Fluor Hanford Group, Inc. to conduct a geophysical investigation in the area of the BC Cribs and Trenches (subject site) at the Hanford Site in Richland, Washington. The BC Cribs and Trenches are located south of the 200 East Area. This document provides the details of the investigation to identify existing infrastructure from legacy disposal activities and to delineate the edges of a groundwater plume that contains radiological and heavy metal constituents beneath the 216-B-26 and 216-B-52 Trenches, and the 216-B-14 through 216-B-19 Cribs.

  15. Factors Associated With Progression Of Diabetic Retinopathy, A ...

    African Journals Online (AJOL)

    Basically univariate analyses were followed by multiple logistic regression analysis. Results: Out of 704 diabetic patients participated in the study 216 were diagnosed as having DR with an overall 30.7% prevalence rate. Among 216 patients with DR, 33 were diagnosed as PDR (4.7%) and 183 were diagnosed as NPDR ...

  16. EST Table: FS913032 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS913032 E_FL_fufe_28A02_F_0 10/09/28 44 %/216 aa ref|XP_975194.1| PREDICTED: similar to something...A 10/09/10 44 %/216 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 fufe ...

  17. Drug: D01421 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available purate sodium; Paraaminohippurate (TN) C9H9N2O3. Na 216.0511 216.1691 D01421.gif Diagnostic aid [renal funct...ly for therapeutic purpose 72 Intracorporeal diagnostic agents 722 Various function testing reagents 7225 Diagnostic

  18. U. S. Naval Forces, Vietnam Monthly Historical Summary for May 1971

    Science.gov (United States)

    1971-07-05

    disposition of RAG units at the end of May. RAG OPCON Lo cat rio n 22 CTG 216. 1 Phu Cuong 24 CTG 216. 1 Phu Cuong 26 Commpnder. Long Xuyen Fourth Riverine Area...tour as the hospital ship for the .’irst Coastal Zone, leavi- DaNarng fct. decoin -* missioning in Alameda , California. The hospital ship had treated

  19. 76 FR 5328 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-01-31

    ... (NP 216) focuses on understanding farms function and how changing or introducing new technology will... Competitiveness and Sustainability National Program (NP-216) of the ARS to customers and producers and document..., Departmental Information Collection Clearance Officer. BILLING CODE 3410-03-P ...

  20. Effects of Level of Glycaemic Control in Reduction of Maternal and ...

    African Journals Online (AJOL)

    Preeclampsia developed in 35 (21.6%) women. Cesarean section was done for 107 (66.0%) women and 55 (44.05%) had vaginal delivery. Still birth accounted for 26 (16.0%) of births and macrosomia occurred in 35 (21.6%) of births. Average FBG was significantly associated with preeclampsia [AOR (95% CI) = 3.36 (1.18, ...

  1. Fibroepithelial polyps of the urethra in infants: A report of three cases

    African Journals Online (AJOL)

    A. Ksia

    a Department of Pediatric Surgery, Hospital Fattouma Bourguiba, Monastir, Tunisia b Department of Radiology, Hospital Fattouma ... touma Bourguiba, 5000 Monastir, Tunisia. Tel.: +216 97523763; fax: +216 73460678. .... by the Tunisian Ministry of Scientific. Research (scientific laboratory LR 12 SP 13). References.

  2. Chronic idiopathic constipation

    African Journals Online (AJOL)

    2009-05-12

    May 12, 2009 ... proving that our ideas about constipation are largely based on myths and misconceptions. For example ... the autointoxication theory. No toxin associated with constipation has ever been identified in the blood. ... largely based on myths and misconceptions. CME May 2009 Vol.27 No.5 pg.216-218.indd 216.

  3. EST Table: AV400537 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400537 br--1414 10/09/28 41 %/216 aa ref|XP_002000083.1| GI10045 [Drosophila mojav...ensis] gb|EDW15544.1| GI10045 [Drosophila mojavensis] 10/08/28 41 %/216 aa FBpp0159262|DmojGI10045-PA 10/08

  4. Review for the Korean Health Professionals and International Cooperation Doctors Dispatched to Peru by the Korea International Cooperation Agency (KOICA).

    Science.gov (United States)

    Kim, Bongyoung

    2015-04-01

    South Korea dispatches Korean nationals to partner developing countries as an Official Development Assistance (ODA) project through the Korea International Cooperation Agency (KOICA). In the health sector, KOICA dispatches international cooperation doctors (ICDs), nurses, physical therapists, radiologic technologists, nutritionists, medical laboratory technologists, occupational therapists, and dental hygienists. A total of 216 ICDs were dispatched over 19 times from 1995 until 2013. There were 19 areas of specialties among the ICDs. The most common specialty was internal medicine (61/216, 28.2%), the second most common specialty was general surgery (43/216, 19.9%), followed by oriental medicine (27/216, 12.5%), pediatrics (17/216, 7.9%), orthopedics (16/216, 7.4%), family medicine (16/216, 7.4%), and odontology (14/216, 6.5%). The ICDs have worked in 21 countries. KOICA dispatched the highest number of ICDs to Asia (97/216, 44.9%), followed by Africa (50/216, 23.1%), Latin America (34/216, 15.7%), the commonwealth of independent states (31/216, 14.4%), and Oceania (4/216, 1.9%). Nobody was dispatched to the Middle East. A total of 134 KOICA health professionals were dispatched to Peru from 1996 until October 1, 2014. Of these, 19.4% (26/134) were ICDs, 44.8% (60/216) were nurses, 20.1% (27/134) were physical therapists, 6.7% (9/134) were radiologic technologists, 2.2% (3/134) were nutritionists, and 6.7% (9/134) were medical laboratory. ICDs' specialties comprised internal medicine (13/26, 50%), family medicine (8/26, 30.8%), pediatrics (2/26, 7.7%), otorhinolaryngology (1/26, 3.8%), orthopedics (1/26, 3.8%), and oriental medicine (1/26, 3.8%). Most of the dispatched health professionals worked at institutions that were supported by KOICA. For this reason, the proportion of health professionals who worked at public health centers (PHCs) was the highest (58.2%, 78/134) when classified by workplace type. Other KOICA health professionals worked at hospitals

  5. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  6. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  7. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  8. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  9. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  10. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  11. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  12. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  13. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  14. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  15. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  16. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  17. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  18. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  19. Resource Conservation and Recovery Act ground-water monitoring projects for Hanford facilities: Progress Report for the Period April 1 to June 30, 1989

    Energy Technology Data Exchange (ETDEWEB)

    Smith, R.M.; Bates, D.J.; Lundgren, R.E.

    1989-09-01

    This report describes the progress of 13 Hanford ground-water monitoring projects for the period April 1 to June 30, 1989. These projects are for the 300 area process trenches (300 area), 183-H solar evaporation basins (100-H area), 200 areas low-level burial grounds, nonradioactive dangerous waste landfill (southeast of the 200 areas), 1301-N liquid waste disposal facility (100-N area), 1324-N surface impoundment and 1324-NA percolation pond (100-N area), 1325-N liquid waste disposal facility (100-N area), 216-A-10 crib (200-east area), 216-A-29 ditch (200-east area), 216-A-36B crib (200-east area), 216-B-36B crib (200-east area), 216-B-3 pond (east of the 200-east area), 2101-M pond (200-east area), grout treatment facility (200-east area).

  20. Dicty_cDB: SSD429 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 622 e-175 1 AJ510162 |AJ510162.1 Cloning vector pDXA-YFP-NotI. 216 1e-52 1 X85120 |X85120.1 Artificial sequences cloning...pDXA-GFP2, complete sequence. 216 1e-52 1 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. ...XA-CFP. 216 1e-52 1 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA...-HC. 216 1e-52 1 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 1e-52 1 AJ510166 |AJ5

  1. Dicty_cDB: SSJ694 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available steine proteinase 1. 1217 0.0 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 8e-54 2 X85119 |X85119.1 Artificial... sequences cloning vector DNA pDXA-3H. 216 8e-54 2 X85122 |X85122.1 Artificial...216 8e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 8e-54 2 X85123 |X85123.1 Artificial...Cloning vector pDXA-FLAG, complete sequence. 216 8e-54 2 X85120 |X85120.1 Artificial sequences cloning vecto

  2. A Novel Avian Paramyxovirus (Putative Serotype 15 Isolated from Wild Birds

    Directory of Open Access Journals (Sweden)

    Hyun-Jeong Lee

    2017-05-01

    Full Text Available In January 2014, a viral hemagglutinating agent named UPO216 was isolated from fecal droppings of wild birds at the UPO wetland in South Korea during an avian influenza surveillance program. Electron microscopy identified the UPO216 virus as an avian paramyxovirus (APMV. Pathogenicity tests and molecular pathotyping revealed that the virus was avirulent in chickens. The UPO216 virus was assigned to a serological group antigenically distinct from known serotypes of APMV (−1, −2, −3, −4, −6, −7, −8, and −9 by hemagglutination inhibition test, despite showing weak cross-reactivity with APMV-1 and APMV-9. The UPO216 virus RNA genome is 15,180 nucleotides (nts in length, encodes 3′-N-P(V/W-M-F-HN-L-5′ in that order, and shows unique genetic characteristics in terms of genomic composition and evolutionary divergence (0.43 or greater from known serotypes of APMV. Phylogenetic analysis revealed that the UPO216 occupies a branch separate from APMV-1, -9, -12, and -13. Serologic surveillance of wild birds (n = 880; 15 species, five Orders detected UPO216-reactive antibodies in 4% (20/494 of serum samples taken from five species of wild duck belonging to the Order Anseriformes. In particular, UPO216-specific antibodies showing no cross-reaction with other serotypes of APMV were detected in four species: Eurasian teal (1/36, European wigeon (1/73, mallard (4/139, and Spot-Billed duck (1/137. These results indicate that the UPO216 virus has antigenically and genetically unique characteristics distinct from known serotypes of APMV and likely has been circulating widely in wild duck species of the Order Anseriformes. Thus, we propose the UPO216 isolate as a prototype strain of a novel APMV serotype (putative APMV-15.

  3. Inhibition of Plasminogen Activator Inhibitor-1 Attenuates Transforming Growth Factor-β-Dependent Epithelial Mesenchymal Transition and Differentiation of Fibroblasts to Myofibroblasts.

    Directory of Open Access Journals (Sweden)

    Keitaro Omori

    Full Text Available Transforming growth factor-β (TGF-β is central during the pathogenesis of pulmonary fibrosis, in which the plasminogen activator inhibitor-1 (PAI-1 also has an established role. TGF-β is also known to be the strongest inducer of PAI-1. To investigate the link between PAI-1 and TGF-β in fibrotic processes, we evaluated the effect of SK-216, a PAI-1-specific inhibitor, in TGF-β-dependent epithelial-mesenchymal transition (EMT and fibroblast to myofibroblast differentiation. In human alveolar epithelial A549 cells, treatment with TGF-β induced EMT, whereas co-treatment with SK-216 attenuated the occurrence of EMT. The inhibition of TGF-β-induced EMT by SK-216 was also confirmed in the experiment using murine epithelial LA-4 cells. Blocking EMT by SK-216 inhibited TGF-β-induced endogenous production of PAI-1 and TGF-β in A549 cells as well. These effects of SK-216 were not likely mediated by suppressing either Smad or ERK pathways. Using human lung fibroblast MRC-5 cells, we demonstrated that SK-216 inhibited TGF-β-dependent differentiation of fibroblasts to myofibroblasts. We also observed this inhibition by SK-216 in human primary lung fibroblasts. Following these in vitro results, we tested oral administration of SK-216 into mice injected intratracheally with bleomycin. We found that SK-216 reduced the degree of bleomycin-induced pulmonary fibrosis in mice. Although the precise mechanisms underlying the link between TGF-β and PAI-1 regarding fibrotic process were not determined, PAI-1 seems to act as a potent downstream effector on the pro-fibrotic property of TGF-β. In addition, inhibition of PAI-1 activity by a PAI-1 inhibitor exerts an antifibrotic effect even in vivo. These data suggest that targeting PAI-1 as a downstream effector of TGF-β could be a promising therapeutic strategy for pulmonary fibrosis.

  4. Naval Nuclear Arms Reduction - Fixing the US Navy’s Achilles’ Heel

    Science.gov (United States)

    1990-06-12

    Kashin ( 4 1 3 6 ) 12 Kashin (4/36) 8 Kanin (2/16) 8 SAM Kotlin (2/16) N u c l e a r or Cony 3 K i e v ( 4 / 7 2 ) I Hod K i e v (4172) 2...8 SAM Kotlin (2/16) 3 K iev (4172) 1 Hod K iev (4172) 2 Moskva (4 /44) 7 Kara (4 /72) I0 K res ta I I (4 /72) 3+ K i r o v ( 1 2 / 9 6

  5. AcEST: BP914837 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1852 Score = 37.0 bits (84), Expect = 0.031 Identities = 26/65 (40%), Positives = 36/65 (55%) Frame = -3 Qu... = 25/65 (38%), Positives = 36/65 (55%) Frame = -3 Query: 216 TSCADSPTSPAFSLASCST...693 Score = 34.3 bits (77), Expect = 0.20 Identities = 24/65 (36%), Positives = 35/65 (53%) Frame...68 (38%), Positives = 38/68 (55%), Gaps = 3/68 (4%) Frame = -3 Query: 216 TSCADSP...(36%), Positives = 34/65 (52%) Frame = -3 Query: 216 TSCADSPTSPAFSLASCSTSSLIASFPFFAPSPSRASTSSKICSTIFGISSPFWA

  6. U.S. Standard Atmosphere, 1976

    Science.gov (United States)

    1976-10-01

    57156 216.650 -56.500 6.2040 1 8.1756 2 1.3320 -1 1.0074 -1 57200 57357 216.650 -56.500 8.2047 8.0974 1.3193 1.0770 57400 57550 216.650 -56.500 8.1262...57000 57S5b .9945 2.7696 *24 6.5236 * 8 6.1002 - 7 295.07 7.9447 - 1 𔄁.014 - S72CU 57357 .9945 2.7430 6.4612 0.3591 295.07 7,9447 1.7014 57400 57558

  7. Improved CVD Techniques for Depositing Passivation Layers of ICs

    Science.gov (United States)

    1975-10-01

    Gases. ... 216 Effects of Substrate Surface . . . . . . eco . yt . . . . . 216 Applicability of Results to Other CVD Reco ytms .. . 216 Post-Deposition...October 11, - eCo .,1,Nolp.4,ardNok, ZE6 1970). 193) 363. D. S. Zoroglu and L. E. Cak EE~rf5 358, Staff Article, "How Phosphorus Abets IC Destruc- Eeto...lmghthroghpt, b sipleIn these reactors, thke substrate wafers are placed and qafv to operate, and easy to maintainl. Tile captal cst o theo lkptlnt

  8. Malaria Facts

    Science.gov (United States)

    ... 216 million clinical episodes, and 445,000 deaths. Biology, Pathology, Epidemiology Among the malaria species that infect ... Cinchona spp., South America, 17th century). Get Email Updates To receive email updates about this page, enter ...

  9. A Global Database of Field-observed Leaf Area Index in Woody Plant Species, 1932-2011

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: This data set provides global leaf area index (LAI) values for woody species. The data are a compilation of field-observed data from 1,216 locations...

  10. Medline Plus

    Full Text Available ... Cardiac Catheterization: The New Frontier of Coronary Intervention (University of Chicago Medical Center, Chicago, IL, 6/26/2014) Aortic Aneurysm Hybrid Arch Debranching (University of Maryland Medical Center, Baltimore, MD, 2/16/ ...

  11. A Comparative Review of Three Microbiology Student Study Resources

    Directory of Open Access Journals (Sweden)

    JMBE Production Editor

    2012-03-01

    Full Text Available Correction for Wendy A. Dustman, “A Comparative Review of Three Microbiology Student Study Resources,” which appeared in the Journal of Microbiology & Biology Education, volume 12, number 2, December 2011, pages 214–216.

  12. Protein (Viridiplantae): 804127 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 700:216 ... 980083:547 ... 3701:1031 ... 59689:710 81972:710 ... predicted protein Arabidopsis lyrata subsp. lyrata MSSEKEEKESSKNPTTPP...IAVPPTATPPIAKPPVATPPTTKPPVATPPVATPPIATPPITKPPVTTPPVATPPIAKPPVATPPTATPPVATPPIAKPPVATPP...IATPPIAKPPVVTPPIATPPIATPPIAIPPIATPPVSKPPVATPPVATPPTAMPPVATPPIAKPPVVTPPVATPPIAKPPVATPPIATPPVSKPPVATPPVATPP...TTMPPVATPPIAKPPVATPPVATPPIAKPPVATPPIATPPVSKPPVATPPVATPPTIMPPVATPPIAKPPVATPPVATPPIAKPPIATPPVATPPIAKPPIATPPIAKPPIATPP...VATPPIAKPPIATPPIAKPPTATPPTSIPPVATPPITTPPVATPPIATPPVAKPPVATPPVASPPVAKPPIATPP

  13. Dicty_cDB: Contig-U06764-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Amino Acid sequence SHHHHYHHYHNHHKVENLIDSHIFIGLMAFLILFILMVIGLLIYKYNLKKRVLILLEKRY QRKKKVKTSQFGDDFTSAKFSQVF...*tf*rsssgwxy**cfff*k** Frame B: SHHHHYHHYHNHHKVENLIDSHIFIGLMAFLILFILMVIGLLIYKYNLKKRVLILLEKRY QRKKKVKTSQFGDDFTSAKFSQVF...KVENLIDSHIFIGLMAFLILFILMVIGLLIYKYNLKKRVLILLEKRYQRKKKVKTSQFGD 220 KVENLIDSHIFIGLMAFLILFILMVIGLLIYKYNLKKRVL...KRYQRKKKVKTSQFGD Sbjct: 216 KVENLIDSHIFIGLMAFLILFILMVIGLLIYKYNLKKRVLILLEKRYQRKKKVKTSQFGD 275 Query: 221

  14. 48 CFR 812.301 - Solicitation provisions and contract clauses for the acquisition of commercial items.

    Science.gov (United States)

    2010-10-01

    ....216-70, Estimated quantities. (15) 852.228-71, Indemnification and insurance. (16) 852.229-70, Sales and use taxes. (17) 852.233-70, Protest content/alternative dispute resolution. (18) 852.233-71...

  15. Future-Oriented Coping and Job Hunting Among College Students

    National Research Council Canada - National Science Library

    Hu, Yueqin; Gan, Yiqun

    2011-01-01

    Using a sample of Chinese college students (n = 216), the present study showed that future-oriented coping negatively correlated with perceived pressure and positively correlated with successful job hunting...

  16. Vývoj rodové identity dětí mladšího a středního školního věku

    Czech Academy of Sciences Publication Activity Database

    Janošová, Pavlína

    2003-01-01

    Roč. 38, č. 3 (2003), s. 216-235 ISSN 0555-5574 Institutional research plan: CEZ:AV0Z7025918 Keywords : gender role acquirement * gender identity development * younght school age Subject RIV: AN - Psychology

  17. Assessment of Undiscovered Oil and Gas Resources of Southeast Asia, 2010

    Science.gov (United States)

    2010-01-01

    Using a geology-based assessment methodology, the U.S. Geological Survey (USGS) estimated means of 21.6 billion barrels of oil and 299 trillion cubic feet of undiscovered natural gas in 22 provinces of southeast Asia.

  18. Strengthening the Army-Industry Dialogue on Defense Cooperation and Trade

    Science.gov (United States)

    1990-11-01

    Office Organization ........ 2-15 LMI Recommendations .............................. 2-16 Chapter 3. Industry Recommendations on Defense Exports and...arrangements for advance notification and involvement of their industries prior to source selection. Program Management Office Organization With respect to the

  19. Effects of elevated CO2 and ozone on phenolic glycosides of trembling aspen

    Science.gov (United States)

    James K. Nitao; Muraleedharan G. Nair; William J. Mattson; Daniel A. Herms; Bruce A. Birr; Mark D. Coleman; Terry M. Trier; J. G. Isebrands

    1996-01-01

    We tested the effects of elevated CO2 and ozone on concentrations of the phenolic glycosides salicortin and tremulacin in immature and mature foliage of the trembling aspen (Populus tremuloides) clones 216, 259, and 271.

  20. Djerrou et al., Afr J Tradit Complement Altern Med. (2013) 10(3):480 ...

    African Journals Online (AJOL)

    AJTCAM

    2009). Efficacy and safety of catnip (Nepeta. Cataria) as a novel filth fly repellent. Medical and Veterinary Entomology, 23 : 209 - 216. 57. Zrira, S., Elamrani, A. and Benjilali, B. (2003). Chemical composition of the essential oil of Pistacia lentiscus L.

  1. Gclust Server: 95977 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(216) 332 predicted alpha/beta hydrolase superfamily protein 1 1.00e-31 0.0 0...length 332 Representative annotation predicted alpha/beta hydrolase superfamily protein Number of Sequences

  2. Trajectories of anxiety and depression in liver transplant candidates during the waiting-list period

    NARCIS (Netherlands)

    Annema, Coby; Roodbol, Petrie F; Van den Heuvel, Edwin R; Metselaar, Herold J; Van Hoek, Bart; Porte, Robert J; Ranchor, Adelita V

    OBJECTIVES: To explore whether distinct trajectories of anxiety and depression exist among liver transplant candidates, and to gain insight into demographic, clinical, and individual characteristics related with these trajectories. DESIGN: A multicentre, prospective cohort study among 216 liver

  3. AcEST: DK948814 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3|Q38JE3_MAIZE Putative uncharacterized protein OS=Zea m... 218 3e-55 tr|Q38JD1|Q38JD1_PHYPA Temperature-ind...218 3e-55 tr|Q38JB9|Q38JB9_POPTM Temperature-induced lipocalin OS=Populus ... 217... 5e-55 tr|Q38JD5|Q38JD5_POPBA Temperature-induced lipocalin' OS=Populus... 216 8e-55 tr|B6V700|B6V700_9ROSI Temperature...-induced lipocalin OS=Populus ... 216 8e-55 tr|Q38JC5|Q38JC5_PRUPE Temperature-induced lipocalin ...OS=Prunus p... 216 1e-54 tr|Q38JC4|Q38JC4_PRUAR Temperature-induced lipocalin OS=Prunus a... 216 1e-54 tr|Q9

  4. 76 FR 41313 - Agency Forms Submitted for OMB Review, Request for Comments

    Science.gov (United States)

    2011-07-13

    ... accuracy of the estimated burden of the collections; (3) ways to enhance the quality, utility, and clarity... prescribed in 20 CFR 216.24. Under Section 2(f)(6) of the RRA, earnings deductions are required each month an...

  5. 76 FR 13629 - Draft Guidance for Industry on Chemistry, Manufacturing, and Controls Information-Fermentation...

    Science.gov (United States)

    2011-03-14

    ... Controls Information--Fermentation-Derived Intermediates, Drug Substances, and Related Drug Products for... 216 entitled ``Chemistry, Manufacturing, and Controls (CMC) Information-- Fermentation-Derived... fermentation-derived intermediates, drug substances, and related drug products for veterinary medicinal use...

  6. A Global Database of Field-observed Leaf Area Index in Woody Plant Species, 1932-2011

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set provides global leaf area index (LAI) values for woody species. The data are a compilation of field-observed data from 1,216 locations obtained from...

  7. Dicty_cDB: Contig-U14955-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9696_1( AF289696 |pid:none) Wolbachia endosymbiont of Spalangi... 216 2e-54 AJ271750_1( AJ271750 |pid:none) ...icotiana tabacum chloroplast mRNA... 216 2e-54 AF289697_1( AF289697 |pid:none) Wolbachia endosymbiont of Spalan...gi... 216 2e-54 AF289698_1( AF289698 |pid:none) Wolbachia endosymbiont of Spalangi... 216 2e-54 AE010300_...|pid:none) Wolbachia endosymbiont of Spalangi... 213 1e-53 DQ093830_1( DQ093830 |pid:none) Wolbachia endosym...3 AF289704_1( AF289704 |pid:none) Wolbachia endosymbiont of Spalangi... 211 7e-53

  8. WATER TEMPERATURE and other data from VREELAND from 1990-11-02 to 1990-11-16 (NCEI Accession 9000298)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The data in this accession was collected from Ship Vreeland between November 2-16, 1990. The real time data of water temperature at varying depth bathythermograph...

  9. State waste discharge permit application: Hydrotest, maintenance and construction discharges. Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-11-01

    On December 23, 1991, the US DOE< Richland Operation Office (RL) and the Washington State Department of Ecology (Ecology) agreed to adhere to the provisions of the Department of Ecology Consent Order No. DE91NM-177 (216 Consent Order) (Ecology and US DOE 1991). The 216 Consent Order list regulatory milestones for liquid effluent streams at the Hanford Site and requires compliance with the permitting requirements of Washington Administrative Code. Hanford Site liquid effluent streams discharging to the soil column have been categorized on the 216 Consent Order as follows: Phase I Streams; Phase II Streams; Miscellaneous Streams. Phase I and Phase II Streams were initially addressed in two report. Miscellaneous Streams are subject to the requirements of several milestones identified in the 216 Consent Order. This document constitutes the Categorical State Waste Discharge Permit application for hydrotest,maintenance and construction discharges throughout the Hanford Site. This categorical permit application form was prepared and approved by Ecology.

  10. Metodika rasčeta potěr' napora pri gidrotransportě sguščennych pul'p chvostov obogaščenija rud

    Czech Academy of Sciences Publication Activity Database

    Aleksandrov, V.I.; Vlasák, Pavel

    2015-01-01

    Roč. 216, č. 18067 (2015), s. 37-43. ISBN 978-5-94211-749-8. ISSN 0135-3500 Institutional support: RVO:67985874 Keywords : pressure losses * concentration * slurry * rheological parameters Subject RIV: BK - Fluid Dynamics

  11. Investigating the potential climate change impacts on maritime operations around the Southern African coast

    CSIR Research Space (South Africa)

    Rossouw, M

    2009-07-01

    Full Text Available . Proceedings IPCC TGICA Conference: Integrating Analysis of Regional Climate Change and Response Options; Nadi, Fiji, June, 2007. p 205-216 UNCTAD (2008). Maritime transport and the climate change challenge. Note by the UNCTAD secretariat. United Nations...

  12. Weather-related Tree Swallow Mortality and Reduced Nesting Effort

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report documents the spring 2007 die-off of 216 Tree Swallows in western New York due to a period of unseasonably warm temperatures followed immediately by a...

  13. 77 FR 12314 - Agency Information Collection Activities: Proposed Collection: Comment Request

    Science.gov (United States)

    2012-02-29

    ...:h3590enr.txt.pdf , pages 216-225). The Act responds to the diverse needs of children and families in... begun to carry out their proposed programs, integrating them with their formula-based programming. These...

  14. Students' Evaluation of Classroom Interactions of Their Biology ...

    African Journals Online (AJOL)

    ' classroom interaction and their feelings towards biology lessons. Three research questions guided the study. Copies of a questionnaire containing 48 items were distributed to 1,216 senior secondary two students from nine randomly selected ...

  15. Zinc supplement use and contribution to zinc intake in Australian children

    National Research Council Canada - National Science Library

    Rangan, Anna; Jones, Aimee; Samman, Samir

    ...) and a review of commercially available Zn supplements. Australia. Children (n 4834) aged 2-16 years. Zn supplement use was associated with younger age, being female, having a lower BMI and consuming a vegetarian or modified diet...

  16. Pokročilé asistenční systémy (ADAS) – optika ve službách bezpečnosti silničního provozu

    Czech Academy of Sciences Publication Activity Database

    Viktorová, L.; Stanke, Ladislav

    2017-01-01

    Roč. 62, Sep-Oct (2017), s. 216-222 ISSN 0447-6441 Institutional support: RVO:68378271 Keywords : ADAS * automotive * LIDAR * sensors * traffic psychology * driver behaviour * traffic safety Subject RIV: AN - Psychology

  17. Prevalencia de enteroparasitos en dos comunidades de Santa Rosa de Agua en Maracaibo, Estado Zulia, Venezuela 2006

    National Research Council Canada - National Science Library

    Calchi L.C., Marinella; Rivero de R., Zulbey; Acurero O., Ellen; Diaz A., Iris; Chourio de L., Glenis; Bracho M., Angela; Maldonado I., Adriana; Fernandez G., Bianca; Fernandez L., Mercy; Gonzalez V., Jesus; Villalobos P., Rafael

    2007-01-01

    Para determinar la prevalencia de enteroparasitos en dos comunidades de Santa Rosa de Agua en el Estado Zulia, se analizaron 216 muestras fecales de individuos de ambos sexos, con edades comprendidas...

  18. Corrigendum to "New constraints on kinetic isotope effects during CO2(aq) hydration and hydroxylation: Revisiting theoretical and experimental data" [Geochim. Cosmochim. Acta 214 (2017) 246-265

    Science.gov (United States)

    Sade, Ziv; Halevy, Itay

    2018-03-01

    The authors regret an error in the derivation of the link between KFFs and isotopic rate constants of CO2 hydration (Section 2.2). Considering the subset of isotopologues, C16O16O, C18O16O, H216O and H218O, there are four possible forward reactions: C16O16O + H216O → H2C16O16O16O,

  19. Hormonal Resistance And Metastasis ER-Coregulartor-Src Signaling Targeted Therapy

    Science.gov (United States)

    2011-09-01

    receptor family. Curr Opin Obstet Gynecol 1999 Jun;11(3):249-54. [16] Curtis HS, Couse JF, Korach KS. Estrogen receptor transcription and...breast cancer. Curr Top Med Chem 2006;6:195-216. (2) Lewis-Wambi JS, Jordan VC. Treatment of Postmenopausal Breast Cancer with Selective Estrogen...Estrogen receptors as therapeutic targets in breast cancer. Curr Top Med Chem 6:195–216 2. Lewis-Wambi JS, Jordan VC (2005) Treatment of postmeno- pausal

  20. Review: Lisa Mackenrodt, Swahili Spirit Possession and Islamic Healing in Contemporary Tanzania: The Jinn Fly on Friday (2011 Buchbesprechung: Lisa Mackenrodt, Swahili Spirit Possession and Islamic Healing in Contemporary Tanzania: The Jinn Fly on Friday (2011

    Directory of Open Access Journals (Sweden)

    Jigal Beez

    2013-01-01

    Full Text Available Review of the monograph:Lisa Mackenrodt, Swahili Spirit Possession and Islamic Healing in Contemporary Tanzania: The Jinn Fly on Friday, Hamburg: Verlag Dr. Kovač, 2011, ISBN 978-3-8300-5806-9, 216 pagesBesprechung der Monographie:Lisa Mackenrodt, Swahili Spirit Possession and Islamic Healing in Contemporary Tanzania: The Jinn Fly on Friday, Hamburg: Verlag Dr. Kovač, 2011, ISBN 978-3-8300-5806-9, 216 Seiten

  1. Analysis of Bolted and Bonded Composite

    Science.gov (United States)

    1992-09-01

    nonlinear and temperature dependent. To describe the nonlinear stress-strain relationship, many engineers have employed the Ramberg - Osgood equation [2-16...the Ramberg - Osgood model, Eq. (1). However, the Ramberg - Osgood equation is more widely used because of its simplicity. 56 IN 9320I LU4.. C VH 221G110...Jones, J. Materials Sciences, Vol. W0, 1975, p. 1037. 2-16. Ramberg , W. and Osgood , W. R., "Description of Stress-Strain Curves by Three Parameters

  2. Distributed Mode Filtering Rod Fiber Amplifier With Improved Mode Stability

    DEFF Research Database (Denmark)

    Laurila, Marko; Alkeskjold, Thomas Tanggaard; Broeng, Jes

    2012-01-01

    We report 216W of average output power from a photonic crystal rod fiber amplifier. We demonstrate 44% power improvement before onset of the mode instability by operating the rod fiber in a leaky guiding regime.......We report 216W of average output power from a photonic crystal rod fiber amplifier. We demonstrate 44% power improvement before onset of the mode instability by operating the rod fiber in a leaky guiding regime....

  3. Anthropomorphic Interfaces on Automation Trust, Dependence, and Performance inYounger and Older Adults

    Science.gov (United States)

    2015-10-26

    witnesses and its relation to ageism . Behavioral Sciences and the Law, 25, 355-375. Nass, C., & Lee, K. M. (2001). Does computer-generated speech...23. Perdue, C. W., & Gurtman, M. B. (1990). Evidence for the automaticity of ageism . Journal of Experimental Social Psychology, 26(3), 199-216...B. Gurtman. 1990. “Evidence for the Automaticity of Ageism .” Journal of Experimental Social Psychology 26 (3): 199–216. Posthuma, R. A., and M. A

  4. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  5. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  6. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  7. Cyclic nucleotide dependent dephosphorylation of regulator of G-protein signaling 18 in human platelets.

    LENUS (Irish Health Repository)

    Gegenbauer, Kristina

    2013-11-01

    Regulator of G-protein signaling 18 (RGS18) is a GTPase-activating protein that turns off Gq signaling in platelets. RGS18 is regulated by binding to the adaptor protein 14-3-3 via phosphorylated serine residues S49 and S218 on RGS18. In this study we confirm that thrombin, thromboxane A2, or ADP stimulate the interaction of RGS18 and 14-3-3 by increasing the phosphorylation of S49. Cyclic AMP- and cyclic GMP-dependent kinases (PKA, PKG) inhibit the interaction of RGS18 and 14-3-3 by phosphorylating S216. To understand the effect of S216 phosphorylation we studied the phosphorylation kinetics of S49, S216, and S218 using Phos-tag gels and phosphorylation site-specific antibodies in transfected cells and in platelets. Cyclic nucleotide-induced detachment of 14-3-3 from RGS18 coincides initially with double phosphorylation of S216 and S218. This is followed by dephosphorylation of S49 and S218. Dephosphorylation of S49 and S218 might be mediated by protein phosphatase 1 (PP1) which is linked to RGS18 by the regulatory subunit PPP1R9B (spinophilin). We conclude that PKA and PKG induced S216 phosphorylation triggers the dephosphorylation of the 14-3-3 binding sites of RGS18 in platelets.

  8. Effect of Different Application Rate of Nitrogen Fertilizer Under Straw Return on Maize Yield and Inorganic Nitrogen Accumulation

    Directory of Open Access Journals (Sweden)

    ZHANG Xin

    2014-06-01

    Full Text Available We investigated the influences of different nitrogen fertilizer rate on maize production, nitrogen use efficiency and soil nitrate nitrogen at straw return farmland for two years. The results showed that maize production increased with the increment of nitrogen fertilizer. The maize production was the highest at 216 kg·hm -2(N216of nitrogen use and began to decrease when the amount of nitrogen use was beyond 216 kg· hm -2. There were significant interannual differences on maize production in the same treatment. The maize production in 2010 increased 0.69%~4.75% compared with that in 2009. Nitrogen use efficiency, nitrogen agronomic efficiency and nitrogen harvest index improved with the year of straw return. The highest nitrate nitrogen accumulation was found in the treatment of 240 kg· hm -2(N240in 0~100 cm soil layer. Soil nitrate content increased with the depth of soil. This may potentially increased the risk of nitrate pollution on shallow groundwater. Compared with N240, the nitrate nitrogen accumulation of N168(168 kg·hm -2 , N192(192 kg·hm -2 and N216(216 kg·hm -2 were equally reduced by respectively 39.87%, 35.84% and 29.38% in 0~100 cm soil layer. Considering the maize production, nitrogen use efficiency and ecological environmental benefits, the optimum amount of nitrogen use should be 200 kg·hm -2.

  9. A Small Molecule Inhibitor of the BLM Helicase Modulates Chromosome Stability in Human Cells

    DEFF Research Database (Denmark)

    Nguyen, Giang Huong; Dexheimer, Thomas S; Rosenthal, Andrew S

    2013-01-01

    The Bloom's syndrome protein, BLM, is a member of the conserved RecQ helicase family. Although cell lines lacking BLM exist, these exhibit progressive genomic instability that makes distinguishing primary from secondary effects of BLM loss problematic. In order to be able to acutely disable BLM...... function in cells, we undertook a high throughput screen of a chemical compound library for small molecule inhibitors of BLM. We present ML216, a potent inhibitor of the DNA unwinding activity of BLM. ML216 shows cell-based activity and can induce sister chromatid exchanges, enhance the toxicity...... of aphidicolin, and exert antiproliferative activity in cells expressing BLM, but not those lacking BLM. These data indicate that ML216 shows strong selectivity for BLM in cultured cells. We discuss the potential utility of such a BLM-targeting compound as an anticancer agent....

  10. M-type asteroids - Rotational properties of 16 objects

    Science.gov (United States)

    Dotto, E.; Barucci, M. A.; Fulchignoni, M.; di Martino, M.; Rotundi, A.; Burchi, R.; di Paolantonio, A.

    1992-10-01

    We present the results of photometric observations of 16 M-type asteroids performed from 1984 through 1990. We determine for the first time a reliable rotational period for the asteroids 369 Aeria, 785 Zwetana, and 798 Ruth. We estimate the shape and the pole coordinates of 135 Hertha and 250 Bettina and also check those of 16 Psyche, 21 Lutetia, 22 Kalliope, 129 Antigone and 216 Kleopatra. Composite lightcurves are derived for nine of the observed objects (83 Beatrix, 97 Klotho, 110 Lydia, 129 Antigone, 135 Hertha, 216 Kleopatra, 369 Aeria, 785 Zwetana and 798 Ruth).

  11. GEP 6.5LT Engine Cetane Window Evaluation for ATJ/JP-8 Fuel Blends

    Science.gov (United States)

    2015-09-01

    Fuel Number 8 HRR Heat Release Rate IPK Iso Parrafinic Kerosene IVC Intake Valve Close J/CAD Joules per Crank Angle Degree JP-8 Jet Propulsion Fuel...Temperature °C 22.2 21.6 21.6 Electrical Conductivity pS/m 660 1230 890 150-600 JFTOT D3241 Test Temperature °C 260 260...Cetane Index D976 - 49.9 50.3 51.0 Particle Count by APC (Cumulative) ISO -4406 >= 4µm(c) class code 16 16 17 >= 6µm(c) class code

  12. Antimicrobial resistance patterns of Staphylococcus species isolated from cats presented at a veterinary academic hospital in South Africa.

    Science.gov (United States)

    Qekwana, Daniel Nenene; Sebola, Dikeledi; Oguttu, James Wabwire; Odoi, Agricola

    2017-09-15

    Antimicrobial resistance is becoming increasingly important in both human and veterinary medicine. This study investigated the proportion of antimicrobial resistant samples and resistance patterns of Staphylococcus isolates from cats presented at a veterinary teaching hospital in South Africa. Records of 216 samples from cats that were submitted to the bacteriology laboratory of the University of Pretoria academic veterinary hospital between 2007 and 2012 were evaluated. Isolates were subjected to antimicrobial susceptibility testing against a panel of 15 drugs using the disc diffusion method. Chi square and Fisher's exact tests were used to assess simple associations between antimicrobial resistance and age group, sex, breed and specimen type. Additionally, associations between Staphylococcus infection and age group, breed, sex and specimen type were assessed using logistic regression. Staphylococcus spp. isolates were identified in 17.6% (38/216) of the samples submitted and 4.6% (10/216) of these were unspeciated. The majority (61.1%,11/18) of the isolates were from skin samples, followed by otitis media (34.5%, 10/29). Coagulase Positive Staphylococcus (CoPS) comprised 11.1% (24/216) of the samples of which 7.9% (17/216) were S. intermedius group and 3.2% (7/216) were S. aureus. Among the Coagulase Negative Staphylococcus (CoNS) (1.9%, 4/216), S. felis and S. simulans each constituted 0.9% (2/216). There was a significant association between Staphylococcus spp. infection and specimen type with odds of infection being higher for ear canal and skin compared to urine specimens. There were higher proportions of samples resistant to clindamycin 34.2% (13/25), ampicillin 32.4% (2/26), lincospectin 31.6% (12/26) and penicillin-G 29.0% (11/27). Sixty three percent (24/38) of Staphylococcus spp. were resistant to one antimicrobial agent and 15.8% were multidrug resistant (MDR). MDR was more common among S. aureus 28.6% (2/7) than S. intermedius group isolates 11.8% (2

  13. EST Table: DC546592 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC546592 E_FL_phe-_07I18_F_0 10/09/28 99 %/228 aa ref|NP_001170882.1| tan protein [...Bombyx mori] dbj|BAI87831.1| Tan [Bombyx mori] 10/09/02 51 %/216 aa FBpp0071270|t-PA 10/08/28 n.h 10/09/10 5... 10/09/10 52 %/216 aa gi|91078850|ref|XP_971848.1| PREDICTED: similar to tan CG12120-PA [Tribolium castaneum] AU000330 phe- ...

  14. Comparative Inhalation Screen of Titanium Dioxide and Graphite Dusts

    Science.gov (United States)

    1988-11-01

    median aerodynamic diameter ( MMAD ) and geometric standard deviation (0g) of each test material were determined .* during the calibration and exposure...transferred to clean cages in adjacent 22 TABLE 5. MEAN PARTICLE SIZE OF AEROSOLS Natural Graphite Synthetic Graphite Titanium Dioxide MMAD (0g) MMAD (0g... MMAD (0g) During 3.06 (2.19) 2.96 (2.16) 2.15 (3.18) Calibration 3.04 (2.16) 2.57 (2.26) 2.15 (2.51) 2.89 (2.22) During 2.40 (2.56) 2.34 (2.53) 1.42

  15. Chemical and physical composition of grain-type and food-type soybean for food processing Composição química e física de soja tipo grão e tipo alimento para o processamento de alimentos

    Directory of Open Access Journals (Sweden)

    Josemeyre Bonifácio da Silva

    2009-07-01

    Full Text Available The objective of this work was to evaluate the chemical and physical characteristics of grains of soybean (Glycine max cultivars for food processing. The soybean cultivars evaluated were: grain-type - BRS 133 and BRS 258; food-type - BRS 213 (null lipoxygenases, BRS 267 (vegetable-type and BRS 216 (small grain size. BRS 267 and BRS 216 cultivars showed higher protein content, indicating that they could promote superior nutritional value. BRS 213 cultivar showed the lowest lipoxygenase activity, and BRS 267, the lowest hexanal content. These characteristics can improve soyfood flavor. After cooking, BRS 267 cultivar grains presented a higher content of aglycones (more biologically active form of isoflavones and oleic acid, which makes it proper for functional foods and with better stability for processing, and also showed high content of fructose, glutamic acid and alanine, compounds related to the soybean mild flavor. Because of its large grain size, BRS 267 is suitable for tofu and edamame, while small-grain-sized BRS 216 is good for natto and for soybean sprouts production. BRS 216 and BRS 213 cultivars presented shorter cooking time, which may be effective for reducing processing costs.O objetivo deste trabalho foi avaliar as características químicas e físicas de grãos de cultivares de soja (Glycine max para o processamento de alimentos. As cultivares avaliadas foram: tipo grão - BRS 133 e BRS 258; tipo alimento - BRS 213 (desprovida de lipoxigenases, BRS 267 (tipo hortaliça e BRS 216 (tamanho de grão pequeno. As cultivares BRS 216 e BRS 267 apresentaram maior teor de proteínas e poderiam promover valor nutricional superior. A cultivar BRS 213 apresentou a menor atividade de lipoxigenases e a BRS 267, o menor teor de hexanal. Essas características podem melhorar o sabor dos alimentos. Com o cozimento, os grãos da cultivar BRS 267 apresentaram maior teor de agliconas (forma biologicamente mais ativa das isoflavonas e de ácido oleico

  16. Hepatitis Delta Infections in Toronto, Ontario

    OpenAIRE

    S. Victor Feinman; Barnet Berris; John L. Gerin; Robert H. Purcell

    1988-01-01

    This study assessed the prevalence of hepatitis delta virus infection, the relation of this infection to the clinical and histological status and to the geographic origin of 216 patients with hepatitis B virus infection in Toronto, Ontario. Evidence of delta infection was present in 13 of the 216 patients (6.0%). It was more common in patients with acute hepatitis (11.1%) and with chronic hepatitis (16.7%) than in asymptomatic carriers (3.6%). It was not present in the three patients with hep...

  17. Knowledge-Based Logistics Planning and Its Application in Manufacturing and Strategic Planning

    Science.gov (United States)

    1990-01-01

    for order 2 30 Figure 2-16: Illustration of Fubini’s Theorem in a TCG with 3 Time 33 Periods Figure 2-17: A TCG with 3 Time Periods 35 Figure 2-18...integral as an iterated integral. Notice that, according to Fubini’s theorem (see [Thomas 83] for instance), there are [2(n-1)]! correct ways to...in (13) domain of integration in (14) Figure 2-16: Illustration of Fubini’s Theorem in a TCG with 3 Time Periods greater than its lower bound (since

  18. Quantitative Single-Particle Digital Autoradiography with α-Particle Emitters for Targeted Radionuclide Therapy using the iQID Camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W.; Frost, Sophia; Frayo, Shani; Kenoyer, Aimee L.; Santos, E. B.; Jones, Jon C.; Green, Damian J.; Hamlin, Donald K.; Wilbur, D. Scott; Fisher, Darrell R.; Orozco, Johnnie J.; Press, Oliver W.; Pagel, John M.; Sandmaier, B. M.

    2015-07-01

    Abstract Alpha emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm) causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with alpha emitters may inactivate targeted cells with minimal radiation damage to surrounding tissues. For accurate dosimetry in alpha-RIT, tools are needed to visualize and quantify the radioactivity distribution and absorbed dose to targeted and non-targeted cells, especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, iQID (ionizing-radiation Quantum Imaging Detector), for use in alpha-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection technology that images and identifies charged-particle and gamma-ray/X-ray emissions spatially and temporally on an event-by-event basis. It employs recent advances in CCD/CMOS cameras and computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, we evaluated this system’s characteristics for alpha particle imaging including measurements of spatial resolution and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 (211At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ~20 μm full width at half maximum (FWHM) and the alpha particle background was measured at a rate of (2.6 ± 0.5) × 10–4 cpm/cm2 (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was performed using a large-area iQID configuration (ø 11.5 cm

  19. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  20. α-Imaging Confirmed Efficient Targeting of CD₄₅-Positive Cells After ²¹¹At-Radioimmunotherapy for Hematopoietic Cell Transplantation

    Energy Technology Data Exchange (ETDEWEB)

    Frost, Sophia; Miller, Brian W.; Back, Tom; Santos, E. B.; Hamlin, Donald K.; Knoblaugh, E.; Frayo, Shani; Kenoyer, Aimee L.; Storb, Rainer; Press, O. W.; Wilbur, D. Scott; Pagel, John M.; Sandmaier, B. M.

    2015-09-03

    Alpha-radioimmunotherapy (α-RIT) targeting CD45 may substitute for total body irradiation in hematopoietic cell transplantation (HCT) preparative regimens for lymphoma. Our goal was to optimize the anti-CD45 monoclonal antibody (MAb; CA12.10C12) protein dose for astatine-²¹¹(²¹¹At)-RIT, extending the analysis to include intra-organ ²¹¹At activity distribution and α-imaging-based small-scale dosimetry, along with imunohistochemical staining. Methods: Eight normal dogs were injected with either 0.75 (n=5) or 1.00 mg/kg (n=3) of ²¹¹At-B10-CA12.10C12 (11.5–27.6 MBq/kg). Two were euthanized and necropsied 19–22 hours postinjection (p.i.), and six received autologous HCT three days after ²¹¹At-RIT, following lymph node and bone marrow biopsies at 2–4 and/or 19 hours p.i. Blood was sampled to study toxicity and clearance; CD45 targeting was evaluated by flow cytometry. ²¹¹At localization and small scale dosimetry were assessed using two α-imaging : α-camera and iQID. Results: Uptake of ²¹¹At was highest in spleen (0.31–0.61 %IA/g), lymph nodes (0.02–0.16 %IA/g), liver (0.11–0.12 %IA/g), and marrow (0.06–0.08 %IA/g). Lymphocytes in blood and marrow were efficiently targeted using either MAb dose. Lymph nodes remained unsaturated, but displayed targeted ²¹¹At localization in T lymphocyte-rich areas. Absorbed doses to blood, marrow, and lymph nodes were estimated at 3.9, 3.0, and 4.2 Gy/210 MBq, respectively. All transplanted dogs experienced transient hepatic toxicity. Liver enzyme levels were temporarily elevated in 5 of 6 dogs; 1 treated with 1.00 mg MAb/kg developed ascites and was euthanized 136 days after HCT. Conclusion: ²¹¹At-anti-CD45 RIT with 0.75 mg MAb/kg efficiently targeted blood and marrow without severe toxicity. Dosimetry calculations and observed radiation-induced effects indicated that sufficient ²¹¹At-B10-CA12.10C12 localization was achieved for efficient conditioning for HCT.

  1. The role of alpha therapy for local and systemic treatment of cancer

    Energy Technology Data Exchange (ETDEWEB)

    Allen, B.J. [St George Hospital, Kogarah, NSW (Australia)

    1998-03-01

    Major problems in the management of cancer relate to the inability to control some primary lesions, e.g. glioblastoma multiforme (GBM), and the inability to deal with metastatic cancer arising from malignant cancers such as melanoma, breast and other cancers. Binary alpha therapy using neutron capture in boron-10 offers the potential for improved prognosis for high grade brain tumours such as GBM and melanoma metastases to the brain. Metastatic cancer proceeds through a number of quite separate stages in the development of lethal disease, i e. cells in transit, preangiogenic lesions, subclinical and clinical lesions. Early stages offer the potential for control if targeted alpha therapy is applied. However, the dose must be localised to the cancer cell and this requirement rules out beta-emitting radionuclides, which are more suited for clinical lesions. Alpha-emitting radionuclides are the most appropriate toxins, as their efficacy depends on the linear energy transfer (LET) and range of the alpha particles. After matching the cancer stage, radiolabel and carrier, we find that {sup 149}Tb is the radionuclide of choice for systemic therapy in all aspects except production. The production of {sup 149}Tb in {mu}Ci (kBq) quantities has been achieved using the heavy ion reaction at the ANU tandem accelerator at Canberra and in multi-mCi (MBq) quantities using the spallation reaction in combination with on-line isotope separation technology of ISOLDE at CERN. Terbium is ideally suited for chelation to monoclonal antibodies to produce stable radio-immunoconjugates (RIC). Astatine-211 is a halide and has potential for the elimination of early stage melanoma metastases as At-MTB. However, the availability of the alpha generators {sup 228}Th-{sup 212}Bi and {sup 225}Ac-{sup 213}Bi facilitates the use of Bi-RIC in clinical trials for acute myeloid leukaemia and cystic glioma. Alpha therapy has the potential to control refractory cancers when treated at the minimum residual

  2. Systematics of Alpha-Radioactivity

    Energy Technology Data Exchange (ETDEWEB)

    Perlman, I.; Ghiorso, A.; Seaborg, G.T.

    1949-09-12

    Correlations of alpha-decay energies in terms of mass number and atomic number have been made for all of the alpha-emitting species now numbering over 100. For each element isotopes show increase in alpha-energy with decrease in mass number except in the region of 126 neutrons where there is an explainable reversal. This reversal has the effect of creating a region of relatively low alpha-energy and long half-life at low mass numbers for such elements as astatine, emanation, francium, and possibly higher elements as had been noted already for bismuth and polonium. Methods and examples of using alpha-decay data to define the energy surface in the heavy element region are discussed. The regularities in alpha-decay are used for predictions of nuclear properties including prediction of the beta-stable nuclides among the heavy elements. The half-life vs. energy correlations show that the even-even nuclides conform well with existing alpha-decay theory, but all nuclear types with odd nucleons show prohibited decay. The reason for this prohibition is not found in spin changes in the alpha-emission but in the assembly of the components of the alpha particle, and this theory is discussed further in terms of observations made on nuclides having two or more alpha-groups. Using most of the even-even nuclei to define 'normal nuclear radius' calculations are now able to show the shrinkage in the regions of lead and of 126 neutrons to amount to about 10%. The much greater change in 'effective radius' for bismuth isotopes can be dissociated into the effects of odd nucleons superimposed on the actual decrease in nuclear radius. The simple expression r = 1.48 A{sup 1/3} {center_dot} 10{sup -13} cm seems to fit the data for the even-even nuclei outside of the region of 126 neutrons better than more complex functions.

  3. AcEST: DK962730 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5) OS=Solanu... 172 2e-41 tr|A1KXJ7|A1KXJ7_ELAGV Oil palm polygalacturonase allergen PEST4... 172 2e-41 tr|A...VAAMESINAIVTGNLISLSEQELVDCDRSYNEGCDGGLMDYAFEFVIKN 216 >tr|A1KXJ7|A1KXJ7_ELAGV Oil palm polygalacturonase all

  4. Influence of crossover methods used by genetic algorithm-based ...

    Indian Academy of Sciences (India)

    order to prevent it and to get into the grammar of exploitation and exploration, parents close to each other are chosen and crossed so that population does ..... Control Syst. Technol. 13(2): 216–223. DeJong K A and Spears W M 1990 An analysis of the interacting roles of population size and crossover in genetic Algorithms.

  5. COMPLICATIONS CHIRURGICALES DES AVORTEMENTS ...

    African Journals Online (AJOL)

    1 janv. 2004 ... The aim of this study was to describe the complications of clandestine abortions and their surgical treatment. It is a retrospective .... In Paul. M, Lichtenberg ES, Borgata l, Grimes DA,. Stubblefield PG. A clinical guide to Medical and. Surgical Abortion. New York: Churchill Livingtone,. 1999, pp. 197-216. 4.

  6. Domain Modeling: NP_085116.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_085116.2 chr5 Solution structure of the tandem four zf-C2H2 domain repeats of mu...rine GLI-Kruppel family member HKR3 c2dlqa_ chr5/NP_085116.2/NP_085116.2_holo_209-322.pdb blast 216C,218E,21

  7. Optimization of ultrasound-assisted extraction of polyphenolic compounds from coriander seeds using response surface methodology

    Directory of Open Access Journals (Sweden)

    Zeković Zoran P.

    2016-01-01

    Full Text Available Coriandrum sativum L. (coriander seeds (CS were used for preparation of extracts with high content of biologically active compounds. In order to optimize ultrasoundassisted extraction process, three levels and three variables of Box-Behnken experimental design (BBD in combination with response surface methodology (RSM were applied, yielding maximized total phenolics (TP and flavonoids (TF content and antioxidant activity (IC50 and EC50 values. Independent variables were temperature (40-80oC, extraction time (40-80 min and ultrasonic power (96-216 W. Experimental results were fitted to a second-order polynomial model with multiple regression, while the analysis of variance (ANOVA was employed to assess the model fitness and determine optimal conditions for TP (79.60oC, 49.20 min, 96.69 W, TF (79.40oC, 43.60 min, 216.00 W, IC50 (80.00oC, 60.40 min, 216.00 W and EC50 (78.40oC, 68.60 min, 214.80 W. On the basis of the obtained mathematical models, three-dimensional surface plots were generated. The predicted values for TP, TF, IC50 and EC50 were: 382.68 mg GAE/100 g CS, 216 mg CE/100 g CS, 0.03764 mg/mL and 0.1425 mg/mL, respectively. [Projekat Ministarstva nauke Republike Srbije, br. TR31013

  8. X-ray sources and their optical counterparts in the Galactic Globular Cluster M12 (NGC 6218)

    NARCIS (Netherlands)

    Lu, T.-N.; Kong, A.K.H.; Bassa, C.G.; Verbunt, F.W.M.|info:eu-repo/dai/nl/068970374; Lewin, W.H.G.; Anderson, S.F.; Pooley, D.

    2009-01-01

    We study a Chandra X-ray Observatory ACIS-S observation of the Galactic globular cluster M12. With a 26 ks exposure time, we detect six X-ray sources inside the half-mass radius (2'.16) of which two are inside the core radius (0'.72) of the cluster. If we assume that these sources are all associated

  9. Regulatory ecotoxicity testing of nanomaterials – proposed modifications of OECD test guidelines based on laboratory experience with silver and titanium dioxide nanoparticles

    DEFF Research Database (Denmark)

    Hund-Rinke, Kerstin; Baun, Anders; Cupi, Denisa

    2016-01-01

    of the sediment-living worm Lumbriculus variegatus (TG 225), activity of soil microflora (TGs 216, 217), and reproduction of the invertebrates (Enchytraeus crypticus, Eisenia fetida, TGs 220, 222). Additionally, test descriptions for two further test systems (root elongation of plants in hydroponic culture; test...

  10. PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN

    African Journals Online (AJOL)

    GB

    Senior Lecturer, Department of Oral Medicine & Radiology, AECS Maaruti College of Dental Sciences & Research. Centre, Bangalore. Page 2. Ethiop J Health Sci. Vol. 22, No. 2. July 2012. 216. E-mail ID: drshilparaj10@yahoo.com size 10 years back, it gradually started increasing in size since 3 years to present size.

  11. Domain Modeling: NP_066360.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_066360.1 chr3 Crystal Structure of Human Fibroblast Growth Factor Homologous Fact...or 2A (FHF2A), also referred to as Fibroblast Growth Factor 13A (FGF13A) p3hbwb_ chr3/NP_066360.1/NP_066360.1_apo_68-216.pdb blast 0 ...

  12. ENERGY USE IN CITRUS PRODUCTION OF MAZANDARAN ...

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    in mid-tropical and wet climate areas. Iran produces 4.216 million metric tonnes of citrus each year (Anon., 2008). Moreover, Mazandaran. Province has produce 40% of that amount. The aim of this study was to assess energy use in citrus production, and the efficiency of energy consumption. MATERIALS AND METHODS.

  13. Knowledge, attitude and practice towards strabismus in Cheha ...

    African Journals Online (AJOL)

    admin

    loss of binocular vision and cosmetic stigma (1, 4, 5). The prevalence of strabismic amblyopia was found to be .... Marry or allow marriage of relatives to a person with strabismus. No (%). Yes. 216 (51.4). No. 204 (48.6). Reason for not marrying. Disabled. 78 (38.2). Cosmetic. 45 (22.1). No reason given. 35 (17.2). Others.

  14. Impact of the introduction of a colposcopy service in a rural South ...

    African Journals Online (AJOL)

    data). The primary healthcare (PHC) head count for the Overstrand healthcare facilities was 214 941 patients in 2007 and 300 216 in 2009, an increase in patient numbers of 40%. The regional referral ..... Martin B, Smith W, Orr P, Guijon F. Investigation and management of cervical intraepithelial neoplasia in Canadian Inuit: ...

  15. In vitro development and regeneration of microcorms in saffron ...

    African Journals Online (AJOL)

    5 media containing NAA (21.6 µM) + BAP (22.2 µM). The above observations will be useful as the base to make a possible road way for production of quality planting material in saffron. Keywords: Saffron, growth regulators, micropropagation, ...

  16. Untitled

    African Journals Online (AJOL)

    histologic sections of nodules showed immature neoplastic mast cells that were characterized by a high degree of ... cutaneous mast cell tumors, certain aspects ..... mast cell tumors in dogs: 10 cases. (1982-1997)”. J. Am. Vet. Med. Ass. 216: 222-226. THOMSON, PG. (1984). Inflammation and Repair. In: General Veterinary.

  17. Tong et al., Afr J Tradit Complement Altern Med. (2010) 7(4):331-338

    African Journals Online (AJOL)

    with increased tissue deposition of lanthanum after 28-day oral administration. Kidney Int. 67: 1062-1069. 8.Lao L. (1999). Traditional Chinese Medicine. In Essentials of Complementary and Alternative Medicine. Jonas WB,. Levin JS, Eds. Baltimore, Md., Lippincott Williams and Wilkins: 216-232. 9.Liu JB, Liu JX, Jin SL.

  18. AcEST: BP913076 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ant alignments: (bits) Value sp|P44991|LYXK_HAEIN Probable L-xylulose kinase OS=Haemophilus i... 30 8.1 sp|P51125|ICAL_MOUSE Calpasta...+ N Sbjct: 216 IAGYVTSRAAEQSGLVEGIPVVGGLFDVVSTALCADLKDDQHLN 259 >sp|P51125|ICAL_MOUSE Calpasta

  19. Exploratory Study of Spirituality and Psychosocial Growth in College Students

    Science.gov (United States)

    Reymann, Linda S.; Fialkowski, Geraldine M.; Stewart-Sicking, Joseph A.

    2015-01-01

    This study examined spirituality, personality, and psychosocial growth among 216 students at a small university in Maryland. Results demonstrated that faith maturity predicted unique variance in purpose in life. There was a main effect observed for gender among faith scores, as well as an interaction effect between gender and year in school among…

  20. 78 FR 59859 - Defense Federal Acquisition Regulation Supplement: Allowability of Legal Costs for Whistleblower...

    Science.gov (United States)

    2013-09-30

    ... to the address shown below on or before November 29, 2013, to be considered in the formation of a... consider public comments received in response to this interim rule in the formation of the final rule. List of Subjects in 48 CFR Parts 216 and 252 Government procurement. Manuel Quinones, Editor, Defense...