WorldWideScience

Sample records for astatine 216

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  8. MGT 216 uop Courses/ uophelp

    OpenAIRE

    Uophelp

    2015-01-01

    For more course tutorials visit www.uophelp.com   MGT 216 FINAL EXAM / TEST (use to study) MGT 216 Week 1 Business Ethics Perspective MGT 216 Week 2 Ethical Theories Chart MGT 216 Week 3 Case Study MGT 216 Week 3 Ethical Game Simulation MGT 216 Week 3 Learning Team Assignment Ford Pinto Case Study Review MGT 216 Week 4 Ethical Issues MGT 216 Week 5 Ethical Organization Profile MGT 216 Week 5 Global Business and Ethics MGT 216 Week 1 DQS ...

  9. MGT 216 Courses/Indigohelp

    OpenAIRE

    charles

    2015-01-01

    For more classes visits www.indigohelp.com   MGT 216 FINAL EXAM / TEST (use to study) MGT 216 Week 1 Business Ethics Perspective MGT 216 Week 2 Ethical Theories Chart MGT 216 Week 3 Case Study MGT 216 Week 3 Ethical Game Simulation MGT 216 Week 3 Learning Team Assignment Ford Pinto Case Study Review MGT 216 Week 4 Ethical Issues MGT 216 Week 5 Ethical Organization Profile MGT 216 Week 5 Global Business and Ethics MGT 216 Week 1 DQS MGT ...

  10. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  11. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  13. XMGT 216 courses/snaptutorial

    OpenAIRE

    Paul Marlowe

    2015-01-01

    For more classes visit www.snaptutorial.com   XMGT 216 Week 1 CheckPoint Ethical Theories Chart XMGT 216 Week 1 Discussion Question 1 & 2 XMGT 216 Week 2 CheckPoint Clarifying Personal Values XMGT 216 Week 2 Assignment Business Ethics Reflection XMGT 216 Week 3 CheckPoint Ethics Awareness Inventory XMGT 216 Week 3 Discussion Question 1 & 2 XMGT 216 Week 4 Assignment Ethical Issues and Management Paper XMGT 216 Week 4 CheckPoint Short Case M...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  15. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  16. XMGT 216 Courses Tutorial / indigohelp

    OpenAIRE

    XMISSION

    2015-01-01

    XMGT 216 Week 1 CheckPoint Ethical Theories Chart XMGT 216 Week 1 Discussion Question 1 & 2 XMGT 216 Week 2 CheckPoint Clarifying Personal Values XMGT 216 Week 2 Assignment Business Ethics Reflection XMGT 216 Week 3 CheckPoint Ethics Awareness Inventory XMGT 216 Week 3 Discussion Question 1 & 2 XMGT 216 Week 4 Assignment Ethical Issues and Management Paper XMGT 216 Week 4 CheckPoint Short Case Management XMGT 216 Week 5 CheckPoint Management Case Study ...

  17. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  18. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  19. MGT 216 UOP Course Tutorial / Tutorialoutlet

    OpenAIRE

    karthi

    2015-01-01

    For more course tutorials visit www.tutorialoutlet.com   MGT 216 FINAL EXAM / TEST (use to study) MGT 216 Week 1 Business Ethics Perspective MGT 216 Week 2 Ethical Theories Chart MGT 216 Week 3 Case Study MGT 216 Week 3 Ethical Game Simulation MGT 216 Week 3 Learning Team Assignment Ford Pinto Case Study Review MGT 216 Week 4 Ethical Issues MGT 216 Week 5 Ethical Organization Profile MGT 216 Week 5 Global Business and Ethics MGT 216 Week 1 ...

  20. MGT 216 Course Tutorial/snaptutorial

    OpenAIRE

    roman8006

    2015-01-01

    MGT 216 Entire Course For more classes visit www.snaptutorial.com   MGT 216 FINAL EXAM / TEST (use to study) MGT 216 Week 1 Business Ethics Perspective MGT 216 Week 2 Ethical Theories Chart MGT 216 Week 3 Case Study MGT 216 Week 3 Ethical Game Simulation MGT 216 Week 3 Learning Team Assignment Ford Pinto Case Study Review MGT 216 Week 4 Ethical Issues MGT 216 Week 5 Ethical Organization Profile MGT 216 Week 5 Global Business and Ethics ...

  1. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  2. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  3. XMGT 216 UOP Tutorial/Uoptutorial

    OpenAIRE

    David Lawrence

    2015-01-01

    For more course tutorials visit www.uoptutorial.com     XMGT 216 week 1 CheckPoint Ethical Theories Chart XMGT 216 week 1 Discussion Question 1 & 2 XMGT 216 week 2 CheckPoint Clarifying Personal Values XMGT 216 week 2 Assignment Business Ethics Reflection XMGT 216 week 3 CheckPoint Ethics Awareness Inventory XMGT 216 week 3 Discussion Question 1 & 2 XMGT 216 week 4 Assignment Ethical Issues and Management Paper XMGT 216 week 4 Chec...

  4. XMGT 216 Course tutorial/uophelp

    OpenAIRE

    SXZX

    2015-01-01

    XMGT 216 Entire Course For more course tutorials visit www.uophelp.com     XMGT 216 Week 1 CheckPoint Ethical Theories Chart XMGT 216 Week 1 Discussion Question 1 & 2 XMGT 216 Week 2 CheckPoint Clarifying Personal Values XMGT 216 Week 2 Assignment Business Ethics Reflection XMGT 216 Week 3 CheckPoint Ethics Awareness Inventory XMGT 216 Week 3 Discussion Question 1 & 2 XMGT 216 Week 4 Assignment Ethical Issues and Management Paper ...

  5. XMGT 216 UOP Tutorial Course/Uoptutorial

    OpenAIRE

    anemone221

    2015-01-01

    For More Course Tutorials Visit www.uoptutorial.com     XMGT 216 week 1 CheckPoint Ethical Theories Chart XMGT 216 week 1 Discussion Question 1 & 2 XMGT 216 week 2 CheckPoint Clarifying Personal Values XMGT 216 week 2 Assignment Business Ethics Reflection XMGT 216 week 3 CheckPoint Ethics Awareness Inventory XMGT 216 week 3 Discussion Question 1 & 2 XMGT 216 week 4 Assignment Ethical Issues and Management Paper XMGT 216 week 4 Chec...

  6. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  7. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  8. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  9. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  10. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  11. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  12. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  13. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  14. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  15. 50 CFR 216.42 - Photography. [Reserved

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Photography. 216.42 Section 216.42 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Special Exceptions § 216.42...

  16. 22 CFR 216.8 - Public hearings.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public hearings. 216.8 Section 216.8 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.8 Public hearings. (a) In most instances AID will be able to gain the benefit of public participation in the impact statement...

  17. 12 CFR 741.216 - Flood insurance.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Flood insurance. 741.216 Section 741.216 Banks... INSURANCE Regulations Codified Elsewhere in NCUA's Regulations as Applying to Federal Credit Unions That Also Apply to Federally Insured State-Chartered Credit Unions § 741.216 Flood insurance. Any...

  18. 32 CFR 216.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 216.5 Section 216.5 National... § 216.5 Responsibilities. (a) The PDUSD(P&R), under the Under Secretary of Defense for Personnel and... appropriate preparations to carry out their responsibilities should a covered school be determined...

  19. 50 CFR 216.87 - Wildlife research.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Wildlife research. 216.87 Section 216.87... Pribilof Islands Administration § 216.87 Wildlife research. (a) Wildlife research, other than research on... to the following conditions: (1) Any person or agency, seeking to conduct such research shall...

  20. 29 CFR 500.216 - Substituted service.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Substituted service. 500.216 Section 500.216 Labor... Service § 500.216 Substituted service. (a) Pursuant to section 102(5) of the Act, the Secretary, when so designated by a court, shall accept service of summons in any action arising under the Act or...

  1. 25 CFR 216.8 - Performance bond.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Performance bond. 216.8 Section 216.8 Indians BUREAU OF... RECLAMATION OF LANDS General Provisions § 216.8 Performance bond. (a) Upon approval of an exploration plan or mining plan, the operator shall be required to file a suitable performance bond of not less than...

  2. 48 CFR 216.405 - Cost-reimbursement incentive contracts.

    Science.gov (United States)

    2010-10-01

    ... incentive contracts. 216.405 Section 216.405 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Incentive Contracts 216.405 Cost-reimbursement incentive contracts....

  3. 32 CFR 216.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 216.4 Section 216.4 National Defense... Policy. It is DoD policy that: (a) Under 10 U.S.C. 983, no covered funds may be provided by contract or... Secretary of Defense determines that the covered school: (1) Has a policy or practice (regardless of...

  4. 36 CFR 216.5 - Documentation.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Documentation. 216.5 Section... PUBLIC IN THE FORMULATION OF FOREST SERVICE DIRECTIVES § 216.5 Documentation. The responsible Forest... reasons therefor, in a concise written summary. The summary may be combined with documentation required...

  5. 31 CFR 800.216 - Foreign person.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign person. 800.216 Section 800... TAKEOVERS BY FOREIGN PERSONS Definitions § 800.216 Foreign person. The term foreign person means: (a) Any foreign national, foreign government, or foreign entity; or (b) Any entity over which control is...

  6. 18 CFR 157.216 - Abandonment.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Abandonment. 157.216 Section 157.216 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... firm contract; or (2) A facility that did or could now qualify for automatic authorization as...

  7. 43 CFR 17.216 - Accessibility.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Accessibility. 17.216 Section 17.216 Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION IN FEDERALLY ASSISTED... Accessibility. No handicapped person shall, because a recipient's facilities are inaccessible to or unusable...

  8. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  9. 50 CFR 216.101 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... General Regulations Governing Small Takes of Marine Mammals Incidental to Specified Activities § 216.101... request, the incidental, but not intentional, taking of small numbers of marine mammals by U.S....

  10. 50 CFR 216.102 - Scope.

    Science.gov (United States)

    2010-10-01

    ... General Regulations Governing Small Takes of Marine Mammals Incidental to Specified Activities § 216.102 Scope. The taking of small numbers of marine mammals under section 101(a)(5) (A) through (D) of...

  11. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  12. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  13. Atmospheric Abundances, Trends and Emissions of CFC-216ba, CFC-216ca and HCFC-225ca

    Directory of Open Access Journals (Sweden)

    Corinna Kloss

    2014-06-01

    Full Text Available The first observations of the feedstocks, CFC-216ba (1,2-dichlorohexafluoropropane and CFC-216ca (1,3-dichlorohexafluoropropane, as well as the CFC substitute HCFC-225ca (3,3-dichloro-1,1,1,2,2-pentafluoropropane, are reported in air samples collected between 1978 and 2012 at Cape Grim, Tasmania. Present day (2012 mixing ratios are 37.8 ± 0.08 ppq (parts per quadrillion; 1015 and 20.2 ± 0.3 ppq for CFC-216ba and CFC-216ca, respectively. The abundance of CFC-216ba has been approximately constant for the past 20 years, whilst that of CFC-216ca is increasing, at a current rate of 0.2 ppq/year. Upper tropospheric air samples collected in 2013 suggest a further continuation of this trend. Inferred annual emissions peaked 421 at 0.18 Gg/year (CFC-216ba and 0.05 Gg/year (CFC-216ca in the mid-1980s and then decreased sharply as expected from the Montreal Protocol phase-out schedule for CFCs. The atmospheric trend of CFC-216ca and CFC-216ba translates into continuing emissions of around 0.01 Gg/year in 2011, indicating that significant banks still exist or that they are still being used. HCFC-225ca was not detected in air samples collected before 1992. The highest mixing ratio of 52 ± 1 ppq was observed in 2001. Increasing annual emissions were found in the 1990s (i.e., when HCFC-225ca was being introduced as a replacement for CFCs. Emissions peaked around 1999 at about 1.51 Gg/year. In accordance with the Montreal Protocol, restrictions on HCFC consumption and the short lifetime of HCFC-225ca, mixing ratios declined after 2001 to 23.3 ± 0.7 ppq by 2012.

  14. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  15. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  16. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  17. 20 CFR 498.216 - Witnesses.

    Science.gov (United States)

    2010-04-01

    ... § 498.216 Witnesses. (a) Except as provided in paragraph (b) of this section, testimony at the hearing..., testimony (other than expert testimony) may be admitted in the form of a written statement. Any such written statement must be provided to all other parties along with the last known address of such witness, in...

  18. 50 CFR 216.103 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... General Regulations Governing Small Takes of Marine Mammals Incidental to Specified Activities § 216.103..., adversely affect the species or stock through effects on annual rates of recruitment or survival. Small... place in a specified geographical region and potentially involves the taking of small numbers of...

  19. 22 CFR 216.6 - Environmental assessments.

    Science.gov (United States)

    2010-04-01

    ... Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.6 Environmental... environment so that the expected benefits of development objectives can be weighed against any adverse impacts upon the human environment or any irreversible or irretrievable commitment of resources....

  20. 27 CFR 24.216 - Distilling material.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Distilling material. 24..., DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.216 Distilling material... fruit residues, for use as distilling material, using any quantity of water desired to...

  1. 25 CFR 216.7 - Approval of mining plan.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Approval of mining plan. 216.7 Section 216.7 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS SURFACE EXPLORATION, MINING, AND RECLAMATION OF LANDS General Provisions § 216.7 Approval of mining plan. (a) Before surface mining...

  2. 42 CFR 57.216a - Performance standard.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Performance standard. 57.216a Section 57.216a... Professions Student Loans § 57.216a Performance standard. On June 30, 1984, and on each June 30 thereafter, except as provided in paragraph (b) of this section, each school must have a default rate (as...

  3. 9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious...

  4. 50 CFR 216.83 - Importation of birds or mammals.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Importation of birds or mammals. 216.83 Section 216.83 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... MAMMALS Pribilof Islands Administration § 216.83 Importation of birds or mammals. No mammals or...

  5. 49 CFR 216.27 - Reservation of authority and discretion.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Reservation of authority and discretion. 216.27 Section 216.27 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD..., LOCOMOTIVE AND EQUIPMENT Emergency Order-Track § 216.27 Reservation of authority and discretion. The FRA...

  6. 40 CFR 2.216-2.300 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false 2.216-2.300 Section 2.216-2.300 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information §§ 2.216-2.300...

  7. 10 CFR 216.7 - Conflict in priority orders.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Conflict in priority orders. 216.7 Section 216.7 Energy... DOMESTIC ENERGY SUPPLIES § 216.7 Conflict in priority orders. If it appears that the use of assistance pursuant to DPA section 101(c) creates or threatens to create a conflict with priorities and...

  8. 216-B-3 expansion ponds closure plan

    International Nuclear Information System (INIS)

    This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA

  9. 216-B-3 expansion ponds closure plan

    Energy Technology Data Exchange (ETDEWEB)

    1994-10-01

    This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA.

  10. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  11. 28 CFR 2.216 - Revocation hearing procedure.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Revocation hearing procedure. 2.216 Section 2.216 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT... identity of a confidential informant or result in harm to any person, that information may be withheld...

  12. 47 CFR 36.216 - Uncollectible revenue-Account 5300.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Uncollectible revenue-Account 5300. 36.216..., REVENUES, EXPENSES, TAXES AND RESERVES FOR TELECOMMUNICATIONS COMPANIES 1 Operating Revenues and Certain Income Accounts Operating Revenues § 36.216 Uncollectible revenue—Account 5300. The amounts in...

  13. 50 CFR 216.74 - Cooperation with Federal officials.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Cooperation with Federal officials. 216.74... MAMMALS Pribilof Islands, Taking for Subsistence Purposes § 216.74 Cooperation with Federal officials... subsistence uses must, consistent with 5 CFR 1320.7(k)(3), cooperate with the NMFS representatives on...

  14. 48 CFR 216.104-70 - Research and development.

    Science.gov (United States)

    2010-10-01

    ... Contract Types § 216.104-70 Research and development. Follow the procedures at PGI 216.104-70 for selecting the appropriate research and development contract type. ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Research and...

  15. 50 CFR 216.81 - Visits to fur seal rookeries.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Visits to fur seal rookeries. 216.81... MAMMALS Pribilof Islands Administration § 216.81 Visits to fur seal rookeries. From June 1 to October 15... any fur seal rookery or hauling grounds nor pass beyond any posted sign forbidding passage....

  16. 50 CFR 216.73 - Disposition of fur seal parts.

    Science.gov (United States)

    2010-10-01

    ... 50 CFR 216.23(c) for the purpose of processing, and will be returned directly to the Alaskan Native..., or to an agent registered under 50 CFR 216.23(c) for resale or transfer to an Alaskan Native, who... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Disposition of fur seal parts....

  17. 48 CFR 1652.216-71 - Accounting and Allowable Cost.

    Science.gov (United States)

    2010-10-01

    ... of FEHBP Clauses 1652.216-71 Accounting and Allowable Cost. As prescribed in section 1616.7002, the...). Accounting and Allowable Cost (FEHBAR 1652.216-71) (JAN 2003) (a) Annual Accounting Statements. (1) The... addition, the Carrier must: (i) on request, document and make available accounting support for the cost...

  18. 48 CFR 3052.216-73 - Distribution of award fee.

    Science.gov (United States)

    2010-10-01

    ... of 85 percent of the base fee and potential award fee, the Government may withhold further payment of... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Distribution of award fee. 3052.216-73 Section 3052.216-73 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND...

  19. 50 CFR 216.91 - Dolphin-safe labeling standards.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Dolphin-safe labeling standards. 216.91... MAMMALS Dolphin Safe Tuna Labeling § 216.91 Dolphin-safe labeling standards. (a) It is a violation of... include on the label of those products the term “dolphin-safe” or any other term or symbol that claims...

  20. 27 CFR 40.216 - Notice for smokeless tobacco.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Notice for smokeless tobacco. 40.216 Section 40.216 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE...

  1. 46 CFR 153.216 - Shower and eyewash fountains.

    Science.gov (United States)

    2010-10-01

    ... Vessel Requirements § 153.216 Shower and eyewash fountains. (a) Each non-self-propelled ship must have a fixed or portable shower and eyewash fountain that operates during cargo transfer and meets paragraph (c... 46 Shipping 5 2010-10-01 2010-10-01 false Shower and eyewash fountains. 153.216 Section...

  2. 48 CFR 1852.216-81 - Estimated cost.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Estimated cost. 1852.216-81... Estimated cost. As prescribed in 1816.307-70(d), insert the following clause: Estimated cost (DEC 1988) The total estimated cost for complete performance of this contract is $ . See FAR clause 52.216-11,...

  3. 48 CFR 52.216-5 - Price Redetermination-Prospective.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Price Redetermination-Prospective. 52.216-5 Section 52.216-5 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... of the excess has been applied to the liquidation of progress payments, then that portion...

  4. 48 CFR 52.216-6 - Price Redetermination-Retroactive.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Price Redetermination-Retroactive. 52.216-6 Section 52.216-6 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... of the excess has been applied to the liquidation of progress payments, then that portion...

  5. 36 CFR 2.16 - Horses and pack animals.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Horses and pack animals. 2.16... RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.16 Horses and pack animals. The following are prohibited... equipment. (b) The use of horses or pack animals outside of trails, routes or areas designated for their...

  6. 50 CFR 216.85 - Walrus and Otter Islands.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Walrus and Otter Islands. 216.85 Section... MAMMALS Pribilof Islands Administration § 216.85 Walrus and Otter Islands. By Executive Order 1044, dated February 27, 1909, Walrus and Otter Islands were set aside as bird reservations. All persons are...

  7. Monitoring plan for borehole logging at 216-Z-1A Tile Field, 216-Z-9 Trench, and 216-Z-12 Crib

    International Nuclear Information System (INIS)

    This plan describes the fiscal year 1998 vadose monitoring of three inactive, liquid waste disposal facilities associated with the Plutonium Finishing Plant (Z-Plant): the 216-Z-1A Tile Field, the 216-Z-9 Trench, and the 216-Z-12 Crib. Monitoring will consist of spectral gamma ray logging of 21 boreholes. This plan describes the physical characteristics of the facilities, their operational histories, the subsurface geology and known contamination distribution at each facility. The plan then describes the specific monitoring to be done including the boreholes to be logged, the methods of data acquisition, data reduction, and data evaluation, and finally, the quality control, data management and data reporting for this effort. The three liquid waste disposal facilities at the Z Plant were chosen to be monitored because they were identified as containing some of the most significant sources of radioactive contamination in the Hanford vadose zone. Johnson's analysis was based on the relative hazard obtained by combining curie quantities disposed to the facilities with appropriate health risk standards. The basic question to be addressed by this logging activity addresses the configuration of subsurface contamination since it was last measured. Historical data from the 216-Z-1A Tile Field, the 216-Z-9 Trench, and the 216-Z-12 Crib form the baseline for comparisons to answer this question

  8. Dicty_cDB: CFI216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TGTACCAATTCATAAT CTTATGGAAGATGCTGCTACCGCTGAAATTTCAAGATCTCAAATTTGGCAATGGATTAAA CATAAAGCACCATT Length of 3' end seq. 494 Connect...ed seq. ID CFI216P Connected seq. >CFI216P.Seq ATTTATTTTATTTTAT...ATGGATTAAACATAAAGCACCATT Length of connected seq. 614 Full length Seq ID - Full length Seq. - Length of full length seq. - ... ...ksnfihsiincskf*rdc*iivisrpc*tr*yh*gwl*k*yrc wysis*slvkw*wlctns*sygrccyr*nfkisnlamd*t*sti... 8.0 %: endoplasmic reticulum 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> prediction for CFI216 is

  9. The decay of the neutron-rich nucleus 216Bi

    International Nuclear Information System (INIS)

    The decay of the neutron-rich isotope 216Bi, produced by proton-induced spallation at the PS Booster-ISOLDE facility, was investigated by β-γγ, αγ coincidence and spectrum-multiscaling measurements. A new method for reducing isobaric contamination enabled to cover the unknown region ''east'' of 208Pb for the isobaric chain A=216. The half-life of the β decay of 216Bi was found as T1/2=135±5 s. Its decay scheme was extended and the possible shell model configurations are proposed. (orig.)

  10. 48 CFR 252.216-7001 - Economic price adjustment-nonstandard steel items.

    Science.gov (United States)

    2010-10-01

    ...-nonstandard steel items. 252.216-7001 Section 252.216-7001 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.216-7001 Economic price adjustment—nonstandard steel items. As prescribed in 216.203-4-70(b), use the following clause: Economic Price Adjustment—Nonstandard Steel...

  11. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  12. 12 CFR 216.1 - Purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... CONSUMER FINANCIAL INFORMATION (REGULATION P) § 216.1 Purpose and scope. (a) Purpose. This part governs the... who obtain financial products or services primarily for personal, family, or household purposes...

  13. 18 CFR 367.2160 - Account 216, Unappropriated retained earnings.

    Science.gov (United States)

    2010-04-01

    ... NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2160 Account 216, Unappropriated... ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED...

  14. Soil/sediment characterization for 216-A-29 ditch

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, R.M.

    1997-03-01

    This document provides a detailed description of the environmental samples collected from the 216-A-29 Ditch in 1988. Tables summarizing the laboratory data for radionuclides, metals, and soil chemistry are included.

  15. Dicty_cDB: SLE216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLE216 (Link to dictyBase) - - - Contig-U13024-1 SLE216Z (Link to Original ... 48 AY530539_1( AY530539 |pid:none) Mimulus ringens def iciens (DEF ) mR... 34 4.4 AY524011_1( AY524011 |pid ... :none) Paulownia tomentosa def iciens (DEF ... 33 5.8 protein update 2009. 1.22 PSO ...

  16. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  17. Results of 1998 spectral gamma-ray monitoring of boreholes at the 216-Z-1A tile field, 216-Z-9 trench, and 216-Z-12 crib

    International Nuclear Information System (INIS)

    This document describes the results of fiscal year 1998 vadose zone monitoring of three inactive liquid waste disposal facilities associated with the Plutonium Finishing Plant: the 216-Z-1A tile field, the 216-Z-9 trench, and the 216-Z-12 crib. Monitoring consisted of spectral gamma-ray logging of 21 boreholes. This work was performed by Pacific Northwest National Laboratory in conjunction with Three Rivers Scientific and Waste management Federal Services, inc. Northwest Operations. These three liquid waste disposal facilities were chosen for monitoring because they were identified as containing some of the most significant sources of radioactive contamination in the Hanford Site vadose zone. The basic question addressed by this logging activity is ''Has the configuration of subsurface contamination changed since it was last measured?'' Previous borehole logging and laboratory analyses provide the baseline data to help answer this question

  18. Results of 1998 spectral gamma-ray monitoring of boreholes at the 216-Z-1A tile field, 216-Z-9 trench, and 216-Z-12 crib

    Energy Technology Data Exchange (ETDEWEB)

    Horton, D.G. [Pacific Northwest National Lab., Richland, WA (United States); Randall, R.R. [Three Rivers Scientific, West Richland, WA (United States)

    1998-09-01

    This document describes the results of fiscal year 1998 vadose zone monitoring of three inactive liquid waste disposal facilities associated with the Plutonium Finishing Plant: the 216-Z-1A tile field, the 216-Z-9 trench, and the 216-Z-12 crib. Monitoring consisted of spectral gamma-ray logging of 21 boreholes. This work was performed by Pacific Northwest National Laboratory in conjunction with Three Rivers Scientific and Waste management Federal Services, inc. Northwest Operations. These three liquid waste disposal facilities were chosen for monitoring because they were identified as containing some of the most significant sources of radioactive contamination in the Hanford Site vadose zone. The basic question addressed by this logging activity is ``Has the configuration of subsurface contamination changed since it was last measured?`` Previous borehole logging and laboratory analyses provide the baseline data to help answer this question.

  19. 216-U-10 Pond and 216-Z-19 Ditch characterization studies

    Energy Technology Data Exchange (ETDEWEB)

    Last, G.V.; Duncan, D.W.; Graham, M.J.; Hall, M.D.; Hall, V.W.; Landeen, D.S.; Leitz, J.G.; Mitchell, R.M.

    1994-02-01

    The chemical, reprocessing of spent nuclear fuels at the US Department of Energy`s Hanford Site has generated large volumes of radioactive liquid effluents. The majority of these effluents have been used strictly for cooling or other supportive functions and have been discharged to ditches and ponds. The 216-U-10 Pond and 216-Z-19 Ditch are two such disposal facilities. These facilities are components of an integrated system of ditches, ponds, and overflow facilities collectively referred to as the U-Pond disposal system. The U-Pond system has been used since 1943 and has received a large variety of radioisotopes from several sources. This study covered tho major aspects of the environment, including wind resuspension, biological uptake and transport, geologic distribution in surface and subsurface sediments, and ground-water impacts. The long-term use of U-Pond and the Z-19 Ditch has resulted in the localized accumulation of transuranic and fission product inventories as a result of sorption and filtration of particulates onto the uppermost sediments.

  20. 216-U-10 Pond and 216-Z-19 Ditch characterization studies

    International Nuclear Information System (INIS)

    The chemical, reprocessing of spent nuclear fuels at the US Department of Energy's Hanford Site has generated large volumes of radioactive liquid effluents. The majority of these effluents have been used strictly for cooling or other supportive functions and have been discharged to ditches and ponds. The 216-U-10 Pond and 216-Z-19 Ditch are two such disposal facilities. These facilities are components of an integrated system of ditches, ponds, and overflow facilities collectively referred to as the U-Pond disposal system. The U-Pond system has been used since 1943 and has received a large variety of radioisotopes from several sources. This study covered tho major aspects of the environment, including wind resuspension, biological uptake and transport, geologic distribution in surface and subsurface sediments, and ground-water impacts. The long-term use of U-Pond and the Z-19 Ditch has resulted in the localized accumulation of transuranic and fission product inventories as a result of sorption and filtration of particulates onto the uppermost sediments

  1. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  2. Combination RCRA groundwater monitoring plan for the 216-A-10, 216-A-36B, and 216-A-37-1 PUREX cribs

    Energy Technology Data Exchange (ETDEWEB)

    Lindberg, J.W.

    1997-06-01

    This document presents a groundwater quality assessment monitoring plan, under Resource Conservation and Recovery Act of 1976 (RCRA) regulatory requirements for three RCRA sites in the Hanford Site`s 200 East Area: 216-A-10, 216-A-36B, and 216-A-37-1 cribs (PUREX cribs). The objectives of this monitoring plan are to combine the three facilities into one groundwater quality assessment program and to assess the nature, extent, and rate of contaminant migration from these facilities. A groundwater quality assessment plan is proposed because at least one downgradient well in the existing monitoring well networks has concentrations of groundwater constituents indicating that the facilities have contributed to groundwater contamination. The proposed combined groundwater monitoring well network includes 11 existing near-field wells to monitor contamination in the aquifer in the immediate vicinity of the PUREX cribs. Because groundwater contamination from these cribs is known to have migrated as far away as the 300 Area (more than 25 km from the PUREX cribs), the plan proposes to use results of groundwater analyses from 57 additional wells monitored to meet environmental monitoring requirements of US Department of Energy Order 5400.1 to supplement the near-field data. Assessments of data collected from these wells will help with a future decision of whether additional wells are needed.

  3. Combination RCRA groundwater monitoring plan for the 216-A-10, 216-A-36B, and 216-A-37-1 PUREX cribs

    International Nuclear Information System (INIS)

    This document presents a groundwater quality assessment monitoring plan, under Resource Conservation and Recovery Act of 1976 (RCRA) regulatory requirements for three RCRA sites in the Hanford Site's 200 East Area: 216-A-10, 216-A-36B, and 216-A-37-1 cribs (PUREX cribs). The objectives of this monitoring plan are to combine the three facilities into one groundwater quality assessment program and to assess the nature, extent, and rate of contaminant migration from these facilities. A groundwater quality assessment plan is proposed because at least one downgradient well in the existing monitoring well networks has concentrations of groundwater constituents indicating that the facilities have contributed to groundwater contamination. The proposed combined groundwater monitoring well network includes 11 existing near-field wells to monitor contamination in the aquifer in the immediate vicinity of the PUREX cribs. Because groundwater contamination from these cribs is known to have migrated as far away as the 300 Area (more than 25 km from the PUREX cribs), the plan proposes to use results of groundwater analyses from 57 additional wells monitored to meet environmental monitoring requirements of US Department of Energy Order 5400.1 to supplement the near-field data. Assessments of data collected from these wells will help with a future decision of whether additional wells are needed

  4. 13 CFR 134.216 - Alternative dispute resolution procedures.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Alternative dispute resolution....216 Alternative dispute resolution procedures. At any time during the pendency of a case, the parties may submit a joint motion requesting that the Judge permit the use of alternative dispute...

  5. 48 CFR 1852.216-88 - Performance incentive.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Performance incentive. 1852... 1852.216-88 Performance incentive. As prescribed in 1816.406-70(f), insert the following clause: Performance Incentive (JAN 1997) (a) A performance incentive applies to the following hardware...

  6. 48 CFR 52.216-10 - Incentive Fee.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Incentive Fee. 52.216-10... Incentive Fee. As prescribed in 16.307(d), insert the following clause in solicitations and contracts when a cost-plus-incentive-fee contract (other than a facilities contract) is contemplated: Incentive Fee...

  7. 48 CFR 216.403 - Fixed-price incentive contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Fixed-price incentive... SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Incentive Contracts 216.403 Fixed-price incentive contracts....

  8. 48 CFR 1852.216-83 - Fixed price incentive.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Fixed price incentive. 1852... 1852.216-83 Fixed price incentive. As prescribed in 1816.406-70(c), insert the following clause: Fixed Price Incentive (OCT 1996) The target cost of this contract is $___. The Target profit of this...

  9. Dicty_cDB: CHB216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHB216 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Original site) ... stsl*n*msrrs*m*s**mg*rmlrkdqm**yl*lalskgs*mqdqt*w**mlc ... pfmetktt*ttststnlqikmstrs*mqt**tw*rmlr*ktss**m*pqm ... *erl*m*nqt *wlqmlc qensketml*tkfmcqr*kmcchqrqnhlcktnl**yslssklplhmw**n ...

  10. 31 CFR 31.216 - Communications with Treasury employees.

    Science.gov (United States)

    2010-07-01

    ... employee, except as permitted by Government-Wide Ethics Rules, 5 CFR part 2635. (3) Solicit or obtain from... TROUBLED ASSET RELIEF PROGRAM Conflicts of Interest § 31.216 Communications with Treasury employees. (a... employee with personal or direct responsibility for that procurement. (2) Offer, give, or promise to...

  11. Adsorption gas chromatography with 150-ms 216Po

    International Nuclear Information System (INIS)

    A gas chromatography apparatus was developed, which allows experiments with volatile radionuclides having shorter half-lives than one second. This apparatus was tested with the 150-ms isotope 216Po. Experimental data were compared with a Monte Carlo model to determine the adsorption enthalpy ΔHa. (author) 2 figs., 2 refs

  12. 48 CFR 2452.216-73 - Performance evaluation plan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Performance evaluation plan... 2452.216-73 Performance evaluation plan. As prescribed in 2416.406(e)(3), insert the following clause in all award fee contracts: Performance Evaluation Plan (AUG 1987) (a) The Government...

  13. 48 CFR 3052.216-72 - Performance evaluation plan.

    Science.gov (United States)

    2010-10-01

    ... CONTRACT CLAUSES Text of Provisions and Clauses 3052.216-72 Performance evaluation plan. As prescribed in (HSAR) 48 CFR 3016.406(e)(i)(ii), insert a clause substantially the same as the following: Performance... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Performance...

  14. 48 CFR 1252.216-72 - Performance evaluation plan.

    Science.gov (United States)

    2010-10-01

    ....216-72 Performance evaluation plan. As prescribed in (TAR) 48 CFR 1216.406(b), insert the following clause: Performance Evaluation Plan (OCT 1994) (a) A Performance Evaluation Plan shall be unilaterally... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance...

  15. 48 CFR 2452.216-70 - Estimated cost, base fee and award fee.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Estimated cost, base fee and award fee. 2452.216-70 Section 2452.216-70 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 2452.216-70 Estimated...

  16. 10 CFR 1021.216 - Procurement, financial assistance, and joint ventures.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Procurement, financial assistance, and joint ventures. 1021.216 Section 1021.216 Energy DEPARTMENT OF ENERGY (GENERAL PROVISIONS) NATIONAL ENVIRONMENTAL POLICY ACT IMPLEMENTING PROCEDURES DOE Decisionmaking § 1021.216 Procurement, financial assistance, and joint ventures. (a) This section applies to...

  17. 29 CFR 1910.216 - Mills and calenders in the rubber and plastics industries.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Mills and calenders in the rubber and plastics industries. 1910.216 Section 1910.216 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND... Guarding § 1910.216 Mills and calenders in the rubber and plastics industries. (a) General requirements—...

  18. 50 CFR 660.216 - Fixed gear fishery-observer requirements.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Fixed gear fishery-observer requirements. 660.216 Section 660.216 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC... West Coast Groundfish-Limited Entry Fixed Gear Fisheries § 660.216 Fixed gear...

  19. 12 CFR 216.12 - Limits on sharing account number information for marketing purposes.

    Science.gov (United States)

    2010-01-01

    ... third party for use in telemarketing, direct mail marketing, or other marketing through electronic mail... for marketing purposes. 216.12 Section 216.12 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF... Disclosures § 216.12 Limits on sharing account number information for marketing purposes. (a)...

  20. Satraplatin: BMS 182751, BMY 45594, JM 216.

    Science.gov (United States)

    2007-01-01

    Satraplatin [BMS 182751, BMY 45594, JM 216] belongs to a series of orally-active platinum compounds with anticancer activity. It was jointly originated by Bristol-Myers Squibb, Johnson Matthey and the Institute of Cancer Research in the UK; however, Johnson Matthey has since ceased involvement with drug development. Subsequently, the agent has been licensed to and is under development with GPC Biotech, Pharmion and Spectrum Pharmaceuticals. Clinical trials are underway to evaluate satraplatin among patients with different tumour types, including prostate, breast, cervical and lung cancers. The compound is under regulatory review with the US FDA for the treatment of hormone-refractory prostate cancer. NeoTherapeutics (now Spectrum Pharmaceuticals) granted GPC Biotech an exclusive worldwide licence to develop and market satraplatin in October 2002. Under the terms of the agreement, GPC Biotech is fully funding development costs and commercialisation requirements for the drug. The deal also involves GPC Biotech paying a signing fee, milestone and royalty payments. Spectrum is a member of a joint development committee headed by GPC Biotech to govern development of satraplatin. Previously in October 2001, NeoOncoRx (Spectrum Pharmaceuticals) gained the rights to develop and market the compound worldwide. In December 2005, GPC Biotech and Pharmion Corporation entered into a co-development and license agreement for satraplatin. Under the agreement terms, Pharmion has exclusive commercialisation rights for Europe, Turkey, the Middle East, Australia and New Zealand, while GPC Biotech retains rights to North America and all other territories. Pharmion made an upfront payment of $US37.1 million to GPC Biotech, which included reimbursement for past clinical development costs plus funding for ongoing and certain clinical development activities to be jointly conducted by the companies. In addition, both parties will pursue a joint development plan for satraplatin in a variety of

  1. Nuclear structure of 216Ra at high spin

    International Nuclear Information System (INIS)

    High-spin states of 216Ra (Z = 88, N = 128) have been investigated through 209Bi(10B, 3n) reaction at an incident beam energy of 55 MeV and 209Bi(11B, 4n) reaction at incident beam energies ranging from 65 to 78 MeV. Based on γγ coincidence data, the level scheme for 216Ra has been considerably extended up to ∼ 33 h spin and 7.2 MeV excitation energy in the present experiment with placement of 28 new γ-transitions over what has been reported earlier. Tentative spin-parity assignments are done for the newly proposed levels on the basis of the DCa ratios corresponding to strong gates. Empirical shell model calculations were carried out to provide an understanding of the underlying nuclear structure. (author)

  2. Nuclear structure of 216Ra at high spin

    Indian Academy of Sciences (India)

    S Muralithar; G Rodrigues; R P Singh; R K Bhowmik; P Mukherjee; B Sethi; I Mukherjee

    2012-09-01

    High-spin states of 216Ra ( = 88, = 128) have been investigated through 209Bi(10B, 3n) reaction at an incident beam energy of 55 MeV and 209Bi(11B, 4n) reaction at incident beam energies ranging from 65 to 78 MeV. Based on coincidence data, the level scheme for 216Ra has been considerably extended up to $∼ 33\\hbar$ spin and 7.2 MeV excitation energy in the present experiment with placement of 28 new -transitions over what has been reported earlier. Tentative spin-parity assignments are done for the newly proposed levels on the basis of the DCO ratios corresponding to strong gates. Empirical shell model calculations were carried out to provide an understanding of the underlying nuclear structure.

  3. Existing data on the 216-Z liquid waste sites

    International Nuclear Information System (INIS)

    During 36 years of operation at the Hanford Site, the ground has been used for disposal of liquid and solid transuranic and/or low-level wastes. Liquid waste was disposed in surface and subsurface cribs, trenches, French drains, reverse wells, ditches and ponds. Disposal structures associated with Z Plant received liquid waste from plutonium finishing and reclamation, waste treatment and laboratory operations. The nineteen 216-Z sites have received 83% of the plutonium discharged to 325 liquid waste facilities at the Hanford Site. The purpose of this document is to support the Hanford Defense Waste Environmental Impact Statement by drawing the existing data together for the 216-Z liquid waste disposal sites. This document provides an interim reference while a sitewide Waste Information Data System (WIDS) is developed and put on line. Eventually these and additional site data for all Hanford waste disposal sites will be available on WIDS. Compilation of existing data is the first step in evaluating the need and developing the technology for long-term management of these waste sites. The scope of this document is confined to data describing the status of the 216-Z waste sites as of December 31, 1979. Information and sketches are taken from existing documents and drawings

  4. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  5. Variable stars in the Pegasus dwarf galaxy (DDO 216)

    International Nuclear Information System (INIS)

    Observations obtained over a period of five years of the resolved stars in the Pegasus dwarf irregular galaxy (DDO 216) have been searched for variable stars. Thirty-one variables were found, and periods established for 12. Two of these variable stars are clearly eclipsing variables, seven are very likely Cepheid variables, and the remaining three are probable Cepheids. The period-luminosity relation for the Cepheids indicates a distance modulus for Pegasus of m - M = 26.22 + or - 0.20. This places Pegasus very near the zero-velocity surface of the Local Group. 25 refs

  6. 50 CFR 216.14 - Marine mammals taken before the MMPA.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Marine mammals taken before the MMPA. 216... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Prohibitions § 216.14 Marine mammals taken before the MMPA. (a) Section...

  7. 22 CFR 216.9 - Bilateral and multilateral studies and concise reviews of environmental issues.

    Science.gov (United States)

    2010-04-01

    ... reviews of environmental issues. 216.9 Section 216.9 Foreign Relations AGENCY FOR INTERNATIONAL... environmental issues. Notwithstanding anything to the contrary in these procedures, the Administrator may... United States is a member or participant; or (b) Concise reviews of the environmental issues...

  8. 50 CFR 216.191 - Designation of Offshore Biologically Important Marine Mammal Areas.

    Science.gov (United States)

    2010-10-01

    ...) Detailed information on the biology of marine mammals within the area, including estimated population size... Important Marine Mammal Areas. 216.191 Section 216.191 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE...

  9. 20 CFR 216.23 - Work which does not affect eligibility.

    Science.gov (United States)

    2010-04-01

    ... RETIREMENT ACT ELIGIBILITY FOR AN ANNUITY Railroad and Last Non-Railroad Employment § 216.23 Work which does... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Work which does not affect eligibility. 216... his or her annuity: (a) Work for a railway labor organization. An individual may work for a...

  10. 30 CFR 77.216-5 - Water, sediment or slurry impoundments and impounding structures; abandonment.

    Science.gov (United States)

    2010-07-01

    ..., sediment, or slurry impoundment and impounding structure which meets the requirements of 30 CFR 77.216(a... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Water, sediment or slurry impoundments and... AND SURFACE WORK AREAS OF UNDERGROUND COAL MINES Surface Installations § 77.216-5 Water, sediment...

  11. 12 CFR 216.15 - Other exceptions to notice and opt out requirements.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Other exceptions to notice and opt out requirements. 216.15 Section 216.15 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL..., agencies that are rating you, persons that are assessing your compliance with industry standards, and...

  12. 50 CFR 216.107 - Incidental harassment authorization for Arctic waters.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Incidental harassment authorization for... Incidental to Specified Activities § 216.107 Incidental harassment authorization for Arctic waters. (a... authorized under § 216.105, incidental harassment authorizations may be issued, following a 30-day...

  13. 50 CFR 216.108 - Requirements for monitoring and reporting under incidental harassment authorizations for Arctic...

    Science.gov (United States)

    2010-10-01

    ... under incidental harassment authorizations for Arctic waters. 216.108 Section 216.108 Wildlife and... for monitoring and reporting under incidental harassment authorizations for Arctic waters. (a) Holders of an incidental harassment authorization in Arctic waters and their employees, agents, and...

  14. 50 CFR 216.41 - Permits for scientific research and enhancement.

    Science.gov (United States)

    2010-10-01

    ... under section 117 of the MMPA; (B) Contribute significantly to understanding the basic biology or... enhancement. 216.41 Section 216.41 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE...

  15. 20 CFR 408.216 - Are you a World War II veteran?

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Are you a World War II veteran? 408.216 Section 408.216 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR... line of active duty. SSI Eligibility...

  16. 48 CFR 216.405-1 - Cost-plus-incentive-fee contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-incentive-fee... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Incentive Contracts 216.405-1 Cost-plus-incentive-fee contracts. See PGI 216.405-1 for guidance on the use of...

  17. 20 CFR 216.32 - Who is eligible for a disability annuity.

    Science.gov (United States)

    2010-04-01

    ... retirement age; and (2) Has a current connection with the railroad industry; and has either: (3) Completed 20....32 Section 216.32 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT ELIGIBILITY FOR AN ANNUITY Employee Annuity § 216.32 Who is eligible for a disability...

  18. 20 CFR 216.52 - Who is eligible for an annuity as a divorced spouse.

    Science.gov (United States)

    2010-04-01

    ...) Have attained retirement age; or (e) Have attained age 62 but be under retirement age. The annuity is reduced for each month the spouse is under retirement age at the time the annuity begins. ... spouse. 216.52 Section 216.52 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER...

  19. 50 CFR 216.21 - Actions permitted by international treaty, convention, or agreement.

    Science.gov (United States)

    2010-10-01

    ..., convention, or agreement. 216.21 Section 216.21 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE... international treaty, convention, or agreement. The MMPA and these regulations shall not apply to the extent that they are inconsistent with the provisions of any international treaty, convention or agreement,...

  20. 27 CFR 40.216b - Notice for roll-your-own tobacco.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Notice for roll-your-own tobacco. 40.216b Section 40.216b Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE...

  1. Addiction-Related Effects of DOV 216,303 and Cocaine

    DEFF Research Database (Denmark)

    Sørensen, Gunnar; Husum, Henriette; Brennum, Lise T;

    2014-01-01

    of DOV 216,303, we conducted a comparative study of addiction-related effects of DOV 216,303 and cocaine in mice using acute self-administration, conditioned place preference (CPP) and drug-induced hyperlocomotion. Effects on accumbal extracellular dopamine levels were determined using microdialysis...

  2. 48 CFR 52.216-16 - Incentive Price Revision-Firm Target.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Incentive Price Revision-Firm Target. 52.216-16 Section 52.216-16 Federal Acquisition Regulations System FEDERAL ACQUISITION... liquidation of progress payments, then that portion may, instead of being refunded, be added to...

  3. 48 CFR 52.216-17 - Incentive Price Revision-Successive Targets.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Incentive Price Revision-Successive Targets. 52.216-17 Section 52.216-17 Federal Acquisition Regulations System FEDERAL ACQUISITION... liquidation of progress payments, then that portion may, instead of being refunded, be added to...

  4. 1 CFR 21.6 - Notice of expiration of codified material.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Notice of expiration of codified material. 21.6 Section 21.6 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER PREPARATION, TRANSMITTAL... expiration of codified material. Whenever a codified regulation expires after a specified period by its...

  5. Ataxia and Hypogonadotropic Hypogonadism with Intrafamilial Variability Caused by RNF216 Mutation.

    Science.gov (United States)

    Alqwaifly, Mohammed; Bohlega, Saeed

    2016-06-15

    Gordon Holmes syndrome (GHS) is a distinct phenotype of autosomal recessive cerebellar ataxia, characterized by ataxia, dementia, reproductive defects and hypogonadism; it has been recently found to be associated with RNF216 mutation. We performed whole-exome sequencing and filtered the resulting novel variants by the coordinates of the shared autozygome. We identified a novel splicing variant in RNF216 that is likely to abolish the canonical splice site at the junction of exon/intron 13 (NM_207111.3:c.2061G>A). We herein report two patients with GHS caused by a novel RNF216 mutation as the first follow up report on RNF216-related GHS, and show interfamilial variability of phenotype supporting the previously reported RNF216-related cases. PMID:27441066

  6. 32 CFR 724.216 - Failure to appear at a hearing or respond to a scheduling notice.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Failure to appear at a hearing or respond to a scheduling notice. 724.216 Section 724.216 National Defense Department of Defense (Continued) DEPARTMENT OF... § 724.216 Failure to appear at a hearing or respond to a scheduling notice. (a) Except as...

  7. 40 CFR 80.216 - What standards apply to gasoline produced or imported for use in the GPA?

    Science.gov (United States)

    2010-07-01

    ... produced or imported for use in the GPA? 80.216 Section 80.216 Protection of Environment ENVIRONMENTAL... Geographic Phase-in Program § 80.216 What standards apply to gasoline produced or imported for use in the GPA... in the geographic phase-in area under § 80.215, and designated as GPA gasoline under §...

  8. Mani (216–276 CE and Ethiopian Enoch

    Directory of Open Access Journals (Sweden)

    Pieter M. Venter

    2014-02-01

    Full Text Available Mani (216–276 CE lived in a world where many ideas contributed to his unique theology. In the scriptural legacy of Mani seven of his books show influence of Ethiopian Enoch. These books are identified in this article and the use of Enochic material in those books is discussed. The Manichaean myth is briefly discussed and used to propose that Enochic influence can mainly be found in the way First Enoch depicted characters and presented the cosmos. Mani adopted his ideas mainly from the Book of the Watchers (1 En 1–36, the Book of Parables (1 En 37–71 and the Astronomical Book of Enoch (72–82 where evil beings and cursed places are depicted.

  9. Groundwater impact assessment report for the 216-U-14 Ditch

    Energy Technology Data Exchange (ETDEWEB)

    Singleton, K.M.; Lindsey, K.A.

    1994-01-01

    Groundwater impact assessments are conducted at liquid effluent receiving sites on the Hanford Site to determine hydrologic and contaminant impacts caused by discharging wastewater to the soil column. The assessments conducted are pursuant to the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-17-00A and M-17-00B, as agreed by the US Department of Energy (DOE), Washington State Department of Ecology (Ecology), and the US Environmental Protection Agency (EPA) (Ecology et al. 1992). This report assesses impacts on the groundwater and vadose zone from wastewater discharged to the 216-U-14 Ditch. Contemporary effluent waste streams of interest are 242-S Evaporator Steam Condensate and UO{sub 3}/U Plant wastewater.

  10. State Environmental Policy Act (SEPA) Environmental Checklist Form 216-B-3 Expansion Ponds Closure Plan

    International Nuclear Information System (INIS)

    The 216-B-3 Expansion Ponds Closure Plan (Revision 1) consists of a Part A Dangerous Waste Permit Application and a Resource Conservation and Recovery Act Closure Plan. An explanation of the Part A submitted with this document is provided at the beginning of the Part A Section. The closure plan consists of nine chapters and five appendices. The 216-B-3 Pond System consists of a series of four earthen, unlined, interconnected ponds and the 216-B-3-3 Ditch that receive waste water from various 200 East Area operating facilities. These four ponds, collectively. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the 216-B-3-3 Ditch. Water discharged to the 216-8-3-3 Ditch flows directly into the 216-B-3 Pond. In the past, waste water discharges to B Pond and the 216-B-3-3 Ditch contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the nonradioactive dangerous portion of mixed waste is regulated under RCRA. Mixed waste also may be considered a hazardous substance under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) when considering remediation of waste sites

  11. 40 CFR 90.903 - Exclusions, application of section 216 (10) and (11) of the Act.

    Science.gov (United States)

    2010-07-01

    ... section 216(10) of the Act, an internal combustion engine (including the fuel system) that is not used in a motor vehicle is deemed a nonroad engine, if it meets the definition in subpart A of this...

  12. 40 CFR 89.903 - Application of section 216(10) of the Act.

    Science.gov (United States)

    2010-07-01

    ... the applicability of section 216(10) of the Act, an internal combustion engine (including the fuel system) that is not used in a motor vehicle is deemed a nonroad engine if it meets the definition...

  13. Decay of high angular momentum isomers: 149Dy and 216Ra nuclei

    International Nuclear Information System (INIS)

    Some general considerations on the forming and de-excitation of high angular momentum nuclei are given. The experimental equipment employed is then described and analyzed. Discrete high angular momentum states of 149Dy83 and 216Ra128 were investigated. Measurements of excitation functions induced by 9Be beams enable the order of the levels beneath the isomer to be determined. Isomeric states were studied using a pulsed 32S beam. Discrete 216Ra transitions above the isomeric state were also studied

  14. Detection and Functional Analysis of Estrogen Receptor α Phosphorylated at Serine 216 in Mouse Neutrophils.

    Science.gov (United States)

    Shindo, Sawako; Moore, Rick; Negishi, Masahiko

    2016-01-01

    Serine 216 constitutes a protein kinase C phosphorylation motif located within the DNA binding domain of estrogen receptor α (ERα). In this chapter we present experimental procedures confirming that mouse ERα is phosphorylated at serine 216 in peripheral blood neutrophils and in neutrophils that infiltrate the uterus, as well as the role of phosphoserine 216 in neutrophil migration. A phospho-peptide antibody (αP-S216) was utilized in Western blot, immunohistochemistry, and double immunofluorescence staining to detect this phosphorylation of an endogenous ERα. Both immunohistochemistry (with αP-S216 or neutrophil marker Ly6G antibody) and double immunofluorescence staining of mouse uterine sections prepared from C3H/HeNCrIBR females revealed that phosphorylated ERα was expressed in all infiltrating neutrophils during hormonal cycles but not in any other of the other uterine cells. Neutrophils infiltrate the uterus from the blood stream. White blood cells (WBC) were prepared from peripheral blood of C3H/HeNCrIBR females or males and double immunostained. Blood neutrophils also expressed phosphorylated ERα but in only about 20 % of cells in both sexes. Only the neutrophils expressing phosphorylated ERα spontaneously migrated in in vitro Transwell migration assays and infiltrated the uterus in mice. PMID:26585153

  15. Plutonium Mobility Studies: 216-Z-9 Trench Sample Analysis Results

    Energy Technology Data Exchange (ETDEWEB)

    Cantrell, Kirk J.; Geiszler, Keith N.; Arey, Bruce W.

    2008-09-05

    A variety of analyses were conducted on selected sediment samples collected from two wells (299 W15-46 and 299-W15-48) drilled near the 216-Z-9 Trench to elucidate the form and potential for Pu and Am to be mobilized under present conditions and those that could be expected in future remediation scenarios. Analyses included moisture content, determination of the less than sand size fraction (silt plus clay), carbon analysis, SEM/EDS analysis, microwave-assisted acid digestions for total element analysis, and extraction tests using Hanford groundwater as the leachate. Results of the extraction tests were used as input to conduct equilibrium geochemical modeling of the solutions with Geochemist’s Workbench®. Geochemical modeling results for Pu were evaluated in terms of recent conclusions regarding the solubility and redox reactions of Pu by Neck et al. (2007a, 2007b). It was found that the highest concentrations of Pu and Am were associated with sediments of low silt/clay content and occur above silt/clay rich layers within the sediment profile. It was also found that the Pu and Am were relatively enriched in the silt/clay portion of these samples. The fact that the highest concentrations of Pu and Am occurred in sediments with low silt/clay contents suggests that waste solutions had perched on top of the low permeability silt/clay rich layers and interactions with the high silt/clay layers was minimal. SEM/EDS analysis indicated that the Pu and Am in these sediments does not occur as discrete micron size particles, and therefore must occur as mononuclear or polynuclear/ nanoclusters size particles adsorbed throughout the sediment samples. Leaching of these samples with Hanford groundwater indicates that release of Pu and Am from the sediments is correlated most significantly with the acidity of the water and not the initial concentrations of Pu and Am in the sediments. Only extracts that were acidic after contact with the sediments (pH 4.3 to 5.4) contained

  16. Interim-status groundwater monitoring plan for the 216-B-63 trench. Revision 1

    International Nuclear Information System (INIS)

    This document outlines the groundwater monitoring plan for interim-status detection-level monitoring of the 216-B-63 Trench. This is a revision of the initial groundwater monitoring plan prepared for Westinghouse Hanford Company (WHC) by Bjornstad and Dudziak (1989). The 216-B-63 Trench, located at the Hanford Site in south-central Washington State, is an open, unlined, earthern trench approximately 1.2 m (4 ft) wide at the bottom, 427 m (1400 ft) long, and 3 m (10 ft) deep that received wastewater containing hazardous waste and radioactive materials from B Plant, located in the 200 East Area. Liquid effluent discharge to the 216-B-63 Trench began in March 1970 and ceased in February 1992. The trench is now managed by Waste Tank Operations

  17. Groundwater impact assessment report for the 216-S-26 Crib, 200 West Area

    International Nuclear Information System (INIS)

    This report assesses the impact of wastewater discharged to the 216-S-26 Crib on groundwater quality. The 216-S-26 Crib, located in the southern 200 West Area, has been in use since 1984 to dispose of liquid effluents from the 222-S Laboratory Complex. The 222-S Laboratory Complex effluent stream includes wastewater from four sources: the 222-S Laboratory, the 219-S Waste Storage Facility, the 222-SA Chemical Standards Laboratory, and the 291-S Exhaust Fan Control House and Stack. Based on assessment of groundwater chemistry and flow data, contaminant transport predictions, and groundwater chemistry data, the 216-S-26 Crib has minimal influence on groundwater contamination in the southern 200 West Area

  18. Groundwater impact assessment report for the 216-S-26 Crib, 200 West Area

    Energy Technology Data Exchange (ETDEWEB)

    Lindberg, J.W.; Evelo, S.D.; Alexander, D.J.

    1993-11-01

    This report assesses the impact of wastewater discharged to the 216-S-26 Crib on groundwater quality. The 216-S-26 Crib, located in the southern 200 West Area, has been in use since 1984 to dispose of liquid effluents from the 222-S Laboratory Complex. The 222-S Laboratory Complex effluent stream includes wastewater from four sources: the 222-S Laboratory, the 219-S Waste Storage Facility, the 222-SA Chemical Standards Laboratory, and the 291-S Exhaust Fan Control House and Stack. Based on assessment of groundwater chemistry and flow data, contaminant transport predictions, and groundwater chemistry data, the 216-S-26 Crib has minimal influence on groundwater contamination in the southern 200 West Area.

  19. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  20. 50 CFR 216.16 - Prohibitions under the General Authorization for Level B harassment for scientific research.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Prohibitions under the General Authorization for Level B harassment for scientific research. 216.16 Section 216.16 Wildlife and Fisheries... Prohibitions under the General Authorization for Level B harassment for scientific research. It shall...

  1. 50 CFR 216.46 - U.S. citizens on foreign flag vessels operating under the International Dolphin Conservation...

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false U.S. citizens on foreign flag vessels operating under the International Dolphin Conservation Program. 216.46 Section 216.46 Wildlife and Fisheries....46 U.S. citizens on foreign flag vessels operating under the International Dolphin...

  2. Addiction-related effects of DOV 216,303 and cocaine: A comparative study in the mouse.

    Science.gov (United States)

    Sørensen, Gunnar; Husum, Henriette; Brennum, Lise T; Bundgaard, Christoffer; Montezinho, Liliana C P; Mørk, Arne; Wörtwein, Gitta; Woldbye, David P D

    2014-06-01

    DOV 216,303, an inhibitor of serotonin, noradrenaline and dopamine reuptake, belongs to a new line of drugs called 'triple reuptake inhibitors' that have been proposed for treatment of depression. The addictive drug cocaine has similar mechanism of action and exerts rewarding effects by blocking reuptake of dopamine, leading to increased extracellular concentrations of dopamine in the nucleus accumbens. Thus, DOV 216,303 and other triple reuptake inhibitors might be speculated to exhibit abuse potential, limiting their future therapeutic use. To further elucidate potential addictive properties of DOV 216,303, we conducted a comparative study of addiction-related effects of DOV 216,303 and cocaine in mice using acute self-administration, conditioned place preference (CPP) and drug-induced hyperlocomotion. Effects on accumbal extracellular dopamine levels were determined using microdialysis, and we measured monoamine receptor occupancy as well as brain and plasma exposure. DOV 216,303 was self-administered acutely in the same dose range as cocaine. However, in the CPP model, DOV 216,303 did not induce place preference at doses where cocaine caused place preference. Higher doses of DOV 216,303 than cocaine were needed to induce hyperlocomotion and increase extracellular accumbal dopamine with effective doses being higher than effective doses used in depression models. Moreover, DOV 216,303 displayed a pharmacokinetic profile with lower potential for addiction than cocaine. Thus, high levels of DAT occupancy were reached slower and decayed more slowly after DOV 216,303 than cocaine administration. The present study shows that acute administration of DOV 216,303 displays some addictive-like properties in mice, but these were less pronounced than cocaine, most likely due to different pharmacokinetic profiles. PMID:24314270

  3. 50 CFR 216.25 - Exempted marine mammals and marine mammal products.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Exempted marine mammals and marine mammal... AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS General Exceptions § 216.25 Exempted marine mammals and marine...

  4. 20 CFR 216.22 - Work as an employee which affects payment.

    Science.gov (United States)

    2010-04-01

    ... RETIREMENT ACT ELIGIBILITY FOR AN ANNUITY Railroad and Last Non-Railroad Employment § 216.22 Work as an employee which affects payment. (a) Work for a railroad employer. Work for pay as an employee of a railroad... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Work as an employee which affects...

  5. 20 CFR 216.24 - Relinquishment of rights to return to work.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relinquishment of rights to return to work... RETIREMENT ACT ELIGIBILITY FOR AN ANNUITY Railroad and Last Non-Railroad Employment § 216.24 Relinquishment of rights to return to work. (a) What return to work rights must be given up. Before an...

  6. 30 CFR 77.216-4 - Water, sediment or slurry impoundments and impounding structures; reporting requirements...

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Water, sediment or slurry impoundments and....216-4 Water, sediment or slurry impoundments and impounding structures; reporting requirements... of the initial plan approval, the person owning, operating, or controlling a water, sediment,...

  7. 30 CFR 77.216-1 - Water, sediment or slurry impoundments and impounding structures; identification.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Water, sediment or slurry impoundments and... AND SURFACE WORK AREAS OF UNDERGROUND COAL MINES Surface Installations § 77.216-1 Water, sediment or..., operating, or controlling the structure, shall be located on or immediately adjacent to each water,...

  8. 30 CFR 77.216-3 - Water, sediment, or slurry impoundments and impounding structures; inspection requirements...

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Water, sediment, or slurry impoundments and... COAL MINES Surface Installations § 77.216-3 Water, sediment, or slurry impoundments and impounding structures; inspection requirements; correction of hazards; program requirements. (a) All water, sediment,...

  9. 30 CFR 77.216 - Water, sediment, or slurry impoundments and impounding structures; general.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Water, sediment, or slurry impoundments and... WORK AREAS OF UNDERGROUND COAL MINES Surface Installations § 77.216 Water, sediment, or slurry... structures which impound water, sediment, or slurry shall be required if such an existing or...

  10. 50 CFR 216.45 - General Authorization for Level B harassment for scientific research.

    Science.gov (United States)

    2010-10-01

    ...) of the ESA and implementing regulations at 50 CFR parts 217-227, particularly at § 222.23 through... et seq.) and implementing regulations (50 CFR part 216), I hereby notify the National Marine... is subject to the requirements of 15 CFR part 904....

  11. Interim-status groundwater monitoring plan for the 216-B-63 trench

    Energy Technology Data Exchange (ETDEWEB)

    Sweeney, M.D.

    1995-02-09

    This document outlines the groundwater monitoring plan, under RCRA regulations in 40 CFR 265 Subpart F and WAC173-300-400, for the 216-B-63 Trench. This interim status facility is being sampled under detection monitoring criteria and this plan provides current program conditions and requirements.

  12. 50 CFR 216.200 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    ... of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.200 Specified activity and... and pipeline construction, vessel and helicopter activity; and oil production activities, including ice road construction, and vessel and helicopter activity, but excluding seismic operations....

  13. Yeast Interacting Proteins Database: YBR216C, YML007W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YBR216C YBP1 Protein required for oxidation of specific cysteine residues of the transcription f ... n the nuclear localization of Yap1p in response to stress ... Rows with this bait as bait (1) Rows with this bai ... (bZIP) transcription factor required for oxidative stress ... tolerance; activated by H2O2 through the multistep ...

  14. 12 CFR 216.4 - Initial privacy notice to consumers required.

    Science.gov (United States)

    2010-01-01

    ... consumer's loan. (d) Existing customers. When an existing customer obtains a new financial product or... SYSTEM PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Privacy and Opt Out Notices § 216.4... provided in paragraph (e) of this section; and (2) Consumer. A consumer, before you disclose any...

  15. 50 CFR 216.95 - Official mark for “Dolphin-safe” tuna products.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Official mark for âDolphin-safeâ tuna... AND IMPORTING OF MARINE MAMMALS Dolphin Safe Tuna Labeling § 216.95 Official mark for “Dolphin-safe... Department of Commerce that may be used to label tuna products that meet the “dolphin-safe” standards...

  16. 48 CFR 1352.216-71 - Level of effort (cost-plus-fixed-fee, term contract).

    Science.gov (United States)

    2010-10-01

    ... Clauses 1352.216-71 Level of effort (cost-plus-fixed-fee, term contract). As prescribed in 48 CFR 1316.307... Optionperiod II Optionperiod III xxxxxxxxxx xxxx xxxx xxxx xxxx xxxxxxxxxx xxxx xxxx xxxx xxxx Total Direct Labor xxxx xxxx xxxx xxxx (c) The hours specified above are provided as estimates......

  17. Groundwater impact assessment for the 216-U-17 Crib, 200 West Area

    International Nuclear Information System (INIS)

    As required by the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement milestone M-17-00A), this report assesses the impact to groundwater from discharge of process condensate to the ground at the 216-U-17 Crib. The assessment considers impacts associated with moisture movement through soil beneath the crib and the potential transport of contaminants to the groundwater

  18. 76 FR 27987 - Foreign-Trade Zone 216-Olympia, Washington; Application for Reorganization Under Alternative Site...

    Science.gov (United States)

    2011-05-13

    ... zone under the alternative site framework (ASF) adopted by the Board (74 FR 1170, 1/12/09 (correction 74 FR 3987, 1/22/09); 75 FR 71069-71070, 11/22/10). The ASF is an option for grantees for the..., 2011. FTZ 216 was approved by the Board on August 16, 1996 (Board Order 836, 61 FR 45408,...

  19. 48 CFR 1852.216-84 - Estimated cost and incentive fee.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Estimated cost and... Provisions and Clauses 1852.216-84 Estimated cost and incentive fee. As prescribed in 1816.406-70(d), insert the following clause: Estimated Cost and Incentive Fee (OCT 1996) The target cost of this contract...

  20. 48 CFR 2452.216-77 - Estimated quantities-requirements contract.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Estimated quantities... Provisions and Clauses 2452.216-77 Estimated quantities—requirements contract. As prescribed in 2416.506-70(c), insert the following provision: Estimated Quantities—Requirements Contract (FEB 2006) In accordance...

  1. 48 CFR 1552.216-76 - Estimated cost and cost-sharing.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Estimated cost and cost... 1552.216-76 Estimated cost and cost-sharing. As prescribed in 1516.307(c), insert the following clause: Estimated Cost and Cost-Sharing (APR 1996) (a) The total estimated cost of performing the work under...

  2. 48 CFR 1852.216-85 - Estimated cost and award fee.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Estimated cost and award... and Clauses 1852.216-85 Estimated cost and award fee. As prescribed in 1816.406-70(e), insert the following clause: Estimated Cost and Award Fee (SEP 1993) The estimated cost of this contract is $___....

  3. 48 CFR 1852.216-73 - Estimated cost and cost sharing.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Estimated cost and cost... and Clauses 1852.216-73 Estimated cost and cost sharing. As prescribed in 1816.307-70(a), insert the following clause: Estimated Cost and Cost Sharing (DEC 1991) (a) It is estimated that the total cost...

  4. 48 CFR 1852.216-74 - Estimated cost and fixed fee.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Estimated cost and fixed... and Clauses 1852.216-74 Estimated cost and fixed fee. As prescribed in 1816.307-70(b), insert the following clause: Estimated Cost and Fixed Fee (DEC 1991) The estimated cost of this contract...

  5. Regulation of the P2X7R by microRNA-216b in human breast cancer

    International Nuclear Information System (INIS)

    Highlights: • We suggest the expression level of miR-216b and P2X7R in breast cancer tissues and cell lines. • We demonstrated that miR-216b directly targets and inhibits P2X7R. • We suggested miR-216b can attenuate ATP/P2X7R signaling pathways and induced Bcl-2/caspase-3 pathway. - Abstract: Breast cancer is the most common cancer in women around the world. However, the molecular mechanisms underlying breast cancer pathogenesis are only partially understood. Here, in this study, we found that P2X7R was up-regulated and miR-216b was down-regulated in breast cancer cell lines and tissues. Using bioinformatic analysis and 3′UTR luciferase reporter assay, we determined P2X7R can be directly targeted by miR-216b, which can down-regulate endogenous P2X7R mRNA and protein levels. Ectopic expression of miR-216b mimics leads to inhibited cell growth and apoptosis, while blocking expression of the miR-216b results in increased cell proliferation. Furthermore, our findings demonstrate that knockdown of P2X7R promotes apoptosis in breast cancer cells through down-regulating Bcl-2 and increasing the cleavage caspase-3 protein level. Finally, we confirmed that down-regulation of miR-216b in breast cancer is inversely associated with P2X7R expression level. Together, these findings establish miR-216b as a novel regulator of P2X7R and a potential therapeutic target for breast cancer

  6. 216例合并HIV/AIDS患者围手术期的心理护理

    Institute of Scientific and Technical Information of China (English)

    韦庆旭

    2014-01-01

    目的:通过对216例合并HIV/AIDS患者围手术期的心理护理,探讨合并HIV/AIDS患者围手术期的心理护理方法。方法:对216例合并HIV/AIDS患者进行术前、术中、术后心理护理和随访。结果通过对216例合并HIV/AIDS患者的心理护理,减轻了心理负担疗效果好,达满意。

  7. Borehole Summary Report for the 216-B-2-2 Ditch

    International Nuclear Information System (INIS)

    The purpose of this borehole summary report is to provide the results of the drilling and sampling as a data package. The 216-B-2-2 Ditch borehole data will be evaluated with other existing data during remedial investigation/feasibility study (RI/FS) work plan development for the Gable Mountain Pond/B-Pond and Ditches Cooling Water Group (200-CW-1 ). Additional characterization needs for the ditch, as well as for the 200-CW-1 Waste Group in general, will be defined in an RI/FS work plan for the 200-CW-1 Waste Group planned for preparation in fiscal year 1999. After characterization activities have been completed for the waste group, the information (including the 216-B-2-2 borehole data) will be collectively evaluated and documented in a remedial investigation report

  8. Features of thin spatial structure of the quasar 3C216 at decameter lengths of waves

    Science.gov (United States)

    Megn, A. V.; Rashkovskiy, S. L.; Shepelev, V. A.; Inytin, G. A.; Vashchishin, R. V.; Brazhenko, A. I.; Koshoviy, V. V.; Lozinskiy, A. B.

    2010-01-01

    The results of interferometric researches of the quasar 3C216 have been presented. The model of brightness distribution of the quasar at frequencies of 20 and 25 MHz and spectra of its details at frequencies below 1 GHz have been refined. It was found out, that at decameter lengths the radio image of 3C216 has three components. It consists of a compact component having the size limited by scattering, an extended component with the size of 4.5'' and a halo with the size about 23''. The northeast hot spot (instead of the core, as it was supposed earlier) is the dominating compact component at decameter waves. The self-absorption effect in the northeast hot spot has been detected.

  9. 77 FR 29682 - Gulf of Mexico, Outer Continental Shelf, Central Planning Area, Oil and Gas Lease Sale 216/222

    Science.gov (United States)

    2012-05-18

    ... Availability (NOA) of a Record of Decision (ROD) on a Final Supplemental Environmental Impact Statement (SEIS... Area (CPA) Lease Sale 216/222 Authority: This NOA is published pursuant to the regulations (40 CFR...

  10. H_2^{16}O and H_2^{18}O Maser Emission from Gas-Dust Clouds

    CERN Document Server

    Nesterenok, Aleksandr; 10.1134/S1063773711070036

    2011-01-01

    The collisional pumping of H_2^{16}O and H_2^{18}O masers in hot dense gas-dust clouds has been simulated numerically. New data on the rate coefficients for collisional transitions from Faure et al. (2007) were used in the calculations. The possibility of detecting H_2^{18}O emission in 22.2-GHz H_2^{16}O maser sources is investigated. The medium is shown to become optically thick in the H_2^{16}O lines for which an inverted level population is observed at H_2O column densities of ~10^{19}-10^{20} cm^{-2}. A simultaneous observation of H_2^{18}O emission and H_2^{16}O maser emission in the same source will allow the physical conditions in the gas-dust cloud to be refined.

  11. Borehole Data Package for 216-U-12 Crib Well 299-W22-79

    International Nuclear Information System (INIS)

    One new Resource Conservation and Recovery Act (RCRA) groundwater monitoring well was installed at the 216-U-12 crib in September 1998 in support of Tri-Parly Agreement (Ecology 1996) milestone M-24-36. The new well is 299-W22-79 and is a downgradient well in the groundwater monitoring network. There are a total of six wells in the groundwater monitoring network for the 216-U-12 crib and their locations are shown on Figure 1. The groundwater assessment monitoring plan for the 216-U-12 crib (Chou and Williams 1993) describes the hydrogeology of the 200 West Area and the 216-U-12 crib area. An Interim Change Notice to the assessment plan provides justification for the well (Chou and Williams 1997). The new well was constructed to the specifications and requirements described in Washington Administrative Code (WAC) 173-160, and WAC-173-303, and in Chou and Williams (1997). This document compiles information on the drilling and construction, well development and permanent pump installation applicable to well 299-W22-79. Appendix A contains the geologist's log, the Well Construction Summary Report, and Well Summary Sheet (as-built diagram). Additional documentation concerning well construction is on file with Bechtel Hanford, Inc., Richland, Washington. English units are used in this report because they are used by drillers to measure and report depths and well construction details. The conversion is made by multiplying feet by 0.3048 to obtain meters; or multiplying inches by 2.54 to obtain centimeters

  12. The synthesis of 191Pt labelled JM216, an orally active platinum anti-tumour agent

    International Nuclear Information System (INIS)

    The orally active platinum anti-tumour complex JM 216 [bis-acetatoamminedichloro cyclohexylamineplatinum (IV)] is at present in stage II clinical trials. A procedure for synthesising the complex labelled with 191Pt or 188Pt at the platinum centre has been developed. The purity (shown by HPLC) is 98% and the specific activity (0.3-0.4 Ci/kg) is enough for in vivo and in vitro studies. (author)

  13. DDO216-A1: a central globular cluster in a low-luminosity transition type galaxy

    CERN Document Server

    Cole, Andrew A; Skillman, Evan D; Williams, Benjamin F; Dolphin, Andrew E; Johnson, L Clifton; McConnachie, Alan W; Boylan-Kolchin, Michael; Dalcanton, Julianne; Governato, Fabio; Madau, Piero; Shen, Sijing; Vogelsberger, Mark

    2016-01-01

    We confirm that the object DDO216-A1 is a substantial globular cluster at the center of Local Group galaxy DDO216 (the Pegasus dwarf irregular), using Hubble Space Telescope ACS imaging. By fitting isochrones, we find the cluster metallicity to be -1.6 +/-0.2, for reddening E(B-V) = 0.16 +/-0.02; the best-fit age is 12.3 +/-0.8 Gyr. There are ~30 RR Lyrae variables in the cluster; the magnitude of the fundamental mode pulsators gives a distance modulus of 24.77 +/-0.08 - identical to the host galaxy. The ratio of overtone to fundamental mode variables and their mean periods make DDO216-A1 an Oosterhoff Type I cluster. We find an I-band central surface brightness 20.85 +/-0.17 F814W mag per square arcsecond, half-light radius of 3.1 arcsec (13.4 pc), and absolute magnitude M814 = -7.90 +/-0.16 (approximately 10^5 solar masses). King models fit to the cluster give the core radius and concentration index, r_c = 2.1" +/-0.9" and c = 1.24 +/-0.39. The cluster is an "extended" cluster somewhat typical of some dwarf...

  14. φX216, a P2-like bacteriophage with broad Burkholderia pseudomallei and B. mallei strain infectivity

    Directory of Open Access Journals (Sweden)

    Kvitko Brian H

    2012-12-01

    Full Text Available Abstract Background Burkholderia pseudomallei and B. mallei are closely related Category B Select Agents of bioterrorism and the causative agents of the diseases melioidosis and glanders, respectively. Rapid phage-based diagnostic tools would greatly benefit early recognition and treatment of these diseases. There is extensive strain-to-strain variation in B. pseudomallei genome content due in part to the presence or absence of integrated prophages. Several phages have previously been isolated from B. pseudomallei lysogens, for example φK96243, φ1026b and φ52237. Results We have isolated a P2-like bacteriophage, φX216, which infects 78% of all B. pseudomallei strains tested. φX216 also infects B. mallei, but not other Burkholderia species, including the closely related B. thailandensis and B. oklahomensis. The nature of the φX216 host receptor remains unclear but evidence indicates that in B. mallei φX216 uses lipopolysaccharide O-antigen but a different receptor in B. pseudomallei. The 37,637 bp genome of φX216 encodes 47 predicted open reading frames and shares 99.8% pairwise identity and an identical strain host range with bacteriophage φ52237. Closely related P2-like prophages appear to be widely distributed among B. pseudomallei strains but both φX216 and φ52237 readily infect prophage carrying strains. Conclusions The broad strain infectivity and high specificity for B. pseudomallei and B. mallei indicate that φX216 will provide a good platform for the development of phage-based diagnostics for these bacteria.

  15. Global modeling of the 15N216O line positions within the framework of the polyad model of effective Hamiltonian and a room temperature 15N216O line list

    Science.gov (United States)

    Tashkun, S. A.; Perevalov, V. I.; Liu, A.-W.; Hu, S.-M.

    2016-05-01

    The global modeling of 15N216O line positions in the 4-12,516 cm-1 region has been performed using the polyad model of effective Hamiltonian. The effective Hamiltonian parameters were fitted to the line positions collected from an exhaustive review of the literature. The dimensionless weighted standard deviation of the fit is 1.31. The fitted set of 109 parameters allowed reproducing more than 18,000 measured line positions with an RMS value of 0.001 cm-1. A line list was calculated for a reference temperature 296 K, natural abundance (1.32×10-5), and an intensity cutoff 10-30 cm/molecule. The line list is based on the fitted set of the effective Hamiltonian parameters for 15N216O obtained in this work and the effective dipole moment parameters of the 15N216O and 14N216O isotopologues. Accurate values of the 15N216O total partition function are also given.

  16. Post-Closure RCRA Groundwater Monitoring Plan for the 216-S-10 Pond and Ditch

    International Nuclear Information System (INIS)

    The purpose of this plan is to provide a post-closure groundwater monitoring program for the 216-S-10 Pond and Ditch (S-10) treatment, storage, and/or disposal (TSD) unit. The plan incorporates the sum of knowledge about the potential for groundwater contamination to originate from the S-10, including groundwater monitoring results, hydrogeology, and operational history. The S-10 has not received liquid waste since October 1991. The closure of S-10 has been coordinated with the 200-CS-1 source operable unit in accordance with the Tri-Party Agreement interim milestones M-20-39 and M-15-39C. The S-10 is closely situated among other waste sites of very similar operational histories. The proximity of the S-10 to the other facilities (216-S-17 pond, 216-S-11 Pond, 216-S-5,6 cribs, 216-S-16 ditch and pond, and 216-U-9 ditch) indicate that at least some observed groundwater contamination beneath and downgradient of S-10 could have originated from waste sites other than S-10. Hence, it may not be feasible to strictly discriminate between the contributions of each waste site to groundwater contamination beneath the S-10. A post-closure groundwater monitoring network is proposed that will include the drilling of three new wells to replace wells that have gone dry. When completed, the revised network will meet the intent for groundwater monitoring network under WAC 173-303-645, and enable an improved understanding of groundwater contamination at the S-10. Site-specific sampling constituents are based on the dangerous waste constituents of concern relating to RCRA TSD unit operations (TSD unit constituents) identified in the Part A Permit Application. Thus, a constituent is selected for monitoring if it is: A dangerous waste constituent identified in the Part A Permit Application, or A mobile decomposition product (i.e., nitrate from nitrite) of a Part A constituent, or A reliable indicator of the site-specific contaminants (i.e., specific conductance). Using these criteria

  17. Asteroid 2015 DB216: a recurring co-orbital companion to Uranus

    Science.gov (United States)

    de la Fuente Marcos, C.; de la Fuente Marcos, R.

    2015-10-01

    Minor bodies trapped in 1:1 co-orbital resonances with a host planet could be relevant to explain the origin of captured satellites. Among the giant planets, Uranus has one of the smallest known populations of co-orbitals, three objects, and all of them are short-lived. Asteroid 2015 DB216 has an orbital period that matches well that of Uranus, and here we investigate its dynamical state. Direct N-body calculations are used to assess the current status of this object, reconstruct its immediate dynamical past, and explore its future orbital evolution. A covariance matrix-based Monte Carlo scheme is presented and applied to study its short-term stability. We find that 2015 DB216 is trapped in a temporary co-orbital resonance with Uranus, the fourth known minor body to do so. A detailed analysis of its dynamical evolution shows that it is an unstable but recurring co-orbital companion to Uranus. It currently follows an asymmetric horseshoe trajectory that will last for at least 10 kyr, but it may remain inside Uranus' co-orbital zone for millions of years. As in the case of other transient Uranian co-orbitals, complex multibody ephemeral mean motion resonances trigger the switching between the various resonant co-orbital states. The new Uranian co-orbital exhibits a secular behaviour markedly different from that of the other known Uranian co-orbitals because of its higher inclination, nearly 38°. Given its rather unusual discovery circumstances, the presence of 2015 DB216 hints at the existence of a relatively large population of objects moving in similar orbits.

  18. Radionuclide logging of Tank 216-T-106, borehole 299-W10-196

    International Nuclear Information System (INIS)

    Geophysical surveys were conducted in borehole 299-W10-196 during construction to profile the radionuclide contaminants in the vadose zone that leaked from single-shell Tank 216-T-106. Contaminants from the tank leak were detected to 120 feet below the ground surface. A second complete geophysical survey was conducted about one year after drilling was completed to evaluate contaminant movement that may have been caused by the presence of the cased borehole. Contaminant movement would warrant plugging and abandoning the borehole. Comparison of the two surveys indicate that no contamination movement to greater depths can be identified

  19. Actinide occurrences in sediments following ground disposal of acid wastes at 216-Z-9

    International Nuclear Information System (INIS)

    Liquid acid wastes from a Pu recovery facility at Hanford were released to the ground via structures collectively termed trenches from 1955 through 1962. Data are presented from a study of the microdistribution of Am and Pu in samples from the 216-Z-9 trench. Solution sediment relationships and associated actinide removal mechanisms under acid conditions were studied. Core wells were drilled into the sediments in which this covered trench is located and in the immediate vicinity to obtain samples for quantitative mineralogical analysis and comparison of sediments from various depths of contaminated and noncontaminated areas. Analytical techniques are described and results are reported

  20. Drift-tube linac geometry optimization at 108 and 216 MHz

    Science.gov (United States)

    Ungrin, James; Michel, Walter L.

    1985-10-01

    Drift-tube linear accelerator geometries at 108 and 216 MHz have been studied using the computer code SUPERFISH with the aim of optimizing the effective shunt impedance, ZT2. Optimum ZT2 curves for particle velocities, β = v/ c, ranging from 0.061 (1.75 MeV/amu) to 0.567 (200 MeV/amu) have been generated from over 2500 computer runs with SUPERFISH. These curves, although derived primarily for a high current electronuclear breeder accelerator, have general application for other proton or heavy ion linear accelerators.

  1. Drift-tube linac geometry optimization at 108 and 216 MHz

    International Nuclear Information System (INIS)

    Drift-tube linear accelerator geometries at 108 and 216 MHz have been studied using the computer code SUPERFISH with the aim of optimizing the effective shunt impedance, ZT2. Optimum ZT2 curves for particle velocities, β=v/c, ranging from 0.061 (1.75 MeV/amu) to 0.567 (200 MeV/amu) have been generated from over 2500 computer runs with SUPERFISH. These curves, although derived primarily for a high current electronuclear breeder accelerator, have general application for other proton or heavy ion linear accelerators. (orig.)

  2. Asteroid 2015 DB216: a recurring co-orbital companion to Uranus

    OpenAIRE

    Marcos, C. de la Fuente; Marcos, R. de la Fuente

    2015-01-01

    Minor bodies trapped in 1:1 co-orbital resonances with a host planet could be relevant to explain the origin of captured satellites. Among the giant planets, Uranus has one of the smallest known populations of co-orbitals, three objects, and all of them are short-lived. Asteroid 2015 DB216 has an orbital period that matches well that of Uranus, and here we investigate its dynamical state. Direct N-body calculations are used to assess the current status of this object, reconstruct its immediat...

  3. Groundwater impact assessment report for the 216-Z-20 Crib, 200 West Area

    International Nuclear Information System (INIS)

    As required by the Hanford Federal Facility Agreement and Consent Order ([Tri-Party Agreement] Milestone M-17-00A), this report assesses the impact of wastewater discharges to the 216-Z-20 Crib on groundwater quality. The assessment reported herein extends the initial analysis conducted from 1989 through 1990 for the Liquid Effluent Study Final Project Report. Three primary issues are addressed in response to regulator concerns with the initial analysis: The magnitude and status of the soil column transuranic inventory. Potential interactions of wastewater with carbon tetrachloride from adjacent facilities. Preferential pathways created by unsealed monitoring wells

  4. Groundwater impact assessment report for the 216-Z-20 Crib, 200 West Area

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, V.G.

    1993-10-01

    As required by the Hanford Federal Facility Agreement and Consent Order ([Tri-Party Agreement] Milestone M-17-00A), this report assesses the impact of wastewater discharges to the 216-Z-20 Crib on groundwater quality. The assessment reported herein extends the initial analysis conducted from 1989 through 1990 for the Liquid Effluent Study Final Project Report. Three primary issues are addressed in response to regulator concerns with the initial analysis: The magnitude and status of the soil column transuranic inventory. Potential interactions of wastewater with carbon tetrachloride from adjacent facilities. Preferential pathways created by unsealed monitoring wells.

  5. Hirschsprung′s disease: Role of rectal suction biopsy - data on 216 specimens

    Directory of Open Access Journals (Sweden)

    Rahman Zillur

    2010-01-01

    Full Text Available Background: The diagnosis of Hirschsprung′s disease (HD is dependent on the histological study of rectal ganglion cells, and an open rectal biopsy was the mainstay that required general anaesthesia (GA and carried risk of postoperative rectal bleeding. Suction rectal biopsy later gained wide acceptance and became the choice as there is no requirement of GA and virtual absence of any complications. Materials and Methods: A retrospective review of the histological findings of 216 rectal suction biopsies studied from 2005 to 2009. Results: There were 143 male and 73 female children. 196 (90.7% children were within 1 year of age. Among 216 rectal suction biopsies 181 (83.80% were aganglionic, 27 (12.5% were ganglionic and 8 (3.7% were inadequate. Majority of patients were of less than 1 year of age (94.47%. Conclusions : The rectal suction biopsy is a bed side procedure, safe, cheap and time saving. There is high degree of accuracy, simplicity and absence of complications.

  6. Results of RCRA groundwater quality assessment program at the 216-U-12 crib

    International Nuclear Information System (INIS)

    The 216-U-12 crib has been in a Resource Conservation and Recovery Act of 1976 (RCRA) interim-status groundwater quality assessment program since the first quarter of 1993. Specific conductance measured in downgradient wells 299-W22-41 and 299-W22-42 exceeds its critical mean. This report presents the results and findings of Phases I and II of the assessment monitoring program, as required by 40 CFR 265.93. The elevated levels of specific conductance in the downgradient open-quotes triggeringclose quotes wells are attributed to nitrate, the mobile anion released when nitric acid is diluted in water, and calcium which is released from the sediments as acid is neutralized. Technetium-99 levels have been elevated in these same downgradient wells since 1991. The source of these constituents is the 216-U-12 crib. Downward migration of nitrate and technetium-99 from the vadose zone (and continued elevated specific conductance in the two downgradient wells) is still occurring because the driving force is still present

  7. The Xinglong 2.16-m Telescope: Current Instruments and Scientific Projects

    CERN Document Server

    Fan, Zhou; Jiang, Xiaojun; Wu, Hong; Li, Hongbin; Huang, Yang; Xu, Dawei; Hu, Zhongwen; Zhu, Yinan; Wang, Jianfeng; Komossa, Stefanie; Zhang, Xiaoming

    2016-01-01

    The Xinglong 2.16-m reflector is the first 2-meter class astronomical telescope in China. It was jointly designed and built by the Nanjing Astronomical Instruments Factory (NAIF), Beijing Astronomical Observatory (now National Astronomical Observatories, Chinese Academy of Sciences, NAOC) and Institute of Automation, Chinese Academy of Sciences in 1989. It is Ritchey-Chr\\'{e}tien (R-C) reflector on an English equatorial mount and the effective aperture is 2.16 meters. It had been the largest optical telescope in China for $\\sim18$ years until the Guoshoujing Telescope (also called Large Sky Area Multi-Object Fiber Spectroscopic Telescope, LAMOST) and the Lijiang 2.4-m telescope were built. At present, there are three main instruments on the Cassegrain focus available: the Beijing Faint Object Spectrograph and Camera (BFOSC) for direct imaging and low resolution ($R\\sim500-2000$) spectroscopy, the spectrograph made by Optomechanics Research Inc. (OMR) for low resolution spectroscopy (the spectral resolutions a...

  8. Asteroid 2015 DB216: a recurring co-orbital companion to Uranus

    CERN Document Server

    Marcos, C de la Fuente

    2015-01-01

    Minor bodies trapped in 1:1 co-orbital resonances with a host planet could be relevant to explain the origin of captured satellites. Among the giant planets, Uranus has one of the smallest known populations of co-orbitals, three objects, and all of them are short-lived. Asteroid 2015 DB216 has an orbital period that matches well that of Uranus, and here we investigate its dynamical state. Direct N-body calculations are used to assess the current status of this object, reconstruct its immediate dynamical past, and explore its future orbital evolution. A covariance matrix-based Monte Carlo scheme is presented and applied to study its short-term stability. We find that 2015 DB216 is trapped in a temporary co-orbital resonance with Uranus, the fourth known minor body to do so. A detailed analysis of its dynamical evolution shows that it is an unstable but recurring co-orbital companion to Uranus. It currently follows an asymmetric horseshoe trajectory that will last for at least 10 kyr, but it may remain inside U...

  9. Summary and analysis of 216 GHz polarimetric measurements of in-situ rain

    Science.gov (United States)

    Hedden, Abigail S.; Wikner, David A.; Bradley, Russell W.

    2015-05-01

    The Army Research Laboratory (ARL) has developed a polarimetric frequency-modulated continuous-wave (FMCW) instrumentation radar that has been used to study the polarization and backscatter properties of in-situ rain in the 220 GHz atmospheric window. A summary of the preliminary measurements is presented in this work including an analysis of the co-polarization backscatter and attenuation characteristics measured at 216 GHz. A marginal detection of the copolarization backscatter signature of rain was made during a series of fast-moving, heavy downpour thunderstorm events. A detection limit of -40±3 dB[m2/m3] was found for the VV-polarization cross section per unit volume for rain rates up to 150 mm/hr. Co-polarization (VV- and HH-polarization) attenuation characteristics measured at high rain rates (< 20 mm/hr) were well described by a Joss thunderstorm drop distribution in the high frequency limit, where drop size is much greater than the observation wavelength. Observations at 216 GHz suggest attenuation levels of 8-10 dB/km at rain rates above 20 mm/hr, strengthening previous evidence that attenuation through rain is independent of frequency under high rain rate conditions. Attenuation measurements at lower rain rates (< 20 mm/hr) were qualitatively consistent with both Laws and Parsons and Joss thunderstorm distributions.

  10. 20 CFR 652.216 - May the One-Stop operator provide guidance to State merit-staff employees in accordance with the...

    Science.gov (United States)

    2010-04-01

    ... State merit-staff employees in accordance with the Act? 652.216 Section 652.216 Employees' Benefits... operator provide guidance to State merit-staff employees in accordance with the Act? Yes, the One-Stop... accountability of State merit-staff employees funded under the Act, remain under the authority of the...

  11. Separation and Biochemical Properties of Protein Mp-21.6 from Momordica charantia%苦瓜Mp-21.6蛋白的分离及生化特性

    Institute of Scientific and Technical Information of China (English)

    蔡马; 于群; 朱新产

    2011-01-01

    为研究苦瓜蛋白的有效分离技术与抑菌活性,本实验采用(NH4)2SO4分级分离油苦瓜(Momordica charantia L.)蛋白质,将SephadexG-100凝胶柱在DEAE-52阴离子交换柱色谱上作站上串联,分步聚集纯化出苦瓜蛋白Mp-21.6.SDS-PAGE凝胶电泳显示单一蛋白条带;经生化分析鉴定,Mp-21.6 (Momordica protein of 21.6 kD)蛋白的分子量为21.6 kD,等电点pI=9.6;双向还原SDS-PAGE确定苦瓜蛋白Mp-21.6仅存在链内二硫健;Aacomplement软件的基于氨基酸组成比较发现,Mp-21.6类似于RNMC_MOMCH [Ribonuclease MC (RNase MC,EC=3.1.27.1)].抑菌试验显示Mp-21.6对大肠杆菌(Escherichia coli)、金黄色葡萄球菌(Staphylococcus aure us)、沙门氏菌(Salmonellab sp)、枯草芽胞杆菌(Bacillus sabtilis)、啤酒酵母(Saccharomyces cerevisiae)和黄曲霉(Aspergillus flavus)产生明显的抑菌活性,其最小抑菌浓度(MIC)远低于苯甲酸钠.随着苦瓜蛋白的逐级分离纯化,其清除羟自由基和总抗氧化能力均有上升的趋势.研究结果提示,苦瓜Mp-21.6蛋白具有广谱抗菌活性及显著的抗氧化能力,利用区隔性分离方式,分级提纯苦瓜的生物活性蛋白,将能开发出有发展潜力的新型抗菌药物.%In order to investigate technology of isolation and purification, and antimicrobial activity of pulp protein, in this paper, protein Mp-21.6 was isolated and purified from the pulp (Momordica charantia L.) by ammonium sulphate fractionation chromatographies on Sephadex G -100 and DEAE-52. And the protein was analyzed via SDS-PAGE and biochemical determination. The results showed that Mp-21.6 was homogeneous single band with molecular weight of 21.6 kD and pi 9.6. Mp-21.6 protein had intrachain disulfide bond by reductive two-dimensional electrophoresis. And Mp-21.6 was similar to RNMCMOMCH [Ribonuclease MC (Rnase MC, EC=3.1.27.1)] compared with amino acids by Aacomplement software. Antimicrobial activities of the protein were detected by

  12. 48 CFR 252.216-7000 - Economic price adjustment-basic steel, aluminum, brass, bronze, or copper mill products.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Economic price adjustment... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions And Clauses 252.216-7000 Economic price...), use the following clause: Economic Price Adjustment—Basic Steel, Aluminum, Brass, Bronze, or...

  13. 30 CFR 77.216-2 - Water, sediment, or slurry impoundments and impounding structures; minimum plan requirements...

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Water, sediment, or slurry impoundments and... COAL MINES Surface Installations § 77.216-2 Water, sediment, or slurry impoundments and impounding... under design storm conditions, sediment or slurry level, water level and other information pertinent...

  14. Clinicopathological features and prognostic factors of 216 cases with primary gastrointestinal tract non-Hodgkin’s lymphoma

    Institute of Scientific and Technical Information of China (English)

    尹文娟

    2013-01-01

    Objective To investigate the clinicopathological features of primary gastrointestinal non-Hodgkin’s lymphomas (PGI-NHL) and their prognostic values.Methods The clinical and pathological data of 216 patients diagnosed as PGI-NHL from Zhejiang Cancer Hospital were

  15. Decree of 19 November 1981 listing the insanitary industries in accordance with Section 216 of the health Code

    International Nuclear Information System (INIS)

    This Decree issued by the Minister of Health approves an amended list of insanitary industries which are subject to certain obligations under Section 216 of the Health Code of 1934. The amendments concern certain nuclear plants and laboratories. The 1981 Decree modifies a previous Decree of 1976. (NEA)

  16. 50 CFR 216.92 - Dolphin-safe requirements for tuna harvested in the ETP by large purse seine vessels.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Dolphin-safe requirements for tuna... MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Dolphin Safe Tuna Labeling § 216.92 Dolphin-safe requirements for tuna harvested in the ETP by large purse seine vessels. (a)...

  17. NCDC216: A New Multistate Group for Water Management and Quality for Ornamental Crop Production and Health

    Science.gov (United States)

    We have established a USDA multistate development committee (NCDC216) to create a project focused on water management and quality for ornamental crop production and health. The nursery and greenhouse industry ranks 5th (>$14.6 billion) among all US agriculture commodities and within the top 5 commod...

  18. Treatability Test Report: Characterization of Vadose Zone Carbon Tetrachloride Source Strength Using Tomographic Methods at the 216-Z-9 Site

    Energy Technology Data Exchange (ETDEWEB)

    Truex, Michael J.; Carroll, Kenneth C.; Rohay, Virginia J.; Mackley, Rob D.; Parker, Kyle R.

    2012-09-28

    A treatability test was conducted in 2011 at the 216-Z-9 Trench to evaluate methods for collecting characterization information that supports refined assessment of SVE performance goals based on impact to groundwater. The characterization information can also provide input to operational strategies for continued SVE operation and decisions regarding closure of the SVE system or transition to other remedies, if necessary.

  19. 77 FR 28568 - Foreign-Trade Zone 216-Olympia, WA; Notification of Proposed Production Activity; Callisons, Inc...

    Science.gov (United States)

    2012-05-15

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE Foreign-Trade Zones Board Foreign-Trade Zone 216--Olympia, WA; Notification of Proposed Production Activity; Callisons, Inc., (Mint Products), Lacey and Chehalis, WA The Port of Olympia, grantee of FTZ...

  20. Ground water impact assessment report for the 216-B-3 Pond system

    International Nuclear Information System (INIS)

    Ground water impact assessments were required for a number of liquid effluent receiving sites according to the Hanford Federal Facility Agreement and Consent Order Milestones M-17-00A and M-17-00B, as agreed upon by the US Department of Energy. This report is one of the last three assessments required and addresses the impact of continued discharge of uncontaminated wastewater to the 216-B-3C expansion lobe of the B Pond system in the 200 East Area until June 1997. Evaluation of past and projected effluent volumes and composition, geohydrology of the receiving site, and contaminant plume distribution patterns, combined with ground water modeling, were used to assess both changes in ground water flow regime and contaminant-related impacts

  1. Fission characteristics of 216Ra formed in heavy-ion induced reactions

    Indian Academy of Sciences (India)

    Hadi Eslamizadeh

    2013-11-01

    A Kramers-modified statistical model is used to calculate the cross-section of the evaporation residue, fission cross-section, average pre-fission multiplicities of protons and -particles for 216Ra formed in 19F + 197Au reactions and results are compared with the experimental data. To calculate these quantities, the effects of temperature and spin K about the symmetry axis have been considered in the calculations of the potential energy surfaces and the fission widths. It is shown that the results of the calculations using values of the temperature coefficient of the effective potential = 0.008 ± 0.003 MeV−2 and scaling factor of the fission-barrier height $r_{s} = 1.004 ± 0.002$ are in good agreement with the experimental data.

  2. Ground water impact assessment report for the 216-B-3 Pond system

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, V.G.; Law, A.G.; Reidel, S.P.; Evelo, S.D.; Barnett, D.B.; Sweeney, M.D.

    1995-01-01

    Ground water impact assessments were required for a number of liquid effluent receiving sites according to the Hanford Federal Facility Agreement and Consent Order Milestones M-17-00A and M-17-00B, as agreed upon by the US Department of Energy. This report is one of the last three assessments required and addresses the impact of continued discharge of uncontaminated wastewater to the 216-B-3C expansion lobe of the B Pond system in the 200 East Area until June 1997. Evaluation of past and projected effluent volumes and composition, geohydrology of the receiving site, and contaminant plume distribution patterns, combined with ground water modeling, were used to assess both changes in ground water flow regime and contaminant-related impacts.

  3. Corrosion studies of A216 grade WCA steel in hydrothermal magnesium-containing brines

    International Nuclear Information System (INIS)

    The US Department of Energy's Salt Repository Project (SRP) is investigating the general corrosion resistance of cast mild steel as a candidate material for waste package containers. Evaluation of this material is being performed at the Pacific Northwest Laboratory in environments simulating expected repository conditions. General corrosion studies of mild steel (ASTM A216 grade WCA) in the as-cast and normalized conditions were conducted in hydrothermal halite-saturated (saturated at ambient temperature) brine environments simulating a ''dissolution'' and an ''inclusion'' brine. Corrosion tests were also performed in brines similar to the inclusion brine but containing magnesium concentrations ranging from 1000 to 30,000 ppM to investigate the effect of magnesium on the corrosion behavior. Corrosion rates of the cast mild steel were found to increase with increasing temperature and with increasing magnesium concentration. Some possible mechanisms that explain the observed behavior are presented. 8 refs., 7 figs., 2 tabs

  4. Groundwater monitoring plan for the Hanford Site 216-B-3 pond RCRA facility

    International Nuclear Information System (INIS)

    The 216-B-3 pond system was a series of ponds for disposal of liquid effluent from past Hanford production facilities. In operation since 1945, the B Pond system has been a RCRA facility since 1986, with Resource Conservation and Recovery Act (RCRA) interim-status groundwater monitoring in place since 1988. In 1994, discharges were diverted from the main pond, where the greatest potential for contamination was thought to reside, to the 3C expansion pond. In 1997, all discharges to the pond system were discontinued. In 1990, the B Pond system was elevated from detection groundwater monitoring to an assessment-level status because total organic halogens and total organic carbon were found to exceed critical means in two wells. Subsequent groundwater quality assessment failed to find any specific hazardous waste contaminant that could have accounted for the exceedances, which were largely isolated in occurrence. Thus, it was recommended that the facility be returned to detection-level monitoring

  5. Groundwater monitoring plan for the Hanford Site 216-B-3 pond RCRA facility

    Energy Technology Data Exchange (ETDEWEB)

    Barnett, D.B.; Chou, C.J.

    1998-06-01

    The 216-B-3 pond system was a series of ponds for disposal of liquid effluent from past Hanford production facilities. In operation since 1945, the B Pond system has been a RCRA facility since 1986, with Resource Conservation and Recovery Act (RCRA) interim-status groundwater monitoring in place since 1988. In 1994, discharges were diverted from the main pond, where the greatest potential for contamination was thought to reside, to the 3C expansion pond. In 1997, all discharges to the pond system were discontinued. In 1990, the B Pond system was elevated from detection groundwater monitoring to an assessment-level status because total organic halogens and total organic carbon were found to exceed critical means in two wells. Subsequent groundwater quality assessment failed to find any specific hazardous waste contaminant that could have accounted for the exceedances, which were largely isolated in occurrence. Thus, it was recommended that the facility be returned to detection-level monitoring.

  6. Ultraviolet (193, 216 and 254 nm) photoinactivation of Escherichia coli strains with different repair deficiencies

    International Nuclear Information System (INIS)

    Escherichia coli K12 bacteria strains AB1157 (repair-deficient wild-type, uvrA+ recA+), AB1886 (uvrA-), AB2463 (recA-) and AB2480 (uvrA- recA-) were exposed to 254 nm germicidal UV and 216 or 193 nm laser radiation. The mean lethal incident dose (D37) for AB1157 does not change significantly with wavelength, whereas it increases for the other strains on going from λirr = 254 to 193 nm, e.g., eightfold for AB2480. Quantum yields for inactivation, due to light absorbed by the chromosomal DNA, have been estimated from the D37 values. The large differences in D37 between uvrA+ and uvrA- strains indicate a significant contribution of pyrimidine dimers and (6-4) photoproducts to photodamage of DNA in the cells. The formation of dimers even with λirr = 193 nm is supported by the result that the photoreactivable sector is larger than 63%. Inactivation of E. coli upon irradiation at 193 and 216 nm is therefore due to damage to intracellular DNA rather than to membrane or protein damage as is the case for mammalian cells. The ratio of the lethal doses for AB1157 vs AB2480 is ∼900 with λirr = 254 nm, but only 160 with λirr = 193 nm. We propose that this is due to the better repair of photodimers and (6-4) photoproducts than of damage induced by photoionization via upper excited states. Irradiation at 193 nm inactivates AB1157 mainly by damage due to photoionization and AB2480 by damage due to photodimers in the chromosomal DNA. 51 refs., 3 figs., 5 tabs

  7. Ultraviolet (193, 216 and 254 nm) photoinactivation of Escherichia coli strains with different repair deficiencies

    Energy Technology Data Exchange (ETDEWEB)

    Gurzadyan, G.G.; Goerner, H.; Schulte-Frohlinde, D. [Max-Planck-Institut fuer Strahlenchemie, Muelheim an der Ruhr (Germany)

    1995-03-01

    Escherichia coli K12 bacteria strains AB1157 (repair-deficient wild-type, uvrA{sup +} recA{sup +}), AB1886 (uvrA{sup {minus}}), AB2463 (recA{sup {minus}}) and AB2480 (uvrA{sup {minus}} recA{sup {minus}}) were exposed to 254 nm germicidal UV and 216 or 193 nm laser radiation. The mean lethal incident dose (D{sub 37}) for AB1157 does not change significantly with wavelength, whereas it increases for the other strains on going from {lambda}{sub irr} = 254 to 193 nm, e.g., eightfold for AB2480. Quantum yields for inactivation, due to light absorbed by the chromosomal DNA, have been estimated from the D{sub 37} values. The large differences in D{sub 37} between uvrA{sup +} and uvrA{sup {minus}} strains indicate a significant contribution of pyrimidine dimers and (6-4) photoproducts to photodamage of DNA in the cells. The formation of dimers even with {lambda}{sub irr} = 193 nm is supported by the result that the photoreactivable sector is larger than 63%. Inactivation of E. coli upon irradiation at 193 and 216 nm is therefore due to damage to intracellular DNA rather than to membrane or protein damage as is the case for mammalian cells. The ratio of the lethal doses for AB1157 vs AB2480 is {approx}900 with {lambda}{sub irr} = 254 nm, but only 160 with {lambda}{sub irr} = 193 nm. We propose that this is due to the better repair of photodimers and (6-4) photoproducts than of damage induced by photoionization via upper excited states. Irradiation at 193 nm inactivates AB1157 mainly by damage due to photoionization and AB2480 by damage due to photodimers in the chromosomal DNA. 51 refs., 3 figs., 5 tabs.

  8. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  9. Constraints on the size of Asteroid (216) Kleopatra using stress analysis

    Science.gov (United States)

    Hirabayashi, M.; Scheeres, D. J.

    2013-12-01

    We investigate the stable size of Asteroid (216) Kleopatra by considering structural constraints on this body. Comprehensive radar observations (Ostro et al. 2000, Science) were used to estimate a shape model for this asteroid. Their estimation revealed that the shape looks like a dog-bone, the mean radius is 54.3 km (with uncertainty as large as 25%), and the surface seems similar to lunar surface regolith. However, 10 years later, Descamps et al. (2011, Icarus) performed near-infrared adaptive optics (AO) imaging with the W.M. Keck II telescope and found that although the shape may be consistent with their observation result, their size appeared to be larger than the Ostro size (by a factor of about 1.24). Our motivation in this study is to investigate structural stability constraints on the size of this asteroid. Across the stated range of uncertainty we find significant differences in the necessary angle of friction and cohesion for the body to avoid plastic deformation. We use the following physical parameters as fixed: a mass of 4.64e18 kg (Descamps et al. 2011, Icarus), a rotation period of 5.385 hr (Magnusson 1990, Icarus), and the Ostro et al. shape. We use the Drucker-Prager criterion to describe the rheology of the asteroid's material. Furthermore, we determine the friction angle from the fact that the surface of this asteroid is similar to lunar surface regolith, whose porosity ranges from 33% to 55%. According to Scott (1963), a soil with porosity of 44% (the mean value of the lunar surface porosity) has a friction angle of 32 degrees (which we use as our nominal value). Since the interior structure is unknown, we assume that the body is homogeneous. We first analyze the stable size by using the upper bound theorem from limit analysis on the assumption that this asteroid's materials are cohesionless. Based on this theorem, for any static surface traction and body force, the yield due to a smooth and convex yield envelope associated with the volume

  10. Groundwater Monitoring Plan for the Hanford Site 216-B-3 Pond RCRA Facility

    Energy Technology Data Exchange (ETDEWEB)

    Barnett, D BRENT.; Smith, Ronald M.; Chou, Charissa J.; McDonald, John P.

    2005-11-01

    The 216-B-3 Pond system was a series of ponds used for disposal of liquid effluent from past Hanford production facilities. In operation from 1945 to 1997, the B Pond System has been a Resource Conservation and Recovery Act (RCRA) facility since 1986, with RCRA interim-status groundwater monitoring in place since 1988. In 1994 the expansion ponds of the facility were clean closed, leaving only the main pond and a portion of the 216-B-3-3 ditch as the currently regulated facility. In 2001, the Washington State Department of Ecology (Ecology) issued a letter providing guidance for a two-year, trial evaluation of an alternate, intrawell statistical approach to contaminant detection monitoring at the B Pond system. This temporary variance was allowed because the standard indicator-parameters evaluation (pH, specific conductance, total organic carbon, and total organic halides) and accompanying interim status statistical approach is ineffective for detecting potential B-Pond-derived contaminants in groundwater, primarily because this method fails to account for variability in the background data and because B Pond leachate is not expected to affect the indicator parameters. In July 2003, the final samples were collected for the two-year variance period. An evaluation of the results of the alternate statistical approach is currently in progress. While Ecology evaluates the efficacy of the alternate approach (and/or until B Pond is incorporated into the Hanford Facility RCRA Permit), the B Pond system will return to contamination-indicator detection monitoring. Total organic carbon and total organic halides were added to the constituent list beginning with the January 2004 samples. Under this plan, the following wells will be monitored for B Pond: 699-42-42B, 699-43-44, 699-43-45, and 699-44-39B. The wells will be sampled semi-annually for the contamination indicator parameters (pH, specific conductance, total organic carbon, and total organic halides) and annually for

  11. Milestones in the testing of surface disinfectants: from Robert Koch to CEN TC 216

    Directory of Open Access Journals (Sweden)

    Reybrouck, Gerald

    2007-09-01

    Full Text Available The first publication on testing disinfection procedures dates back to 1881 and was compiled by Robert Koch. Although his conclusions were erroneous, we continue to use the “germ carrier test” right up to the present day even if preference is now given to the suspension test first devised by Geppert. Over the years many conceptual milestones had to be reached, and much knowledge and many insights were needed to develop this procedure further to ensure reproducible results. Today, the disinfectant effect is calculated in terms of logarithmic reduction factors for the microbial count: a reduction of 5 log levels has been agreed, i.e. an inactivation kinetics of 99.999%. Of paramount importance was, in particular, the insight that different methods had to be employed to test disinfectants, while doing so not only in the laboratory but also under everyday working conditions. This gave rise to a situation whereby each country developed its own test methods, producing significantly different results. It was only in 1970 that the parties concerned came together so as to reach a uniform solution in Europe. The achievements of the “International Colloquium” were later adopted and continued by the European Standardization Committee (CEN in a special working group (TS 216. The most important accomplishment of this working group is, no doubt, the insight that it is not a test result but rather a test system that will reveal the truth. The tests carried out in Phase 1 are quantitative suspension tests to elucidate the bactericidal, virucidal, tuberculocidal, fungicidal and sporicidal efficacy. Phase 2 defines the requisite concentration per exposure time.CEN was founded and is sponsored by industry, since the latter needs reliable standards. Time will tell whether this was not perhaps the greatest milestone in the development of test methods. However, the successes scored by CEN are ultimately only the logical consequence of the accomplishments

  12. 4$\\pi$ detector for study of Zeno effect using 220Rn -> 216Po alpha->alpha correlated chains

    CERN Document Server

    Nadderd, L; Subotic, K; Polyakov, A N; Lobanov, Y V; Rykhlyuk, A V

    2015-01-01

    First test of the 4pi detector for study of exponential law of radioactive decay and possibility of observation of Zeno effect [1-3], measuring the mean life of 216Po is presented. This detector consists of two surface-barrier n-Si(Au) detectors placed in the close contact ( 4T1/2. Both, the data acquisition system and the vacuum chamber design are presented in brief.

  13. Borehole data package for the 216-S-10 pond and ditch well 299-W26-13

    International Nuclear Information System (INIS)

    One new Resource Conservation and Recovery Act (RCRA) groundwater monitoring well was installed at the 216-S-10 pond and ditch during November and December 1999 in fulfillment of Tri-Party Agreement (Ecology 1996) milestone M-24-42. The well is 299-W26-13 and is located at the northeast comer to the 216-S-10 pond, southwest of 200 West Area. The well is a new downgradient well in the monitoring network. A figure shows the locations of all wells in the 216-S-10 pond and ditch monitoring network. The new well was constructed to the specifications and requirements described in Washington Administrative Code (WAC) 173-160 and WAC 173-303, the groundwater monitoring plan for the 216-S-10 pond and ditch (Airhart et al. 1990), and the description of work for well drilling and installation. During drilling and construction of well 299-W26-13, sampling and analysis activities were done to support remedial action, closure decisions at treatment, storage and disposal facilities, and to confirm preliminary site conceptual models developed in the 200-CS-1 Work Plan (DOE/RL 1999). This document compiles information on the drilling and construction, well development, pump installation, and sediment and groundwater testing applicable to well 299-W26-13. Appendix A contains the Well Summary Sheet (as-built diagram), the Well Construction Summary Report, and the geologist's log. Appendix B contains results of field and laboratory determinations of physical and chemical properties of sediment samples. Appendix C contains borehole geophysical logs. Additional documentation concerning well construction is on file with Bechtel Hanford, Inc., Richland, Washington

  14. ASASSN-15oi: A Rapidly Evolving, Luminous Tidal Disruption Event at 216 Mpc

    CERN Document Server

    Holoien, T W -S; Prieto, J L; Grupe, D; Chen, Ping; Godoy-Rivera, D; Stanek, K Z; Shappee, B J; Dong, Subo; Brown, J S; Basu, U; Beacom, J F; Bersier, D; Brimacombe, J; Carlson, E K; Falco, E; Johnston, E; Madore, B F; Pojmanski, G; Seibert, M

    2016-01-01

    We present ground-based and Swift photometric and spectroscopic observations of the tidal disruption event (TDE) ASASSN-15oi, discovered at the center of 2MASX J20390918-3045201 ($d\\simeq216$ Mpc) by the All-Sky Automated Survey for SuperNovae (ASAS-SN). The source peaked at a bolometric luminosity of $L\\simeq1.9\\times10^{44}$ ergs s$^{-1}$ and radiated a total energy of $E\\simeq5.0\\times10^{50}$ ergs over the $\\sim3.5$ months of observations. The early optical/UV emission of the source can be fit by a blackbody with temperature increasing from $T\\sim2\\times10^4$ K to $T\\sim6\\times10^4$ K while the luminosity declines from $L\\simeq1.9\\times10^{44}$ ergs s$^{-1}$ to $L\\simeq2.8\\times10^{43}$ ergs s$^{-1}$, requiring the photosphere to be shrinking rapidly. The optical/UV luminosity decline is broadly consistent with an exponential decline, $L\\propto e^{-t/t_0}$, with $t_0\\simeq35$ days. ASASSN-15oi also exhibits roughly constant soft X-ray emission that is significantly weaker than the optical/UV emission. Spe...

  15. Discovery of a possible X-ray counterpart to HESS J1804-216

    CERN Document Server

    Bamba, A; Hiraga, J S; Hughes, J P; Kohmura, T; Kokubun, M; Maeda, Y; Matsumoto, H; Senda, A; Takahashi, T; Tsuboi, Y; Yamauchi, S; Yuasa, T; Bamba, Aya; Koyama, Katsuji; Hiraga, Junko S.; Hughes, John P.; Kohmura, Takayoshi; Kokubun, Motohide; Maeda, Yoshitomo; Matsumoto, Hironori; Senda, Atsushi; Takahashi, Tadayuki; Tsuboi, Yohko; Yamauchi, Shigeo; Yuasa, Takayuki

    2006-01-01

    Suzaku deep observations have discovered two highly significant nonthermal X-ray sources, Suzaku J1804$-$2142 (Src 1) and Suzaku J1804$-$2140 (Src 2), positionally coincident with the unidentified TeV $\\gamma$-ray source, HESS J1804$-$216. The X-ray sources are not time variable and show no counterpart in other wavebands, except for the TeV source. Src 1 is unresolved at Suzaku spatial resolution, whereas Src 2 is extended or composed of multiple sources. The X-ray spectra are highly absorbed, hard, and featureless, and are well fitted by absorbed power-law models with best-fit photon indices and absorption columns of $-0.3_{-0.5}^{+0.5}$ and $0.2_{-0.2}^{+2.0}\\times 10^{22}$ cm$^{-2}$ for Src 1, and $1.7_{-1.0}^{+1.4}$ and $1.1_{-0.6}^{+1.0}\\times 10^{23}$ cm$^{-2}$ for Src 2. The measured X-ray absorption to the latter source is significantly larger than the total Galactic neutral hydrogen column in that direction. The unabsorbed 2--10 keV band luminosities are $7.5\\times 10^{32}(d/{\\rm 5 kpc})^2$ ergs s$^{...

  16. Evidence for deuterium astration in the planetary nebula Sh2-216?

    CERN Document Server

    Oliveira, C M; Moos, H W; Kruk, J W; Rauch, T; Oliveira, Cristina M; Chayer, Pierre; Kruk, Jeffrey W.; Rauch, Thomas

    2007-01-01

    We present FUSE observations of the line of sight to WD0439+466 (LS V +46 21), the central star of the old planetary nebula Sh2-216. The FUSE data shows absorption by many interstellar and stellar lines, in particular D I, H2 (J = 0 - 9), HD (J = 0 - 1), and CO. Many other stellar and ISM lines are detected in the STIS E140M HST spectra of this sightline, which we use to determine N(HI). We derive, for the neutral gas, D/H=(0.76 +0.12 -0.11)E-5, O/H = (0.89 +0.15 -0.11)E-4 and N/H = (3.24 +0.61-0.55)E-5. We argue that most of the gas along this sightline is associated with the planetary nebula. The low D/H ratio is likely the result of this gas being processed through the star (astrated) but not mixed with the ISM. This would be the first time that the D/H ratio has been measured in predominantly astrated gas. The O/H and N/H ratios derived here are lower than typical values measured in other planetary nebulae likely due to unaccounted for ionization corrections.

  17. Evaluation report on CCTF Core-II reflood test C2-16 (Run 76)

    International Nuclear Information System (INIS)

    This report presents the result of the upper plenum injection (UPI) test C2-16 (Run 76), which was conducted on October 23, 1984, with the Cylindrical Core Test Facility (CCTF) at Japan Atomic Energy Research Institute (JAERI). The CCTF is a 1/21.4 scale model of a 1,100 MWe PWR with four loop active components to provide information on the system and core thermo-hydrodynamics during reflood. The objectives of the test are to investigate the reflood phenomena with single failure UPI condition and to investigate the effect of the asymmetry of UPI on the reflood phenomena. The test was performed with an asymmetric UPI condition at the injection rate simulating single failure of LPCI pumps. It was observed that, (1) a UPI test simulating no LPCI pump failure gave the slightly lower peak clad temperature than a UPI test simulating single LPCI pump failure, indicating that single LPCI pump failure assumption is conserrative for UPI condition, and (2) an asymmetric UPI lead to a higher core water accumulation and then a higher heat transfer coefficient, resultantly a lower peak clad temperature than a symmetric UPI, indicating that asymmetric UPI does not lead to a poorer core cooling than symmetric UPI. (author)

  18. Crash testing hydrological models in contrasted climate conditions: An experiment on 216 Australian catchments

    Science.gov (United States)

    Coron, L.; AndréAssian, V.; Perrin, C.; Lerat, J.; Vaze, J.; Bourqui, M.; Hendrickx, F.

    2012-05-01

    This paper investigates the actual extrapolation capacity of three hydrological models in differing climate conditions. We propose a general testing framework, in which we perform series of split-sample tests, testing all possible combinations of calibration-validation periods using a 10 year sliding window. This methodology, which we have called the generalized split-sample test (GSST), provides insights into the model's transposability over time under various climatic conditions. The three conceptual rainfall-runoff models yielded similar results over a set of 216 catchments in southeast Australia. First, we assessed the model's efficiency in validation using a criterion combining the root-mean-square error and bias. A relation was found between this efficiency and the changes in mean rainfall (P) but not with changes in mean potential evapotranspiration (PE) or air temperature (T). Second, we focused on average runoff volumes and found that simulation biases are greatly affected by changes in P. Calibration over a wetter (drier) climate than the validation climate leads to an overestimation (underestimation) of the mean simulated runoff. We observed different magnitudes of these models deficiencies depending on the catchment considered. Results indicate that the transfer of model parameters in time may introduce a significant level of errors in simulations, meaning increased uncertainty in the various practical applications of these models (flow simulation, forecasting, design, reservoir management, climate change impact assessments, etc.). Testing model robustness with respect to this issue should help better quantify these uncertainties.

  19. Description of work for 216-U-Pond cone penetrometer demonstration

    International Nuclear Information System (INIS)

    This description of work details the Proposed field activities associated with Cone Penetrometer (CPT) work at the 216-U-10 Pond (U-10 Pond) in the 200 West Area and will serve as a field guide for those performing the work. The U-10 Pond was constructed in 1944 to receive low-level liquid effluent from the various chemical reprocessing facilities within the 200 West Area. The U-10 Pond covered 30 acres and received approximately 4.3 x 1010 gal of contaminated liquid. Sampling conducted in 1980 indicated that the most significant radionuclides were 90Sr, 137Cs, plutonium, and uranium (DOE-RL 1993). The pond was deactivated and stabilized in 1985 with clean fill dirt. The thickness of the stabilization cover is variable across the former pond and ranges between 2 ft near the pond margins and delta area to 8 feet in the deepest section of the pond. The purpose of this work is to establish the extent of contamination beneath the U-10 pond

  20. Results of RCRA groundwater quality assessment at the 216-B-3 Pond Facility

    International Nuclear Information System (INIS)

    This document describes a groundwater quality assessment of the 216-B-3 pond system, a Resources Conservation and Recovery act of 1976 (RCRA) waste facility. In 1990, sampling and chemical analysis of groundwater underlying the facility indicated that the contamination indicator parameters, total organic halogens (TOX), and total organic carbon (TOC) had exceeded established limits in two wells. This discovery placed the facility into RCRA groundwater assessment status and subsequently led to a more detailed hydrochemical analysis of groundwater underlying the facility. Comprehensive chemical analyses of groundwater samples from 1994 through 1996 revealed one compound, tris (2-chloroethyl) phosphate (TRIS2CH), that may have contributed to elevated TOX concentrations. No compound was identified as a contributor to TOC. Detailed evaluations of TOX, TOC, and TRIS2CH and comparison of occurrences of these parameters led to conclusions that (1) with few exceptions, these constituents occur at low concentrations below or near limits of quantitation; (2) it is problematic whether the low concentrations of TRIS2CH represent a contaminant originating from the facility or if it is a product of well construction; and (3) given the low and diminishing concentration of TOX, TOC, and TRIS2CH, no further investigation into the occurrent of these constituents is justified. Continued groundwater monitoring should include an immediate recalculation of background critical means of upgradient/downgradient comparisons and a return to seminannual groundwater monitoring under a RCRA indicator parameter evaluation program

  1. Three Alginate Lyases from Marine Bacterium Pseudomonas fluorescens HZJ216: Purification and Characterization

    Energy Technology Data Exchange (ETDEWEB)

    Liyan, Li [Ocean University of China, Qingdao, PRC; Jiang, Xiaolu [Ocean University of China, Qingdao, PRC; Wang, Peng [Ocean University of China, Qingdao, PRC; Guan, Huashi [Ocean University of China, Qingdao, PRC; Guo, Hong [ORNL

    2010-01-01

    Three alginate lyases (A, B, and C) from an alginate-degrading marine bacterium strain HZJ216 isolated from brown seaweed in the Yellow Sea of China and identified preliminarily as Pseudomonas fluorescens are purified, and their biochemical properties are described. Molecular masses of the three enzymes are determined by SDS-PAGE to be 60.25, 36, and 23 kDa with isoelectric points of 4, 4.36, and 4.59, respectively. Investigations of these enzymes at different pH and temperatures show that they are most active at pH 7.0 and 35 C. Alginate lyases A and B are stable in the pH range of 5.0 9.0, while alginate lyase C is stable in the pH range of 5.0 7.0. Among the metal ions tested, additions of Na+, K+, and Mg2+ ions can enhance the enzyme activities while Fe2+, Fe3+, Ba2+, and Zn2+ ions show inhibitory effects. The substrate specificity results demonstrate that alginate lyase C has the specificity for G block while alginate lyases A and B have the activities for both M and G blocks. It is the first report about extracellular alginate lyases with high alginate-degrading activity from P. fluorescens.

  2. The predicted impacts to the groundwater and Columbia River from ammoniated water discharges to the 216-A-36B crib

    International Nuclear Information System (INIS)

    Impact from past and potential future discharges of ammoniated water to the 216-A-36B crib have on groundwater and river concentrations of hazardous chemical constitutents are studied. Until August 1987, the 216-A-36B crib, located in the 200-East Area of the Hanford Site, accepted ammoniated water discharges. Although this study addresses known hazardous chemical constituents associated with such discharges, the primary concern is the discharge of NH4OH because of its microbiological conversion to NO2/sup /minus// and NO3/sup /minus//. As a result of fuel decladding operations, material balance calculations indicate that NH4OH has been discharged to the 216-A-36B crib in amounts that exceed reportable quantities under the Comprehensive Environmental Response, Compensation and Liability Act of 1980. Although flow to the crib is relatively constant, the estimated NH4OH discharge varies from negligible to a maximum of 10,000 g-molesh. Because these discharges are intermittent, the concentration delivered to the groundwater is a function of soil sorption, microbiological conversion rates of NH4+ to NO2/sup /minus// and NO3/sup /minus//, and groundwater dispersion. This report provides results based on the assumptions of maximum, nominal, and discountinued NH4OH discharges to the crib. Consequently, the results show maximum and realistic estimates of NH4+, NO2/sup /minus// and NO3/sup /minus// concentrations in the groundwater

  3. Brightest Fermi-LAT flares of PKS 1222+216: implications on emission and acceleration processes

    Energy Technology Data Exchange (ETDEWEB)

    Kushwaha, Pankaj; Singh, K. P. [Department of Astronomy and Astrophysics, Tata Institute of Fundamental Research, Mumbai (India); Sahayanathan, Sunder, E-mail: pankaj563@tifr.res.in [Astrophysical Sciences Division, Bhabha Atomic Research Centre, Mumbai (India)

    2014-11-20

    We present a high time resolution study of the two brightest γ-ray outbursts from a blazar PKS 1222+216 observed by the Fermi Large Area Telescope (LAT) in 2010. The γ-ray light curves obtained in four different energy bands, 0.1-3, 0.1-0.3, 0.3-1, and 1-3 GeV, with time bins of six hours, show asymmetric profiles with similar rise times in all the bands but a rapid decline during the April flare and a gradual one during the June flare. The light curves during the April flare show an ∼2 day long plateau in 0.1-0.3 GeV emission, erratic variations in 0.3-1 GeV emission, and a daily recurring feature in 1-3 GeV emission until the rapid rise and decline within a day. The June flare shows a monotonic rise until the peak, followed by a gradual decline powered mainly by the multi-peak 0.1-0.3 GeV emission. The peak fluxes during both the flares are similar except in the 1-3 GeV band in April, which is twice the corresponding flux during the June flare. Hardness ratios during the April flare indicate spectral hardening in the rising phase followed by softening during the decay. We attribute this behavior to the development of a shock associated with an increase in acceleration efficiency followed by its decay leading to spectral softening. The June flare suggests hardening during the rise followed by a complicated energy dependent behavior during the decay. Observed features during the June flare favor multiple emission regions while the overall flaring episode can be related to jet dynamics.

  4. Corrosion and hydrogen permeation of A216 grade WCA steel in hydrothermal magnesium-containing brines

    International Nuclear Information System (INIS)

    The US Department of Energy's Salt Repository Project (SRP) is investigating the general corrosion resistance of cast mild steel as a candidate material for waste package containers. Evaluation of this material is being performed at the Pacific Northwest Laboratory in environments simulating expected repository conditions. The present work addresses two potential failure modes of the reference waste package container: failure by general corrosion processes, and failure by internal hydrogen pressurization by permeation of corrosion product hydrogen. General corrosion studies of mild steel (ASTM A216 grade WCA) in the as-cast and normalized conditions were conducted in hydrothermal halite-saturated (saturated at ambient temperature) brine environments simulating a dissolution and an inclusion brine. Corrosion tests were also performed in brines similar to the inclusion brine but containing magnesium concentrations ranging from 1,000 to 30,000 ppm to investigate the effect of magnesium on the corrosion behavior. In addition, long-term (to 18 months) corrosion tests have been carried out using two-phase salt/brine environments (excess salt tests). Corrosion rates of the cast mild steel in brine were found to increase with increasing temperature and with increasing magnesium concentration. Some possible mechanisms that explain the observed behavior are presented. The corrosion rates observed in the excess-salt tests tend to decrease with time, at 200 degree and 150 degree C; and as-cast material corrodes more slowly than does normalized material. Corrosion-product hydrogen rapidly permeated a mild steel tubing corrosion/permeation specimen immersed in brine. The rate of permeation at 150 degree C was high enough to cause concern regarding potential container overpressurization

  5. Influence of Neutron Shell Closure (Nc=126) on Prescission Particle Emission of Fissioning Systems 216,224Th

    Institute of Scientific and Technical Information of China (English)

    叶巍

    2003-01-01

    The effect of neutron shell closure Nc = 126 on the prescission-particle emission of 216Th and 224Th nuclei is investigated within the framework of an extensive Smoluchowski equation. It is found that there is a large difference in the prescission neutron multiplicity for the two Th nuclei, indicating a strong shell effect in neutron emission. Moreover, shell effects on particle emission are also investigated as functions of excitation energy,angular momentum and nuclear viscosity. The results show that with increasing excitation energy shell effects in prefission neutron evolve from continual strength to gradual weakness. Both high angular momenta and low viscosity weaken the shell effects on the particle emission.

  6. A Retrospective Clinical Analysis of 216 Patients With Non-ST Segment Elevation Myocardial Infarction

    Institute of Scientific and Technical Information of China (English)

    Manish Pradhan; Shuxian Zhou; Juan Lei; Zesheng Liu

    2008-01-01

    Objectives To analyze the clinical characteristics of 216 patients with non-ST segment elevation myocardial infarc-tion (NSTEMI). Methods A retrospective analysis was used. Two hundred and sixteen NSTEMI patients were divid-ed into two groups: ①according to the age: age 178 μmol. L-1 group. Seven hundred and eighty six acute myocardial infarction (AMI) patients during the same period were divided into ST seg-ment elevation myocardial infarction (STEMI) group and NSTEMI group. Clinical characteristics of the patients in th e two groups were compared. Results ① The number of NSTEMI patients in age ≥65 years group is significantly grea-ter than that in age 178 μmol· L-1) and triple ves-sel disease. Fewer patients in this group received coronary artery angiography (CAG), percutaneous coronary interven-tion (PCI) and coronary artery bypass graft (CABG). More number of deaths in this group compared with the age 4 group is significantly greater than that in TIMI score 4 group comparing with TIMI score ≤4 group. ③ Obviously, more number of elderly patients, non-insulin dependant diabetes mellitus (NIDDM), patients with cardiac troponin T (CTnT) >3.0 ng · L-1 and deaths occurred in sCr > 178 μmol · L-1 group. @ STEMI and NSTEMI patients were compared in same time frame as follows: fewer NSTEMI patients and more elderly patients had no chest pain, NID-DM, hypertension, dyslipidemia, left main coronary artery (LMCA) disease while CTnT ≥3.0 ng· ml-1; fewer pa- tients with aneurysm (30 days) underwent CAG, PCI and CABG treatment. However, there were no significant differ-ences in smokers, patients with less than 50% stenosis in any vessel, 1 -3 vessel disease, acute left ventricle heart fail-ure, cardiogenic shock, serious arrhythmia and deaths. ⑤ The multivariate logistic regression analysis showed that death in NSTEMI was directly influenced by malignant arrhythmias with age ≥ 70 years. Conclusions Patients with NSTEMI were older, had more risk factors

  7. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2013. Scientific Opinion on Flavouring Group Evaluation 216, Revision 1 (FGE.216Rev1). Consideration of genotoxic potential for α,β-unsaturated 2-Phenyl -2-Alkenals from Subgroup 3.3 of FGE.19

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia;

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of five flavouring substances from subgroup 3.3 of FGE.19. In the Flavouring Group Evaluation 216 (FGE.216) additional genotoxicity...... of animals treated with 2-phenylcrotonaldehyde. Moreover, since the substance was genotoxic only without metabolic activation, it appears necessary to prove the absence of genotoxic effect locally in the gastro intestinal system using the Comet assay....

  8. Breast-conserving surgery and combined therapy for women breast cancer:a report of 216 cases%216例女性乳腺癌保乳手术及综合治疗的临床分析

    Institute of Scientific and Technical Information of China (English)

    Xianju Qin; Junxue Chen; Hongwei Zhang; Dafang Zhao; Hua Zhang; Wenjie Luo; Qian Huang; Shixian Lian; Hanxing Tong

    2007-01-01

    Objective:To explore the therapeutic effect and associated techniques of breast-conserving therapy on patients with clinical stage Ⅰand stage Ⅱ breasl cancer.Methods:216 female patients with breast cancer underwent breast-conserving therapy from December 1993 to October 2004.Their data were analyzed retrospectively.The breast-conserving therapy consisted of lumpectomy or quadrant removal of the breast,postoperative radiotherapy.chemotherapy and endocrine therapy.of them.209 patients underwent axillary lymph node dissection.Results:There were no operative complications.216patients were followed-up 3 to 147 months.the medial follow-up time was 78 months.The local recurrence rate was 1.85%.Two patients died and one of them was not related with breast cancer.Presence or absence of fibrosis,shape of breast,asymmetry,pigmentation and handle were taken into consideration for cosmetic evaluation by the patients and experienced breast surgeon.Breasts were scored cosmetically asexcellent and good in 199 patients.the rate of satisfactory was92.13%.Conclusion:Breast-conserving therapy for early breast cancer is a safe and effective therapy.It has less trauma and less complications and can also raise the quality of life in the patients.But we must obey the strict indications and reasonable techniques.

  9. 中西结合治疗216例犬细小病毒病疗效观察%Clinical Observation of 216 Cases of Canine Parvovirus Disease by Treatment of Combining TCM and WM

    Institute of Scientific and Technical Information of China (English)

    宋洋铭; 叶得河

    2012-01-01

    通过临床症状、流行病学特点和犬细小病毒抗原试剂盒对疑似细小病毒感染的216例病犬进行确诊,并对确诊为细小病毒感染的部分病例进行抗体水平检测,以判断其预后,采用中西结合的综合措施治疗发病犬,治愈率达到70%,提出了有效的预防措施.%Author confirmed 216 cases of suspected canine parvovirus disease through the clinical signs, epidemiological characteristics and antigen rapid canine parvovirus test kit, to determine its prognosis, author detected antibody level of some cases of confirmed canine parvovirus disease, in addition, author achieved cure rate of 70% by comprehensive measures of treatment of combining TCM and WM, at last author propose effective prevention measures for canine parvovirus disease.

  10. 40 CFR 265 interim status indicator-evaluation ground-water monitoring plan for the 216-B-63 trench

    International Nuclear Information System (INIS)

    This document outlines a ground-water monitoring plan for the 216-B-63 trench located in the northeast corner of the 200-East Area on the Hanford Site in southeastern Washington State. It has been determined that hazardous materials (corrosives) were disposed of to the trench during past operations. Installation of an interim-status ground-water monitoring system is required to determine whether hazardous chemicals are leaching to the ground water from beneath the trench. This document summarizes the existing data that are available from near the 216-B-63 trench and presents a plan to determine the extent of ground-water contamination, if any, derived from the trench. The plan calls for the installation of four new monitoring wells located near the west end of the trench. These wells will be used to monitor ground-water levels and water quality immediately adjacent to the trench. Two existing RCRA monitoring wells, which are located near the trench and hydraulically upgradient of it, will be used as background wells. 46 refs., 15 figs., 12 tabs

  11. Observation of Very High Energy Gamma Rays from HESS J1804-216 with CANGAROO-III Telescopes

    CERN Document Server

    Higashi, Y; Yoshida, T; Enomoto, R; Tanimori, T; Edwards, P G; Naito, T; Bicknell, G V; Clay, R W; Gunji, S; Hara, S; Hara, T; Hattori, T; Hayashi, S; Hirai, Y; Inoue, K; Kabuki, S; Kajino, F; Katagiri, H; Kawachi, A; Kifune, T; Kiuchi, R; Kushida, J; Matsubara, Y; Mizukami, T; Mizumoto, Y; Mizuniwa, R; Mori, M; Muraishi, H; Muraki, Y; Nakamori, T; Nakano, S; Nishida, D; Nishijima, K; Ohishi, M; Sakamoto, Y; Seki, A; Stamatescu, V; Suzuki, T; Swaby, D L; Thornton, G; Tokanai, F; Tsuchiya, K; Watanabe, S; Yamada, Y; Yamazaki, E; Yanagita, S; Yoshikoshi, T; Yukawa, Y

    2008-01-01

    We observed the unidentified TeV gamma-ray source HESS J1804-216 with the CANGAROO-III atmospheric Cerenkov telescopes from May to July in 2006. We detected very high energy gamma rays above 600 GeV at the 10 sigma level in an effective exposure of 76 hr. We obtained a differential flux of (5.0+/-1.5_{stat}+/-1.6_{sys})\\times 10^{-12}(E/1 TeV)^{-\\alpha} cm^{-2}s^{-1}TeV^{-1} with a photon index \\alpha of 2.69 +/- 0.30_{stat} +/- 0.34_{sys}, which is consistent with that of the H.E.S.S. observation in 2004. We also confirm the extended morphology of the source. By combining our result with multi-wavelength observations, we discuss the possible counterparts of HESS J1804-216 and the radiation mechanism based on leptonic and hadronic processes for a supernova remnant and a pulsar wind nebula.

  12. 宫腔内人工授精治疗不育症216例疗效观察

    Institute of Scientific and Technical Information of China (English)

    贾韶彤; 席向红; 刘鑫

    2006-01-01

    为观察男性不育症患者宫腔内人工授精(IUI)临床疗效,回顾性分析行IUI的216例患者的临床资料.患者4组:A组正常精液自然周期的卵泡成熟后采用IUI;B组正常精液采用促排卵后行IUI治疗;C组精液分析异常(精液不液化、少精症、弱精子症等)自然周期的卵泡成熟后采用IUI;D组免疫性不育(男性血清抗精了抗体阳性)自然周期的卵泡成熟后采用IUI.结果,216例男性不育患者进行245个周期的IUI,妊娠33例,妊娠率15.28%;正常精液促排卵进行IUI治疗的B组妊娠率最高,为19.04%.表明IUI适用于男方因素引起的不孕.

  13. Cilium adhesin P216 (MHJ_0493) is a target of ectodomain shedding and aminopeptidase activity on the surface of Mycoplasma hyopneumoniae.

    Science.gov (United States)

    Tacchi, Jessica L; Raymond, Benjamin B A; Jarocki, Veronica M; Berry, Iain J; Padula, Matthew P; Djordjevic, Steven P

    2014-06-01

    MHJ_0493 (P216) is a highly expressed cilium adhesin in Mycoplasma hyopneumoniae. P216 undergoes cleavage at position 1074 in the S/T-X-F↓-X-D/E-like motif (1072)T-N-F↓Q-E(1076) generating N-terminal and C-terminal fragments of 120 kDa (P120) and 85 kDa (P85) on the surface of M. hyopneumoniae. Here we show that several S/T-X-F↓X-D/E-like motifs exist in P216 but only (1072)T-N-F↓Q-E(1076) and (1344)I-T-F↓A-D-Y(1349) were determined to be bona fide processing sites by identifying semitryptic peptides consistent with cleavage at the phenylalanine residue. The location of S/T-X-F↓-X-D/E-like motifs within or abutting regions of protein disorder greater than 40 consecutive amino acids is consistent with our hypothesis that site access influences the cleavage efficiency. Approximately 20 cleavage fragments of P216 were identified on the surface of M. hyopneumoniae by LC-MS/MS analysis of biotinylated proteins and 2D SDS-PAGE. LC-MS/MS analysis of semitryptic peptides within P216 identified novel cleavage sites. Moreover, detection of a series of overlapping semitryptic peptides that differed by the loss a single amino acid at their N-terminus is consistent with aminopeptidase activity on the surface of M. hyopneumoniae. P120 and P85 and their cleavage fragments bind heparin and cell-surface proteins derived from porcine epithelial-like cells, indicating that P216 cleavage fragments retain the ability to bind glycosaminoglycans. PMID:24804907

  14. Pilot Source Study 2015: US Regional Airline Pilot Hiring Background Characteristic Changes Consequent to Public Law 111-216 and the FAA First Officer Qualifications Rule

    OpenAIRE

    Bjerke, Elizabeth; Smith, Guy; Smith, MaryJo; Christensen, Cody; Carney, Thomas; Craig, Paul; Niemczyk, Mary

    2016-01-01

    This report is the first article in a series called Pilot Source Study 2015. Public Law (PL) 111-216, passed by the US Congress in 2010, and the subsequent FAA Regulation, Pilot Certification and Qualification Requirements for Air Carrier Operations Rule, abruptly changed the pilot hiring situation for US air carriers operating under 14 CFR Part 121. PL 111-216 became effective on August 1, 2013; thereafter, pilots were not eligible to be first officers in Part 121 air carriers unless they we...

  15. A program to compute three-dimensional subsonic unsteady aerodynamic characteristics using the doublet lattice method, L216 (DUBFLEX). Volume 2: Supplemental system design and maintenance document

    Science.gov (United States)

    Harrison, B. A.; Richard, M.

    1979-01-01

    The information necessary for execution of the digital computer program L216 on the CDC 6600 is described. L216 characteristics are based on the doublet lattice method. Arbitrary aerodynamic configurations may be represented with combinations of nonplanar lifting surfaces composed of finite constant pressure panel elements, and axially summetric slender bodies composed of constant pressure line elements. Program input consists of configuration geometry, aerodynamic parameters, and modal data; output includes element geometry, pressure difference distributions, integrated aerodynamic coefficients, stability derivatives, generalized aerodynamic forces, and aerodynamic influence coefficient matrices. Optionally, modal data may be input on magnetic field (tape or disk), and certain geometric and aerodynamic output may be saved for subsequent use.

  16. Vadose Zone Contaminant Fate and Transport Analysis for the 216-B-26 Trench

    Energy Technology Data Exchange (ETDEWEB)

    Ward, Andy L.; Gee, Glendon W.; Zhang, Z. F.; Keller, Jason M.

    2004-10-14

    The BC Cribs and Trenches, part of the 200 TW 1 OU waste sites, received about 30 Mgal of scavenged tank waste, with possibly the largest inventory of 99Tc ever disposed to the soil at Hanford and site remediation is being accelerated. The purpose of this work was to develop a conceptual model for contaminant fate and transport at the 216-B-26 Trench site to support identification and development and evaluation of remediation alternatives. Large concentrations of 99Tc high above the water table implicated stratigraphy in the control of the downward migration. The current conceptual model accounts for small-scale stratigraphy; site-specific changes soil properties; tilted layers; and lateral spreading. It assumes the layers are spatially continuous causing water and solutes to move laterally across the boundary if conditions permit. Water influx at the surface is assumed to be steady. Model parameters were generated with pedotransfer functions; these were coupled high resolution neutron moisture logs that provided information on the underlying heterogeneity on a scale of 3 inches. Two approaches were used to evaluate the impact of remedial options on transport. In the first, a 1-D convolution solution to the convective-dispersive equation was used, assuming steady flow. This model was used to predict future movement of the existing plume using the mean and depth dependent moisture content. In the second approach, the STOMP model was used to first predict the current plume distribution followed by its future migration. Redistribution of the 99Tc plume was simulated for the no-action alternative and on-site capping. Hypothetical caps limiting recharge to 1.0, 0.5, and 0.1 mm yr-1 were considered and assumed not to degrade in the long term. Results show that arrival time of the MCLs, the peak arrival time, and the arrival time of the center of mass increased with decreasing recharge rate. The 1-D convolution model is easy to apply and can easily accommodate initial

  17. Vadose Zone Contaminant Fate and Transport Analysis for the 216-B-26 Trench

    International Nuclear Information System (INIS)

    The BC Cribs and Trenches, part of the 200 TW 1 OU waste sites, received about 30 Mgal of scavenged tank waste, with possibly the largest inventory of 99Tc ever disposed to the soil at Hanford and site remediation is being accelerated. The purpose of this work was to develop a conceptual model for contaminant fate and transport at the 216-B-26 Trench site to support identification and development and evaluation of remediation alternatives. Large concentrations of 99Tc high above the water table implicated stratigraphy in the control of the downward migration. The current conceptual model accounts for small-scale stratigraphy; site-specific changes soil properties; tilted layers; and lateral spreading. It assumes the layers are spatially continuous causing water and solutes to move laterally across the boundary if conditions permit. Water influx at the surface is assumed to be steady. Model parameters were generated with pedotransfer functions; these were coupled high resolution neutron moisture logs that provided information on the underlying heterogeneity on a scale of 3 inches. Two approaches were used to evaluate the impact of remedial options on transport. In the first, a 1-D convolution solution to the convective-dispersive equation was used, assuming steady flow. This model was used to predict future movement of the existing plume using the mean and depth dependent moisture content. In the second approach, the STOMP model was used to first predict the current plume distribution followed by its future migration. Redistribution of the 99Tc plume was simulated for the no-action alternative and on-site capping. Hypothetical caps limiting recharge to 1.0, 0.5, and 0.1 mm yr-1 were considered and assumed not to degrade in the long term. Results show that arrival time of the MCLs, the peak arrival time, and the arrival time of the center of mass increased with decreasing recharge rate. The 1-D convolution model is easy to apply and can easily accommodate initial

  18. Carbon Tetrachloride Flow and Transport in the Subsurface of the 216-Z-18 Crib and 216-Z-1A Tile Field at the Hanford Site: Multifluid Flow Simulations and Conceptual Model Update

    Energy Technology Data Exchange (ETDEWEB)

    Oostrom, Mart; Rockhold, Mark L.; Thorne, Paul D.; Last, George V.; Truex, Michael J.

    2006-10-31

    Carbon tetrachloride (CT) was discharged to the 216-Z-9, Z-1A, and Z-18 waste sites that are included in the 200-PW-1 Operable Unit in Hanford 200 West Area. Fluor Hanford, Inc. is conducting a Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) remedial investigation/feasibility study (RI/FS) for the 200-PW-1 Operable Unit. As part of this overall effort, Pacific Northwest National Laboratory (PNNL) was contracted to improve the conceptual model of how CT is distributed in the Hanford 200 West Area subsurface through use of numerical flow and transport modeling. This work supports the U.S. Department of Energy's (DOE's) efforts to characterize the nature and distribution of CT in the 200 West Area and subsequently select an appropriate final remedy.

  19. One Day Every 216 Years, Three Days Each Decan. Rebirth Cycle of Pythagoras, Phoenix, Hazon Gabriel, and Christian Dogma of Resurrection Can Be Explained by the Metonic Cycle

    Science.gov (United States)

    Rothwangl, S.

    2009-08-01

    This article explains how the Metonic cycle is at the base of the period of 216 years Pythagoras believed in being reborn after that period. It shows how this period calendrically is related to other mythological worldviews such as the Phoenix myth, the Hebrean Hazon Gabriel, and the Christian dogma of resurrection on the third day.

  20. Carbon Tetrachloride Flow and Transport in the Subsurface of the 216-Z-9 Trench at the Hanford Site

    Science.gov (United States)

    Oostrom, M.; Rockhold, M.; Truex, M.; Thorne, P.; Last, G.; Rohay, V.

    2006-12-01

    Three-dimensional modeling was conducted with layered and heterogeneous models to enhance the conceptual model of CT distribution in the vertical and lateral direction beneath the 216-Z-9 trench and to investigate the effects of soil vapor extraction (SVE). This work supports the U.S. Department of Energy's (DOE's) efforts to characterize the nature and distribution of CT in the 200 West Area and subsequently select an appropriate final remedy. Simulations targeted migration of dense, nonaqueous phase liquid (DNAPL) consisting of CT and co-disposed organics in the subsurface beneath the 216-Z-9 trench as a function of the properties and distribution of subsurface sediments and of the properties and disposal history of the waste. Simulations of CT migration were conducted using the Subsurface Transport Over Multiple Phases (STOMP) simulator. Simulation results support a conceptual model for CT distribution where CT in the DNAPL phase is expected to have migrated primarily in a vertical direction below the disposal trench. Presence of small-scale heterogeneities tends to limit the extent of vertical migration of CT DNAPL due to enhanced retention of DNAPL compared to more homogeneous conditions, but migration is still predominantly in the vertical direction. Results also show that the Cold Creek units retain more CT DNAPL within the vadose zone than other hydrologic unit during SVE. A considerable amount of the disposed CT DNAPL may have partitioned to the vapor and subsequently water and sorbed phases. Presence of small-scale heterogeneities tends to increase the amount of volatilization. Any continued migration of CT from the vadose zone to the groundwater is likely through interaction of vapor phase CT with the groundwater and not through continued DNAPL migration. The results indicated that SVE appears to be an effective technology for vadose zone remediation, but additional effort is needed to improve simulation of the SVE process.

  1. Percutaneous Laser Disc Decompression for Lumbar Disc Retrospective Analysis: Report of 216 Cases%经皮激光减压术治疗腰椎间盘突出症216

    Institute of Scientific and Technical Information of China (English)

    赵继荣; 朱换平; 陈文

    2011-01-01

    Objective To observe the therapeutic effect of percutaneous laser disc decompression on lumbar disc herniation.Methods 216 cases of lumbar discherniation were treated by percutaneous laser disc decompression therapy, and were followed up for 1 week, three months, one year and three years respectirely to assess the efficacy.Results The efficient and excellent rates were 56.9% and 93.1%, 80.8% and 95.3%, 83.4% and 94.5%, 82.8% and 93.8%.7 days, 3 months, 1 year and 3 years after operation, respectively.The disease was in a recovery stage within the first year after operation and become stable then.Conclusions Percutaneous laser disc decompression in effective for treatment of disc herniation with less complications and its longterm effects is better the short-term effect.%目的 观察经皮激光减压术治疗腰椎间盘突出症的疗效.方法 对符合纳入标准的216例腰椎间盘突出症患者应用经皮激光间盘气化减压术治疗,分别于术后1周、3个月、1和3年进行随访,评定疗效.结果 有效率、优良率术后3d分别为56.9%、93.1%;术后3个月分别为80.8%、95.3%;术后1年分别为83.4%、94.5%;术后3年分别为82.8%、93.8%.术后1年内处于病情恢复阶段,1年后疗效稳定.结论 经皮激光气化减压术治疗椎间盘突出症疗效确切、并发症少,远期效果好于近期效果.

  2. AB088. The application of vesiculoscopy in the patients of hematospermia and ejaculatory duct obstruction (216 cases report)

    Science.gov (United States)

    Li, Yan-Feng; Liao, Liang-Gong

    2016-01-01

    Objective To evaluate the clinical effects of the vesiculoscopy and related endoscopic technique on the treatment of ejaculatory duct obstruction (EDO) and severe, persistent hematospermia in cases that were refractory to conservative treatments by retrospectively analyzing the clinical data of the patients treated in our hospital. Methods Clinical data from 216 patients with persistent and refractory hematospermia or EDO in our hospital since Jan. 2009 to May. 2015 was retrospectively analyzed. Data collected included history, symptoms, as well as ultrasound and MRI of the morphological features of the bilateral seminal vesicles (SV) and ejaculatory duct (ED) areas. Seminal vesiculoscopy and /or transurethral resection of the ejaculatory duct (TURED) or other related procedure were performed according to individual situation. The effects of endoscopic treatment on the refractory haematospermia and EDO were followed up. Results The age range of the patients was 21–80 years (mean, 43.2 years). The history of hematospermia lasted for 6 to 120 months (mean, 35.2 months). The operations include: (I) seminal vesiculoscopy + seminal vesicle irrigation; (II) transurethral resection of the cysts in ED area and fulguration of the cyst wall; (III) lithotripsy and/or removing stones of seminal duct; (IV) fulguration of the abnormal blood vessels at posterior urethra; (V) TURED. The operation time ranged from 20 to 65 min (mean, 33 min). The seminal vesiculoscopy and related procedure were successfully performed in 211 patients, and were failed to perform in 5 patients because of the atrophy or abnormal anatomy of the seminal vesicles. 27.3% (59/216) of the patients had cysts in the ED area and 12.5% (27/216) had stone or calcification in the SV, ED or utricular cyst. 204 patients were followed up for 3–72 months (mean, 35 months). The hematospermia of all the patients were disappeared within 2–6 weeks and 94.6% (193/204) of the patients did not appear the haematospermia

  3. Structural Characterization of the 216-Z-9 Crib Prior to Decontamination and Demolition Using Robot Crawler and High Resolution Photography

    International Nuclear Information System (INIS)

    The Department of Energy, Richland Operations Office is preparing to conduct a Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) removal action for the decontamination and demolition of the above-grade mining structures and equipment at the 216-Z-9 Crib. An investigation of the condition of the mining complex was initiated to determine constraints necessary for safely conducting the removal of the buildings. While crib headspace chemical analysis and nondestructive analysis of the interior of the buildings was completed to address radiological contamination concerns, the primary concern regarding the removal of the above-grade structures located on the crib cover involves determining the loading capacity and structural integrity of the crib cover slab. Additional concerns included headspace gases and radionuclide contamination. Until the structural analysis was completed, loading limits on the crib cover had been restricted. Photographic documentation revealed the loss of protective tiles and acid resistant coating from the underside of the cover raising a question of concrete stability. The investigation relied heavily on the use of high resolution photography with high intensity lighting for photographic documentation of the underside of the crib cover, followed by structural analysis of the documentation by a team of qualified engineers. Deployment of a robot crawler with attached camera and positioning of a fixed camera were integral to this structural characterization effort. Results of the photographic documentation were of sufficient quality to allow for bounding decisions to be made regarding the loading of the crib cover while performing the demolition of the mining structures (glovebox, excavator, bucket) and the associated buildings. The 216-Z-9 Crib, also known as the 216 Z-9 Recuplex CAW (CA column waste) Waste Disposal Cavern, the Z-9 Trench and the Z-9 Crib was constructed as an engineered trench with an open area beneath

  4. Conformational alterations induced by novel green 16-E2-16 gemini surfactant in xanthine oxidase: Biophysical insights from tensiometry, spectroscopy, microscopy and molecular modeling.

    Science.gov (United States)

    Akram, Mohd; Bhat, Imtiyaz Ahmad; Bhat, Waseem Feeroze; Kabir-ud-Din

    2015-11-01

    Herein we report the interaction of a biodegradable gemini surfactant, ethane-1,2-diyl bis(N,N-dimethyl-N-hexadecylammoniumacetoxy) dichloride (16-E2-16) with bovine milk xanthine oxidase (XO), employing tensiometry, fluorescence spectroscopy, UV spectroscopy, far-UV circular dichroism spectroscopy (CD), Fourier transform infrared (FT-IR) spectroscopy, scanning electron microscopy (SEM), transmission electron microscopy (TEM), and computational molecular modeling. Surface tension results depict substantial changes in the micellar as well as interfacial parameters (CMC, ΠCMC, γCMC, Γmax, Amin, ΔGmic° and ΔGads°) of 16-E2-16 gemini surfactant upon XO combination, deciphering the interaction of XO with the gemini surfactant. Fluorescence measurements reveal that 16-E2-16 gemini surfactant causes quenching in the xanthine oxidase (XO) fluorescence spectra via static procedure and the values of various evaluated binding parameters (KSV, Kb, kq, ΔGb° and n) describe that 16-E2-16 effectively binds to XO. Three dimensional fluorescence, 8-anilino-1-naphthalene sulfonic acid (ANS) binding, F1F3 ratio, UV, CD, FTIR, SEM and TEM results delineate changes in the secondary structure of xanthine oxidase. Molecular docking results provide complement to the steady-state fluorescence findings and support the view that quenching occurs due to non-polar environment experienced by aromatic residues of the enzyme. The results of this study can help scientists to tune the conformation of an enzyme (XO) with biocompatible amphiphilic microstructures, which will help to unfold further understanding in the treatment modes of various diseases like gout, hyperuricemia, liver and brain necrosis. PMID:26057098

  5. High-resolution FUSE and HST ultraviolet spectroscopy of the white dwarf central star of Sh 2-216

    CERN Document Server

    Rauch, T; Werner, K; Kruk, J W; Oliveira, C M; Putte, D Vande; Mignani, R P; Kerber, F

    2007-01-01

    LS V +4621 is the DAO-type central star of the planetary nebula Sh 2-216. We perform a comprehensive spectral analysis of high-resolution, high-S/N ultraviolet observations obtained with FUSE and STIS aboard the HST as well as the optical spectrum of LS V +4621 by means of state-of-the-art NLTE model-atmosphere techniques in order to compare its photospheric properties to theoretical predictions from stellar evolution theory as well as from diffusion calculations. From the N IV - NV, O IV - O VI, Si IV - Si V, and Fe V - Fe VII ionization equilibria, we determined an effective temperature of 95 +/- 2 kK with high precision. The surface gravity is log g = 6.9 +/- 0.2. An unexplained discrepancy appears between the spectroscopic distance d = 224 +46/-58 pc and the parallax distance d = 129 +6/-5 pc of LS V +4621. For the first time, we have identified Mg IV and Ar VI absorption lines in the spectrum of a hydrogen-rich central star and determined the Mg and Ar abundances as well as the individual abundances of i...

  6. A simulation study of the performance of the NASA (2,1,6) convolutional code on RFI/burst channels

    Science.gov (United States)

    Perez, Lance C.; Costello, Daniel J., Jr.

    1993-01-01

    In an earlier report, the LINKABIT Corporation studied the performance of the (2,1,6) convolutional code on the radio frequency interference (RFI)/burst channel using analytical methods. Using an R(sub 0) analysis, the report concluded that channel interleaving was essential to achieving reliable performance. In this report, Monte Carlo simulation techniques are used to study the performance of the convolutional code on the RFI/burst channel in more depth. The basic system model under consideration is shown. The convolutional code is the NASA standard code with generators g(exp 1) = 1+D(exp 2)+D(exp 3)+D(exp 5)+D(exp 6) and g(exp 2) = 1+D+D(exp 2)+D(exp 3)+D(exp 6) and d(sub free) = 10. The channel interleaver is of the convolutional or periodic type. The binary output of the channel interleaver is transmitted across the channel using binary phase shift keying (BPSK) modulation. The transmitted symbols are corrupted by an RFI/burst channel consisting of a combination of additive white Gaussian noise (AWGN) and RFI pulses. At the receiver, a soft-decision Viterbi decoder with no quantization and variable truncation length is used to decode the deinterleaved sequence.

  7. Influence of intermartensitic transitions on transport properties of Ni$_{2.16}Mn_{0.84}$Ga alloy

    CERN Document Server

    Khovailo, V V; Wedel, C; Takagi, T; Abe, T; Sugiyama, K

    2004-01-01

    Magnetic, transport, and x-ray diffraction measurements of ferromagnetic shape memory alloy Ni$_{2.16}$Mn$_{0.84}$Ga revealed that this alloy undergoes an intermartensitic transition upon cooling, whereas no such a transition is observed upon subsequent heating. The difference in the modulation of the martensite forming upon cooling from the high-temperature austenitic state [5-layered (5M) martensite], and the martensite forming upon the intermartensitic transition [7-layered (7M) martensite] strongly affects the magnetic and transport properties of the alloy and results in a large thermal hysteresis of the resistivity $\\rho$ and magnetization $M$. The intermartensitic transition has an especially marked influence on the transport properties, as is evident from a large difference in the resistivity of the 5M and 7M martensite, $(\\rho_{\\mathrm{5M}} - \\rho_{\\mathrm{7M}})/\\rho _{\\mathrm{5M}} \\approx 15%$, which is larger than the jump of resistivity at the martensitic transition from the cubic austenitic phase ...

  8. Expand MILES spectral library for LAMOST stellar parameter determination using Chinese 2.4 and 2.16 metereter telescopes

    Science.gov (United States)

    Wang, Chun; Liu, Xiaowei; Huang, Yang; Zuo, Fang; Yuan, Haibo; Ren, Juanjuan; Chen, Bingqiu; Xiang, Maosheng; Zhang, Huawei; Luo, Ali; Shi, Jianrong

    2015-08-01

    We present a new medium resolution (full width at half-maximum FWHM ~ 2.4 Å) spectral library containing 1903 stellar spectra with a wavelength coverage of 3800-9000 Å based on MILES spectral library which contains 985 blue arm spectra with wavelength coverage of 3500-7500 Å at a spectral resolution of 2.5 Å (FWHM). The spectra are observed with Chinese Xinglong 2.16 meter telescope of blue arm spectra (with wavelength coverage 3800-5180 Å ) and Gaomeigu 2.4 meter telescope of red arm spectra (with wavelength coverage 5150-9000 Å ), respectively. This new library aims to improve the stellar atmospheric parameters determination accuracy of LAMOST Stellar Parameter Pipeline at Peking University (LSP3) and minimize the limitation of LSP3 . It also could be used in the spectral synthesis of stellar populations of galaxies and many other astronomical fields. Now 560 blue arm and 496 red arm spectra have been observed and reduced. The accuracy of wavelength-calibration and flux-calibration are better than ~ 0.3 Å and ~ 5 per cent, respectively. The mean signal to noise ratios of all spectra are almost larger than 100 per Å.

  9. Kinetics of radiolabelled (99mTc) heparin and low molecular weight heparin fractions CY 216, CY 222 in patients with uncomplicated myocardial infarction

    International Nuclear Information System (INIS)

    Kinetics of plasmatic disappearance of 99mTc-heparin and low molecular weight heparin (LMWH) fractions CY 216 and CY 222 were compared in 2 women and 8 men (aged 50-71) with uncomplicated myocardial infarction. The three technetiated heparins were consecutively injected intravenously (67 nanomoles) to each of 10 patients, at intervals of 3-5 days, 14-28 days after acute cardiac onset. The plasma radioactivity was counted in blood samples collected within a period of 5 h. 99mTc-heparin and LMWH fractions CY 216, CY 222 disappeared from plasma following a biexponential clearance curve with a fast and slow component reflecting the biodistribution (α) and elimination (β) phase. The bioavailability values as well as distribution and elimination rates were similar for all three technetiated heparins. The bulk of injected 99mTc-heparin or LMWH fraction was rapidly distributed to the tissue compartment, whereas the radiocomplex remaining in the circulation was slowly eliminated with a half-time of an average 320 min. Radioactivity eliminated from plasma was only partially (30-50%) excreted in the urine. The results indicate that after a low-dose intravenous administration LMWH fractions CY 216 and CY 222 maintain the pharmacokinetic properties of standard heparin, especially the rapid distribution to the tissue compartment. (author)

  10. Regular in situ measurements of HDO/H216O in the northern and southern hemispherical upper troposphere reveal tropospheric transport processes.

    Science.gov (United States)

    Christner, Emanuel; Dyroff, Christoph; Sanati, Shahrokh; Brenninkmeijer, Carl; Zahn, Andreas

    2013-04-01

    Atmospheric water in form of water vapor and clouds is an enormously crucial trace species. It is responsible for ~70 % of the natural greenhouse effect (Schmidt et al., JGR, 2010), carries huge amounts of latent heat, and is the major source of OH in the troposphere. The isotopic composition of water vapor is an elegant tracer for a better understanding and quantification of the extremely complex and variable hydrological cycle in Earth's atmosphere (evaporation, cloud condensation, rainout, re-evaporation, snow), which in turn is a prerequisite to improve climate modeling and predictions. In this context, water-isotopologues (here the isotope ratio HDO/H216O) can be used to study the atmospheric transport of water and in-cloud processes. As H216O and HDO differ in vapor pressure and molecular diffusion, fractionation occurs during condensation and rainout events. For that reason the ratio HDO/H216O preserves information about the transport and condensation history of an air mass. The tunable diode-laser absorption spectrometer ISOWAT was developed for airborne measurements of the water-isotopologue concentrations of H216O and HDO, probing fundamental rovibrational water-absorption lines at around 2.66 μm. Since April 2010 the spectrometer is regularly operated aboard the CARIBIC passenger aircraft (Civil Aircraft for the Regular Investigation of the atmosphere Based on an Instrument Container - Lufthansa, Airbus 340-600), which measures ~100 trace gases and aerosol components in the UTLS (9-12 km altitude) on four long-distance flights per month. During several flights across the equator (Africa) or close to the equator (Venezuela and Malaysia) an increase of HDO/H216O from the subtropics towards the tropics was measured (by more than 100 permil) at an altitude of ~12 km. This isotopic gradient can partly be attributed to differences in humidity. In addition there is a humidity independent latitudinal gradient (by more than 50 permil), revealing the strong

  11. Advanced Hodgkin's lymphoma: results in 216 patients treated with ABVD in Brazil Linfoma de Hodgkin em estádio avançado: resultados do tratamento em 216 pacientes tratados com ABVD no Brasil

    Directory of Open Access Journals (Sweden)

    Luciana Britto

    2010-01-01

    Full Text Available The outcome of Hodgkin's lymphoma (HL has markedly improved over the last few decades, placing HL among the human cancers with highest cure rates. However, data about treatment outcomes in developing countries are scarce. From 1996 to 2005, 370 consecutive patients with HL treated in three public institutions in Rio de Janeiro were identified. A total of 216 patients who presented with advanced stage (IIB-IV HL were selected for the present analysis. Patients with advanced disease were treated with ABVD, complemented or not by radiation therapy. The median follow-up time of survivors was 6.3 years (1-11.8. Fifteen patients died during first-line treatment. The complete remission rate was 80%. The 5-year progression-free survival (PFS and the 5-year overall survival (OS probabilities were 69% and 83%, respectively. The 5-year PFS in low-risk and high-risk patients were 81% and 62% (p=0.003, respectively. The 5-year OS in low-risk and high-risk International Prognostic Score patients were 89% and 78% (p=0.02, respectively. The present study provides a representative estimate of current treatment results for advanced HL in public institutions in an urban area in Brazil. It is clear that full treatment can be given to most patients, although those with very low socio-economic status might require special attention and support. Since Brazil is a large country, with substantial interregional heterogeneity, a nationwide registry of HL patients is currently being implemented.Os resultados do tratamento do linfoma de Hodgkin (LH melhoraram substancialmente ao longo das últimas décadas e tornaram o LH uma das neoplasias humanas com maior chance de cura. Entretanto, os dados sobre tratamento em países em desenvolvimento são escassos. Entre 1996 e 2005, 370 pacientes consecutivos com LH tratados em três instituições públicas no Rio de Janeiro foram identificados. Destes, 216 em estádio avançado (IIB-IV foram selecionados para esta análise. Os

  12. XMM-NEWTON OBSERVATIONS OF THE TeV γ-RAY SOURCE HESS J1804-216

    International Nuclear Information System (INIS)

    We have analyzed three XMM-Newton observations of the central part of the unidentified TeV γ-ray source HESS J1804-216. We focus on two X-ray sources, 2XMMi J180442.0-214221 (Src 1) and 2XMMi J180432.5-214009 (Src 2), which were suggested to be the possible X-ray counterparts to the TeV source. We discover a 2.93 hr X-ray periodicity from Src 1, with the pulse profile explained with a self-eclipsing pole in an eclipsing polar. Src 2 exhibits a strong Fe emission line (FWHM ∼ 0.3 keV and equivalent width ∼0.8 keV) and large X-ray variability on timescales of hours and is probably an intermediate polar. Thus Src 1 and Src 2 are probably two field sources not responsible for the TeV emission. The observations were contaminated by strong stray light from a nearby bright source, and we see no clear extended X-ray emission that can be attributed to the supernova remnant G8.7-0.1, a popular possible association with the TeV source. The other possible association, the pulsar wind nebula candidate PSR J1803-2137, shows little long-term variability compared with a previous Chandra observation. Many point sources were serendipitously detected, but most of them are probably normal stars. Three new candidate compact object systems (other than Src 1, Src 2, and PSR J1803-2137) are also found. They are far away from the TeV source and are probably also magnetic cataclysmic variables, thus unlikely to be responsible for the TeV emission.

  13. MEFV Gene Profile in Northwest of Iran, Twelve Common MEFV Gene Mutations Analysis in 216 Patients with Familial Mediterranean Fever

    Directory of Open Access Journals (Sweden)

    Farhad Salehzadeh

    2015-01-01

    Full Text Available Familial Mediterranean Fever (FMF is a hereditary autoinflammatory disease with autosomal recessive inheritance pattern often seen around the Mediterranean Sea. It is characterized by recurrent episodes of fever and polyserositis and rash. Recently, MEFV gene analysis determines the definitive diagnosis of FMF. In this study, we analyzed 12 MEFV gene mutations in more than 200 FMF patients, previously diagnosed by Tel-Hashomer clinical criteria, in northwest of Iran, located in the proximity of the Mediterranean Sea. In the northwest of Iran (Ardabil, 216 patients with FMF diagnosis, based on Tel-Hashomer criteria, referred to the genetic laboratory to be tested for the following mutations; P369S, F479L, M680I(G/C, M680I(G/A, I692del, M694V, M694I, K695R, V726A, A744S, R761H, E148Q. All patients were screened for MEFV gene mutations by a reverse hybridization assay (FMF Strip Assay, Vienna lab, Vienna, Austria according to manufacturer’s instructions. Among these FMF patients, no mutation was detected in 51 (23/62% patients, but 165 (76/38% patients had one or two mutations, 33 patients (15/28% homozygous, 86 patients (39/81% compound heterozygous and 46 patients (21/29% were heterozygous. The most common mutations were M694V (23/61%, V726A (11/11% and E148Q (9/95% respectively. MEFV gene mutations showed similarities and dissimilarities in different ethnic groups, while it is common among Arabs and Armenians genotype. Since common 12 MEFV gene analysis could not detect up to 50% of our patients, who had FMF on the basis of clinical Tel-Hashomer criteria, clinical criteria is still the best way in the diagnosis of FMF in this area.

  14. SOLVENT HOLD TANK SAMPLE RESULTS FOR MCU-14-135/136 AND MCU-14-214/215/216: FEBRUARY AND MARCH 2014 MONTHLY SAMPLES

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F.; Taylor-Pashow, K.

    2014-06-30

    SRNL received two sets of SHT samples (MCU-14-135-136 in February 2014 and MCU-14-214-216 in March 2014) for analysis. The samples were analyzed for composition. As with the previous solvent sample results, these analyses indicate that the solvent does not require Isopar® L trimming at this time. However, the addition of TiDG (suppressor) to the blended solvent is recommended. Evidence of possible (slight) isomerization of the solvent, probably Isopar®L or TiDG degradation products, was observed.

  15. 216例神经科重症监护病房患者医院感染及病原菌分析%Etiological analysis of 216 cases of hospital-acquired infections in neurology intensive care unit

    Institute of Scientific and Technical Information of China (English)

    姜嘟嘟; 柳毅刚; 詹青

    2013-01-01

    Objective To investigate microbiological etiology of hospital-acquired infections in Neurology ICU and their antibiotic resistance pattern to provide basis for rational antimicrobial therapy. Methods The pathogens of hospital-acquired infections in 216 NICU patients and the results of susceptibility testing from January 1 , 2008 to December 31 , 2011 were analyzed retrospectively. Results The top three infections were pneumonia (including 39 ventilator-associated pneumonia), urinary tract infection (including 91 catheter-associated urinary tract infections), and bloodstream infection (including 11 central venous catheter-related bloodstream infections). A total of 582 strains of pathogens were collected, of which gram negative bacilli, gram positive cocci and fungal pathogens accounted for 65. 5%, 24. 9% and 9. 6% , respectively. The top five gram-negative rods were Klebsiella pneumoniae (25.2%), Pseudomonas aeruginosa (22.3%), Acinetobacter baumannii (18.1%), Escherichia coli (17.3%) and Proteus mirabilis (4.5%). The top gram-positive pathogens were Staphylococcus aureus (43.4%), Staph-ylococcus haemolyticus (17.2%), Enterococcus faeciumv (8.3%), Staphylococcus epidermidis (8.3%). and Enterococcus gallinarum (4. 8%). Candida albicans was the most frequently reported fungal pathogen. Most strains of gram negative rods were highly susceptible to carbapenems, cefoperazone-sulbactam and piperacillin-tazobactam, but resistant to aminoglycosides and fluoroquinolones. The resistance of Acinetobacter baumannii was serious, including 29% (20/69) extensively drug-resistant strains. The strains of Acinetobacter baumannii were highly susceptible to only cefoperazone-sulbactam. Strains of gram positive cocci were highly susceptible to vancomycin and linezolid. Conclusions Most of the hospital infections in NICU are device-related infections, including ventilator-associated pneumonia, catheter-associated urinary tract infections, and central venous catheter-related bloodstream

  16. Process for producing astatine-211 for radiopharmaceutical use

    International Nuclear Information System (INIS)

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  17. High-resolution FUSE and HST ultraviolet spectroscopy of the white dwarf central star of Sh 2-216

    Science.gov (United States)

    Rauch, T.; Ziegler, M.; Werner, K.; Kruk, J. W.; Oliveira, C. M.; Vande Putte, D.; Mignani, R. P.; Kerber, F.

    2007-07-01

    Context: We perform a comprehensive spectral analysis of LS V +46° 21 in order to compare its photospheric properties to theoretical predictions from stellar evolution theory as well as from diffusion calculations. Aims: LS V +46° 21 is the DAO-type central star of the planetary nebula Sh 2-216. High-resolution, high-S/N ultraviolet observations obtained with FUSE and STIS aboard the HST as well as the optical spectrum have been analyzed in order to determine the photospheric parameters and the spectroscopic distance. Methods: We performed a detailed spectral analysis of the ultraviolet and optical spectrum by means of state-of-the-art NLTE model-atmosphere techniques. Results: From the N IV - N V, O IV - O VI, Si IV - Si V, and Fe V - Fe VII ionization equilibria, we determined an effective temperature of (95± 2) kK with high precision. The surface gravity is log g = 6.9± 0.2. An unexplained discrepancy appears between the spectroscopic distance d = 224+46-58 pc and the parallax distance d = 129+6-5 pc of LS V +46° 21. For the first time, we have identified Mg IV and Ar VI absorption lines in the spectrum of a hydrogen-rich central star and determined the Mg and Ar abundances as well as the individual abundances of iron-group elements (Cr, Mn, Fe, Co, and Ni). With the realistic treatment of metal opacities up to the iron group in the model-atmosphere calculations, the so-called Balmer-line problem (found in models that neglect metal-line blanketing) vanishes. Conclusions: Spectral analysis by means of NLTE model atmospheres has presently arrived at a high level of sophistication, which is now hampered largely by the lack of reliable atomic data and accurate line-broadening tables. Strong efforts should be made to improve upon this situation. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract

  18. Metallicity and star formation activities of the interacting system Arp 86 from observations with MOS on the Xinglong 2.16 m telescope

    International Nuclear Information System (INIS)

    We present an analysis of the metallicity and star formation activities of H II regions in the interacting system Arp 86, based on the first scientific observations using multi-object spectroscopy with the 2.16 m telescope at the Xinglong Observing Station. We find that the oxygen abundance gradient in Arp 86 is flatter than that in normal disk galaxies, which confirms that gas inflows caused by tidal forces during encounters can flatten the metallicity distributions in galaxies. The companion galaxy NGC 7752 is currently experiencing a galaxy-wide starburst with a higher star formation rate surface density than the main galaxy NGC 7753, which can be explained in that the companion galaxy is more susceptible to the effects of interaction than the primary. We also find that the galaxy 2MASX J23470758+2926531 has similar abundance and star formation properties to NGC 7753, and may be a part of the Arp 86 system. (research papers)

  19. Metallicity and Star Formation Activities of the Interacting System Arp 86 from Observation with MOS on Xinglong 2.16m Telescope

    CERN Document Server

    Zhou, Zhi-Min; Huang, Lei; Li, Hong-Bin; Zhou, Zhi-Zhong; Jia, Jun-Jun; Lam, Man-I; Zhu, Yi-Nan

    2014-01-01

    We present an analysis of the metallicity and star formation activities of HII regions in the interacting system Arp 86, based on the first scientific observation of the multi-object spectroscopy on the 2.16m Telescope at Xinglong Observatory. We find that the oxygen abundance gradient in Arp 86 is flatter than that in normal disk galaxies, which confirms that gas inflows caused by tidal forces during encounters can flatten the metallicity distributions in galaxies. The companion galaxy NGC 7752 is currently experiencing a galaxy-wide starburst with higher surface density of star formation rate than the main galaxy NGC 7753, which can be explained that the companion galaxy is more susceptible to the effects of interaction than the primary. We also find that the galaxy 2MASX J23470758+2926531 has similar abundance and star formation properties to NGC 7753, and may be a part of the Arp 86 system.

  20. Overexpression of CDC25B, CDC25C and phospho-CDC25C (Ser216) in vulvar squamous cell carcinomas are associated with malignant features and aggressive cancer phenotypes

    International Nuclear Information System (INIS)

    CDC25 phosphatases are important regulators of the cell cycle. Their abnormal expression detected in a number of tumors implies that their dysregulation is involved in malignant transformation. However, the role of CDC25s in vulvar cancer is still unknown. To shed light on their roles in the pathogenesis and to clarify their prognostic values, expression of CDC25A, CDC25B and CDC25C in a large series of vulvar squamous cell carcinomas were examined. Expression of CDC25A, CDC25B, CDC25C and phosphorylated (phospho)-CDC25C (Ser216) were examined in 300 vulvar carcinomas using immunohistochemistry. Western blot analysis was utilized to demonstrate CDC25s expression in vulvar cancer cell lines. Kinase and phosphatase assays were performed to exclude cross reactivity among CDC25s isoform antibodies. High nuclear CDC25A and CDC25B expression were observed in 51% and 16% of the vulvar carcinomas, respectively, whereas high cytoplasmic CDC25C expression was seen in 63% of the cases. In cytoplasm, nucleus and cytoplasm/nucleus high phospho-CDC25C (Ser216) expression was identified in 50%, 70% and 77% of the carcinomas, respectively. High expression of CDC25s correlated significantly with malignant features, including poor differentiation and infiltration of vessel for CDC25B, high FIGO stage, presence of lymph node metastases, large tumor diameter, poor differentiation for CDC25C and high FIGO stage, large tumor diameter, deep invasion and poor differentiation for phospho-CDC25C (Ser216). In univariate analysis, high expression of phospho-CDC25C (Ser216) was correlated with poor disease-specific survival (p = 0.04). However, such an association was annulled in multivariate analysis. Our results suggest that CDC25C and phospho-CDC25C (Ser216) play a crucial role and CDC25B a minor role in the pathogenesis and/or progression of vulvar carcinomas. CDC25B, CDC25C and phospho-CDC25C (Ser216) were associated with malignant features and aggressive cancer phenotypes. However, the

  1. THE FIRST Hi-GAL OBSERVATIONS OF THE OUTER GALAXY: A LOOK AT STAR FORMATION IN THE THIRD GALACTIC QUADRANT IN THE LONGITUDE RANGE 216.°5 ∼< l ∼< 225.°5

    International Nuclear Information System (INIS)

    We present the first Herschel PACS and SPIRE photometric observations in a portion of the outer Galaxy (216.°5 ∼–1.0±0.2. Finally, we use a luminosity versus mass diagram to infer the evolutionary status of the sources, finding that most of the proto-stellar sources are in the early accretion phase (with some cases compatible with a Class I stage), while for pre-stellar sources, in general, accretion has not yet started

  2. IUPAC critical evaluation of the rotational–vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O

    International Nuclear Information System (INIS)

    This paper is the fourth of a series of papers reporting critically evaluated rotational–vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D216O, D217O, and D218O. The MARVEL (Measured Active Rotational–Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0–14 016, 0–7969, and 0–9108 cm−1 for D216O, D217O, and D218O, respectively. For D216O, D217O, and D218O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D216O, D217O, and D218O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm−1, from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved. - Highlights: • All published transitions are collected and analyzed. • A set of validated rovibrational transitions are presented. • Experimental energy levels for all three D2O isotopologues are determined. • Synthetic spectra are presented using these validated energy levels

  3. Cultivando Boas Práticas: a RDC-216/04 e a Cultura Organizacional na Perspectiva dos Gestores de Três Restaurantes Self-Services em Uberlândia-MG

    OpenAIRE

    Luciana Resende Ávila; Valdir Machado Valadão Júnior

    2010-01-01

    This research aims to reveal how the procedures established by the Anvisa resolution RDC-216/04 influence the organizational culture of self-services restaurants in Uberlandia, under their managers perspective. The research is qualitative and descriptive. The method applied was the comparative case study. The techniques used for data collecting were organizational document analysis, observation and semi-structured interviews. For the results analysis it was applied the techniques of content a...

  4. Corrosion behavior oa A216 Grade WCA mild steel and Ti Grade 12 alloy in hydrothermal brines: Salt Repository Project: Annual report, FY 1986

    International Nuclear Information System (INIS)

    The present document describes work performed at PNL during FY 1985 and FY 1986 that was directed toward characterizing the corrosion behavior of the candidate barrier materials in salt-repository- relevant, hydrothermal brine environments. The significant degradation modes of the materials were evaluated and prioritized, and the corresponding corrosion and environmental-mechanical work was performed. The objective of the work was to augment the material performance data base that will ultimately be used in the development of the predictive degradation models required for waste package licensing. The specific experimental objectives of the work performed through FY 1986 have been to quantify, to the degree possible, the rates of general corrosion of A216 steel; the susceptibility of this material to pitting, crevice corrosion, and stress-corrosion cracking; and the susceptibility of Ti Grade 12 to crevice corrosion and hydrogen absorption. These are the degradation modes judged potentially most deleterious (with the possible exception, for Ti Grade 12, of hydrogen-induced delayed failure) to the application of the two candidate barrier materials in a salt repository environment. 64 refs., 69 figs., 25 tabs

  5. Perfusion pattern and time of vascularisation with CEUS increase accuracy in differentiating between benign and malignant tumours in 216 musculoskeletal soft tissue masses

    Energy Technology Data Exchange (ETDEWEB)

    De Marchi, Armanda, E-mail: armanda.demarchi@tiscali.it [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Prever, Elena Brach del, E-mail: elena.brach@unito.it [Department of OrthopaedicOncology and ReconstructiveSurgery, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Cavallo, Franco, E-mail: franco.cavallo@unito.it [Department of Public health and Paediatrics, University of Turin, Via Santena 5-bis, 10126 Torino (Italy); Pozza, Simona, E-mail: simona.pozza@tin.it [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Linari, Alessandra, E-mail: linaralessandra@libero.it [Department of Pathology, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, Regina Margherita Hospital, Piazza Polonia, 10126 Torino (Italy); Lombardo, Paolo, E-mail: pao.lombardo82@gmail.com [Department of DiagnosticImaging and Radiotherapy of the University of Turin, Azienda Ospedaliero-Universitaria Città della Salute e della Scienza di Torino, Via Genova 3, 10126 Torino (Italy); Comandone, Alessandro, E-mail: alessandro.comandone@gradenigo.it [Department of Oncology, Gradenigo Hospital, Corso Regina Margherita, 8/10.10153 Torino (Italy); Piana, Raimondo, E-mail: raimondo.piana@libero.it [Department of OrthopaedicOncology and ReconstructiveSurgery, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Faletti, Carlo [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy)

    2015-01-15

    Introduction: Musculoskeletal Soft Tissue Tumours (STT) are frequent heterogeneous lesions. Guidelines consider a mass larger than 5 cm and deep with respect to the deep fascia potentially malignant. Contrast Enhanced Ultrasound (CEUS) can detect both vascularity and tumour neoangiogenesis. We hypothesised that perfusion patterns and vascularisation time could improve the accuracy of CEUS in discriminating malignant tumours from benign lesions. Materials and methods: 216 STT were studied: 40% benign lesions, 60% malignant tumours, 56% in the lower limbs. Seven CEUS perfusion patterns and three types of vascularisation (arterial-venous uptake, absence of uptake) were applied. Accuracy was evaluated by comparing imaging with the histological diagnosis. Univariate and multivariate analysis, Chi-square test and t-test for independent variables were applied; significance was set at p < 0.05 level, 95% computed CI. Results: CEUS pattern 6 (inhomogeneous perfusion), arterial uptake and location in the lower limb were associated with high risk of malignancy. CEUS pattern has PPV 77%, rapidity of vascularisation PPV 69%; location in the limbs is the most sensitive indicator, but NPV 52%, PPV 65%. The combination of CEUS-pattern and vascularisation has 74% PPV, 60% NPV, 70% sensitivity. No correlation with size and location in relation to the deep fascia was found. Conclusion: US with CEUS qualitative analysis could be an accurate technique to identify potentially malignant STT, for which second line imaging and biopsy are indicated in Referral Centers. Intense inhomogeneous enhancement with avascular areas and rapid vascularisation time could be useful in discriminating benign from malignant SST, overall when the lower limbs are involved.

  6. A possible preseismic anomaly in the ground wave of a radio broadcasting (216 kHz during July-August 1998 (Italy

    Directory of Open Access Journals (Sweden)

    P. F. Biagi

    2005-01-01

    Full Text Available On February 1996, a receiver able to measure the electric field strength of LF radio broadcastings, with a sampling frequency of ten minutes, was put into operation in a site (AS located in central Italy. One of the broadcasting stations selected is MCO (f=216 kHz, located in southeast France, 518 km far from the receiver. The MCO data collected since February 1996 up to September 2004 were examined and, at first, the night time data and the day time data (in winter and summer were separated. Then, the wavelet analysis on the night and day time data was applied. The main result of the analysis was the appearance of a very clear anomaly during summer (July–August 1998, at day time and at night time. The anomaly is a strong exaltation of the signal components with period in the 25–40 days range. Theoretical calculations of electric field strength were made and the only way to justify this anomaly seems to be the occurrence of an increase of the ground wave propagation mode of the radio signal. Such an increase could have been produced by an increase of the ground conductivity and by modifications of some parameter of the troposphere, mainly the refractive index. On 15 August 1998 a seismic sequence started with 17 earthquakes (M=2.2–4.6 on the Reatini mountains, a seismogenic zone located 30 km far from the AS receiver along the path MCO-AS. In this paper, the possibility that the previous radio anomaly can be a precursor of this seismic sequence is proposed.  

  7. Perfusion pattern and time of vascularisation with CEUS increase accuracy in differentiating between benign and malignant tumours in 216 musculoskeletal soft tissue masses

    International Nuclear Information System (INIS)

    Introduction: Musculoskeletal Soft Tissue Tumours (STT) are frequent heterogeneous lesions. Guidelines consider a mass larger than 5 cm and deep with respect to the deep fascia potentially malignant. Contrast Enhanced Ultrasound (CEUS) can detect both vascularity and tumour neoangiogenesis. We hypothesised that perfusion patterns and vascularisation time could improve the accuracy of CEUS in discriminating malignant tumours from benign lesions. Materials and methods: 216 STT were studied: 40% benign lesions, 60% malignant tumours, 56% in the lower limbs. Seven CEUS perfusion patterns and three types of vascularisation (arterial-venous uptake, absence of uptake) were applied. Accuracy was evaluated by comparing imaging with the histological diagnosis. Univariate and multivariate analysis, Chi-square test and t-test for independent variables were applied; significance was set at p < 0.05 level, 95% computed CI. Results: CEUS pattern 6 (inhomogeneous perfusion), arterial uptake and location in the lower limb were associated with high risk of malignancy. CEUS pattern has PPV 77%, rapidity of vascularisation PPV 69%; location in the limbs is the most sensitive indicator, but NPV 52%, PPV 65%. The combination of CEUS-pattern and vascularisation has 74% PPV, 60% NPV, 70% sensitivity. No correlation with size and location in relation to the deep fascia was found. Conclusion: US with CEUS qualitative analysis could be an accurate technique to identify potentially malignant STT, for which second line imaging and biopsy are indicated in Referral Centers. Intense inhomogeneous enhancement with avascular areas and rapid vascularisation time could be useful in discriminating benign from malignant SST, overall when the lower limbs are involved

  8. Formación de la Aleación Zn-21.6%Al-2.0%Cu por Pulvimetalurgia: Efecto del Lubricante en las Briquetas Formation of Zn-21.6%Al-2.0%Cu Alloy by Powder Metallurgy: Effect of the Lubricant in Briquettes

    Directory of Open Access Journals (Sweden)

    José A Aragón

    2008-01-01

    Full Text Available En este trabajo se presenta la elaboración de la aleación Zn-21.6%Al-2.0%Cu (porcentajes en masa, por un método de metalurgia de polvos y se analiza el efecto de distintos lubricantes, usados en las briquetas. Se elaboraron mezclas de polvos de Zn, Al y Cu con acetona, cera y ácido esteárico como lubricantes, y se compactaron uniaxialmente a una presión de 77.4 MPa. Las briquetas se sinterizaron bajo un flujo de argón y en intervalos de 15 minutos a 357 °C. Los materiales fueron caracterizados estructuralmente con microscopio óptico, ensayos de microdureza Vickers, dureza Rockwell F y difracción de rayos X. El ácido esteárico y la cera funcionan similarmente como lubricantes y la acetona retarda la formación de la aleación, pero causa mayores durezas, luego del sinterizado. La aleación se forma totalmente cuando el lubricante es cera y se sinteriza más de 45 minutos. La rapidez de formación de la aleación depende del tipo de lubricante en las briquetas.In this work the elaboration of Zn-21.6%Al-2.0%Cu alloy (mass percentages, prepared by a method of powder metallurgy and the effect of different lubricants used in the briquettes were studied. Mixtures of powders of Zn, Al and Cu with acetone, wax and stearic acid as lubricants were prepared and compacted up to a pressure of 77.4 Mpa. The briquettes were sintered under argon flux and at intervals of 15 and 45 minutes at 357° C. The materials were structurally characterized by optical microscopy, micro-hardness Vickers, hardness Rockwell F tests and X-rays diffraction. The stearic acid and wax work similar to lubricants and acetone slows down the formation of the alloy, but it causes greater hardnesses after sintering. The alloy is completely formed when the lubricant is wax and the sintering time is more than 45 minutes. The velocity of formation of the alloy depends on the type of lubricant in the briquettes.

  9. Produção de brotos de soja utilizando a cultivar BRS 216: caracterização físico-química e teste de aceitabilidade Production of soybean sprouts from the cultivar BRS 216: physical and chemical characterization and acceptability test

    Directory of Open Access Journals (Sweden)

    Marcelo Alvares de Oliveira

    2013-03-01

    Full Text Available O presente trabalho teve por objetivo avaliar os parâmetros físico-químicos e os processos para a produção de brotos de soja a partir de sementes da cultivar BRS 216, bem como sua composição química e aceitabilidade. Foram avaliados o comprimento e o peso dos brotos viáveis, a composição centesimal e os teores de isoflavonas e de inibidor de tripsina. O desenho experimental foi ao acaso com três repetições e os tratamentos foram avaliados num esquema fatorial 3 × 3: três frequências de irrigação (a cada quatro, oito e 12 horas e três períodos de crescimento (cinco, seis e sete dias. O teste de aceitabilidade dos brotos de soja foi realizado utilizando-se a escala hedônica estruturada de nove pontos, avaliando-se cor, aparência, odor, textura, sabor e avaliação global, além da intenção de compra. A frequência de irrigação com intervalos de quatro horas e o período de sete dias de crescimento foram ideais para produção dos brotos de soja, favorecendo maior produtividade, teores mais elevados de proteínas e menores teores de inibidor de tripsina. O índice de aceitabilidade dos brotos de soja foi superior a 70 em todas as características avaliadas, com exceção do odor.The aim of the present study was to evaluate the physical and chemical parameters and process for the production of soybean sprouts from the BRS 216 cultivar, as well as determining their chemical composition and acceptability. The length and weight of viable sprouts, proximate composition, and the isoflavone and trypsin inhibitor contents were evaluated. The experimental design was completely randomized with three replications, and the treatments were evaluated using a 3 × 3 factorial design: three irrigation frequencies (four, eight and 12 hours and three growth periods (five, six and seven days. The soybean sprout acceptability was determined using a nine point structured hedonic scale, evaluating colour, appearance, aroma, texture, flavour

  10. 哈茨木霉T_(2-16)菌剂不同使用方法对花生防病促生长效果的研究%Effect of Different Application Methods of Trichoderma harzianum T2-16 on Peanut Growth Promotion and Disease Prevention

    Institute of Scientific and Technical Information of China (English)

    王献慧; 梁志怀; 魏林; 陈玉荣; 张屹

    2012-01-01

    应用哈茨木霉菌T2-16菌剂对花生进行木霉拌种和浸种处理,研究木霉对花生防病促生长的效果。结果表明,供试木霉菌剂两种使用方法对病害防治效果和促生长作用均好于对照,其中木霉菌剂拌种处理的效果又优于浸种处理。拌种处理后荚果产量、饱果产量和籽仁产量分别比对照提高了32.4%、36.8%和33.8%,而其秕果重量比对照降低了29.8%,其叶斑病发病率比对照降低了8.79%,防效为64.63%,其烂果数比对照少了3.18个,防效为60.6%。%Seed dressing and seed soaking with Trichoderma harzianum T2-16 were applied to pea- nut in order to research the effect of Trichoderma on disease prevention and growth promotion in pea- nut. Results indicated that the effect of two application methods of Trichoderma on disease prevention and growth promotion was better than the control, and the effect of Trichoderma dressed seed was better than that of Trichoderrna soaked seed. The pod yield, the plump pod yield and the kernel yield of peanut treated by seed dressing were 32.3%, 36.8% and 33.8% more than that of control, respec- tively. Its blighted pod weight was 29.8% less than that of control. The incidence of leaf spot was 8.79% less than that of control, which showed the efficiency of disease prevention was 64.6 %. The number of rotten pod was 3.18 less than that control, which showed the efficiency of disease prevention was 60.6%.

  11. Phosphorylation of transglutaminase 2 (TG2 at serine-216 has a role in TG2 mediated activation of nuclear factor-kappa B and in the downregulation of PTEN

    Directory of Open Access Journals (Sweden)

    Wang Yi

    2012-07-01

    Full Text Available Abstract Background Transglutaminase 2 (TG2 and its phosphorylation have been consistently found to be upregulated in a number of cancer cell types. At the molecular level, TG2 has been associated with the activation of nuclear factor-kappa B (NF-κB, protein kinase B (PKB/Akt and in the downregulation of phosphatase and tensin homologue deleted on chromosome 10 (PTEN. However, the underlying mechanism involved is not known. We have reported that protein kinase A (PKA induced phosphorylation of TG2 at serine-216 (Ser216 regulates TG2 function and facilitates protein-protein interaction. However, the role of TG2 phosphorylation in the modulation of NF-κB, Akt and PTEN is not explored. Methods In this study we have investigated the effect of TG2 phosphorylation on NF-κB, Akt and PTEN using embryonic fibroblasts derived from TG2 null mice (MEFtg2-/- overexpressing native TG2 or mutant-TG2 (m-TG2 lacking Ser216 phosphorylation site with and without dibutyryl cyclic-AMP (db-cAMP stimulation. Functional consequences on cell cycle and cell motility were determined by fluorescence activated cell sorting (FACS analysis and cell migration assay respectively. Results PKA activation in TG2 overexpressing MEFtg2-/- cells resulted in an increased activation of NF-κB and Akt phosphorylation in comparison to empty vector transfected control cells as determined by the reporter-gene assay and immunoblot analysis respectively. These effects were not observed in MEFtg2-/- cells overexpressing m-TG2. Similarly, a significant downregulation of PTEN at both, the mRNA and protein levels were found in cells overexpressing TG2 in comparison to empty vector control and m-TG2 transfected cells. Furthermore, Akt activation correlated with the simultaneous activation of NF-κB and a decrease in PTEN suggesting that the facilitatory effect of TG2 on Akt activation occurs in a PTEN-dependent manner. Similar results were found with MCF-7 and T-47D breast cancer cells

  12. Cultivando Boas Práticas: a RDC-216/04 e a Cultura Organizacional na Perspectiva dos Gestores de Três Restaurantes Self-Services em Uberlândia-MG

    Directory of Open Access Journals (Sweden)

    Luciana Resende Ávila

    2010-01-01

    Full Text Available This research aims to reveal how the procedures established by the Anvisa resolution RDC-216/04 influence the organizational culture of self-services restaurants in Uberlandia, under their managers perspective. The research is qualitative and descriptive. The method applied was the comparative case study. The techniques used for data collecting were organizational document analysis, observation and semi-structured interviews. For the results analysis it was applied the techniques of content analysis and speech analysis under the triangulation perspective. The research findings showed homogeneities and heterogeneities in the interpretation of the managers on how that legislation brought influences to their organizational culture. Managers belonging to the same establishment diverged in their considerations about the relevance of certain procedures established by the resolution in the routine of their activities, although at the same time there were favorable and consistent interpretations among the interviewees, independent of belonging or not to the same organization.

  13. Survey of organophosphate resistance and an Ala216Ser substitution of acetylcholinesterase-1 gene associated with chlorpyrifos resistance in Apolygus lucorum (Meyer-Dür) collected from the transgenic Bt cotton fields in China.

    Science.gov (United States)

    Zhen, Congai; Miao, Ling; Liang, Pei; Gao, Xiwu

    2016-09-01

    The mirid bug is frequently controlled by the application of organophosphorus insecticides in the transgenic Bt cotton field of China. A topical bioassay method was performed to evaluate the toxicities of chlorpyrifos and malathion towards field-collected Chinese populations of Apolygus lucorum from transgenic Bt cotton fields. For chlorpyrifos, the resistance ratios ranged from 0.8 to 9.4-fold compared to a susceptible strain. For malathion, the resistance levels relative to the susceptible strain ranged from 1.2 to 14.4-fold. Compared to a susceptible strain, the Cangzhou population from Hebei province showed the highest resistance ratios towards these insecticides. A comparison of the detoxifying and target enzyme activities between the Cangzhou population and a susceptible strain revealed that altered acetylcholinesterase possibly account for the chlorpyrifos and malathion resistance in the Cangzhou population. Two acetylcholinesterase (AChE-encoding) genes (designated Alace1 and Alace2) from the green mirid bug (A. lucorum) were identified. The Alace1 and Alace2 genes encoded 597 and 645 amino acids, respectively. Both AChE proteins had conserved motifs including a catalytic triad, a choline-binding site, and an acyl pocket. Quantitative real-time PCR analysis showed that Alace1 had a much higher transcriptional level than Alace2, for the expression profiles of both spatial and time distributions. One amino acid substitution, Ala216Ser in Alace1, was found in the Cangzhou population. These results suggest that the mutation Ala216Ser should be most likely involved in organophosphorus resistance in A. lucorum. PMID:27521910

  14. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Directory of Open Access Journals (Sweden)

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  15. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  16. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  17. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  18. Complete 2mm Spectral Line Survey (130-170 GHz) of Sgr B2N, Sgr B2OH, IRC +10 216, Orion (KL), Orion-S, W51M, and W3(IRS5)

    CERN Document Server

    Remijan, Anthony J; Markwick-Kemper, A J; Turner, B E

    2008-01-01

    We report a complete 2mm spectral line survey (130-170 GHz) taken with the NRAO 12m Telescope between 1993 and 1995 toward the following sources: Sgr B2N, Sgr B2OH, IRC +10 216, Orion (KL), Orion-S, W51M, and W3(IRS5). Until very recently, this project was entirely the work of B. E. Turner. He wrote the original proposal, given below without changes or updates, and did all of the observing. B.E. Turner has fallen seriously ill and can no longer continue to work on the analysis of these data. The notes that follow the proposal give further information about the project and important information for users of these data. The data are distributed using the Spectral Line Search Engine (SLiSE) developed by A. J. Remijan and M. J. Remijan. SLiSE is a data display tool that will contain all the fully reduced and calibrated archived data taken as part of this 2mm survey. SLiSE is fast, easy to use, and contains the necessary functionality to display the data taken from spectral line searches. For example, SLiSE contai...

  19. THE FIRST Hi-GAL OBSERVATIONS OF THE OUTER GALAXY: A LOOK AT STAR FORMATION IN THE THIRD GALACTIC QUADRANT IN THE LONGITUDE RANGE 216. Degree-Sign 5 {approx}< l {approx}< 225. Degree-Sign 5

    Energy Technology Data Exchange (ETDEWEB)

    Elia, D.; Molinari, S.; Schisano, E.; Pestalozzi, M.; Benedettini, M.; Di Giorgio, A. M.; Pezzuto, S.; Rygl, K. L. J. [Istituto di Astrofisica e Planetologia Spaziali-INAF, Via Fosso del Cavaliere 100, I-00133 Roma (Italy); Fukui, Y.; Hayakawa, T.; Yamamoto, H. [Department of Physics, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); Olmi, L. [Osservatorio Astrofisico di Arcetri-INAF, Largo E. Fermi 5, I-50125 Firenze (Italy); Veneziani, M. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Schneider, N.; Piazzo, L. [IRFU/SAp CEA/DSM, Laboratoire AIM CNRS, Universit Paris Diderot, F-91191 Gif-sur-Yvette (France); Ikhenaode, D. [DIET-Dipartimento di Ingegneria dell' Informazione, Elettronica e Telecomunicazioni, Universita di Roma La Sapienza, via Eudossina 18, I-00184 Roma (Italy); Mizuno, A. [Solar-Terrestrial Environment Laboratory, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8601 (Japan); Onishi, T. [Department of Physical Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan); Polychroni, D. [Department of Astrophysics, Astronomy and Mechanics, Faculty of Physics, University of Athens, Panepistimiopolis, 15784 Zografos, Athens (Greece); Maruccia, Y., E-mail: davide.elia@iaps.inaf.it [Dipartimento di Matematica e Fisica, Universita del Salento, CP 193, I-73100 Lecce (Italy)

    2013-07-20

    We present the first Herschel PACS and SPIRE photometric observations in a portion of the outer Galaxy (216. Degree-Sign 5 {approx}< l {approx}< 225. Degree-Sign 5 and -2 Degree-Sign {approx}< b {approx}< 0 Degree-Sign ) as a part of the Hi-GAL survey. The maps between 70 and 500 {mu}m, the derived column density and temperature maps, and the compact source catalog are presented. NANTEN CO(1-0) line observations are used to derive cloud kinematics and distances so that we can estimate distance-dependent physical parameters of the compact sources (cores and clumps) having a reliable spectral energy distribution that we separate into 255 proto-stellar and 688 starless sources. Both typologies are found in association with all the distance components observed in the field, up to {approx}5.8 kpc, testifying to the presence of star formation beyond the Perseus arm at these longitudes. Selecting the starless gravitationally bound sources, we identify 590 pre-stellar candidates. Several sources of both proto- and pre-stellar nature are found to exceed the minimum requirement for being compatible with massive star formation based on the mass-radius relation. For the pre-stellar sources belonging to the Local arm (d {approx}< 1.5 kpc) we study the mass function whose high-mass end shows a power law N(log M){proportional_to}M {sup -1.0{+-}0.2}. Finally, we use a luminosity versus mass diagram to infer the evolutionary status of the sources, finding that most of the proto-stellar sources are in the early accretion phase (with some cases compatible with a Class I stage), while for pre-stellar sources, in general, accretion has not yet started.

  20. Near-UV and blue wavelength excitable Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} high efficiency red phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Khanna, A. [Smart Lighting Engineering Research Center, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Electrical Computer and Systems Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Dutta, P.S., E-mail: duttap@rpi.edu [Smart Lighting Engineering Research Center, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Electrical Computer and Systems Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States)

    2015-05-15

    Red phosphors with narrow emission around 615 nm (with FWHM~5–10 nm) having chemical compositions of A{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} (A=Mg, Sr) have been found to exhibit the highest luminescence amongst the molybdate–tungstate family when excited by sources in the 380–420 nm wavelength range. Thus they are most suitable for enhancing color rendering index and lowering color temperature in phosphor converted white LEDs (pc-WLEDs) with near-UV/blue LED excitation sources. The excitation band edge in the near UV/blue wavelength in the reported phosphor has been attributed to the coordination environment of the transition metal ion (Mo{sup 6+}, W{sup 6+}) and host crystal structure. Furthermore the quantum efficiency of the phosphors has been enhanced by adjusting activator concentration, suitable compositional alloying using substitutional alkaline earth metal cations and charge compensation mechanisms. - Graphical abstract: The charge transfer excitation of orthorhombic Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} is significantly higher than tetragonal CaMoO{sub 4}: Eu{sup 3+} phosphors making Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} prime candidates for fabrication of warm white phosphor-converted LEDs. - Highlights: • LED excitable Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} phosphors were synthesized. • These phosphors are 10 times more intense than CaMoO{sub 4}: Eu{sup 3+} red phosphors. • Their intensity and efficiency were enhanced by materials optimization techniques. • Such techniques include compositional alloying, charge compensation, etc.

  1. 8 CFR 216.2 - Notification requirements.

    Science.gov (United States)

    2010-01-01

    ... requirement that the alien and the petitioning spouse or alien entrepreneur must file a petition to remove the... petitioning spouse, or alien entrepreneur of the requirement to file a petition to remove conditions...

  2. 10 CFR 216.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... maximizes domestic energy supplies by furthering the exploration, production, refining, transportation or... related activity. Such term also includes emergency preparedness activities conducted pursuant to title VI of the Robert T. Stafford Disaster Relief and Emergency Assistance Act (42 U.S.C. 5195, et seq.)...

  3. 50 CFR 216.15 - Depleted species.

    Science.gov (United States)

    2010-10-01

    ... these waters. (h) Eastern North Pacific Southern Resident stock of killer whales (Orcinus orca). The... Juan de Fuca, and Puget Sound. (i) AT1 stock of killer whales (Orcinus orca). The stock includes...

  4. 50 CFR 216.254 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... safety for marine mammals with a radius of no less than 5 nm (9.3 km) for single bombs and 10 nm (18.5 km) for double bombs and a buffer zone from the outer edge of the safety zone with a radius of at least 2.5 nm (4.6 km) for single bombs and 5 nm (18.5 km) for double bombs. (b) Prior to a JASSM or...

  5. 32 CFR 216.2 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... Corporation for Public Broadcasting, the Federal Mediation and Conciliation Service, the Federal Mine Safety... National Council on Disability, the National Education Goals Panel, the National Labor Relations Board, the... service in the Department of Homeland Security. The policies herein also affect the Departments...

  6. 50 CFR 216.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... means the species Thunnus thynnus or Thunnus orientalis. Bona fide scientific research: (1) Means scientific research on marine mammals conducted by qualified personnel, the results of which: (i) Likely would be accepted for publication in a refereed scientific journal; (ii) Are likely to contribute to...

  7. 50 CFR 216.105 - Specific regulations.

    Science.gov (United States)

    2010-10-01

    ... MAMMALS General Regulations Governing Small Takes of Marine Mammals Incidental to Specified Activities... activity. (b) For allowed activities that may result in incidental takings of small numbers of...

  8. 50 CFR 216.23 - Native exceptions.

    Science.gov (United States)

    2010-10-01

    ... Alaska Native organization(s). (2) Limitations. (i) Sale of Cook Inlet beluga whale parts and products... section to select the proper cell from the Harvest Table to determine the harvest levels for the next 5...) For purposes of creating and selling authentic native articles of handicraft and clothing, and (3)...

  9. 50 CFR 216.180 - Specified activity.

    Science.gov (United States)

    2010-10-01

    ... (Balaenoptera musculus), fin (Balaenoptera physalus), minke (Balaenoptera acutorostrata), Bryde's (Balaenoptera edeni), sei (Balaenoptera borealis), humpback (Megaptera novaeangliae), North Atlantic right...

  10. 50 CFR 216.244 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... habitat (as designated in 50 CFR Part 226) shall implement the following measures. (A) All torpedo-firing... right whale critical habitat (as designated in 50 CFR part 226) from November 15-April 15. (E) Object... accomplishment of primary operational duties. (xviii) Aircraft with deployed sonobuoys shall use only the...

  11. 50 CFR 216.274 - Mitigation.

    Science.gov (United States)

    2010-10-01

    .... (F) Aircraft with deployed sonobuoys shall use only the passive capability of sonobuoys when marine... would be maintained throughout the exercise. Potential assets include sonobuoys, which can be utilized.... The sonobuoys shall be re-seeded as necessary throughout the exercise. Additionally, passive...

  12. 50 CFR 216.174 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... sonobuoys shall use only the passive capability of sonobuoys when marine mammals are detected within 200.... Explosive source sonobuoys (AN/SSQ-110A) that cannot be scuttled shall be reported as unexploded ordnance... acoustic monitoring shall be maintained throughout the exercise. Potential assets include sonobuoys,...

  13. 20 CFR 216.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... birth corresponding to such numerical age. Board means the Railroad Retirement Board. Claimant means an... filing of another application. Retirement age means, with respect to an employee who attains age 62...(er), or surviving divorced spouse) after December 31, 1999, retirement age means the age provided...

  14. 10 CFR 1015.216 - Exemptions.

    Science.gov (United States)

    2010-01-01

    ... reflect remedies or procedures prescribed by the Debt Collection Act of 1982 and the DCIA, such as... Collection Act of 1982 and the DCIA, to the extent that they are authorized under some other statute or...

  15. 12 CFR 216.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 208.3(g); (2) A bank holding company, as defined in 12 CFR 225.2(c); (3) A subsidiary (as defined in 12 CFR 225.2(o)) or affiliate of a bank holding company and a subsidiary of a State member bank... section 4(k) of the Bank Holding Company Act of 1956 (12 U.S.C. 1843(k)). (2) Financial institution...

  16. Stereotactic gamma knife radiosurgery for brain arteriovenous malformations (A Report of 216 Cases)%立体定向伽玛刀治疗脑动静脉畸型研究

    Institute of Scientific and Technical Information of China (English)

    梁军潮; 徐波涛; 王伟民; 赵刚; 吴鸿勋; 李林; 贺道华; 张聿浩

    2007-01-01

    Objective To evaluate the curative effect of stereotactic gamma knife radiosurgery on brain arteriovenous malformations (AVM).Methods Between July 1995 and May 1998,285 patients with cerebral AVM were treated with Leksell gamma knife,among which we collected the follow-up files of 216 cases fitting our demand,including 162 male and 54 female patients.The mean age of patients was 26.0 years (1.5~83 years).AVM volume ranged from 0.3 to 43.9 cm3 (the mean volume of Spetzler-Martin grading were as follows:grade I 42 cases,grade Ⅱ 68 cases,grade Ⅲ 95 cases,grade Ⅳ 7 cases,grade Ⅴ 4 cases.All the cases were followed up for 17~31 months.156 cases were oriented through conducting magnetic resonance angiography (MRA) with a 1.5 Tesla magnetic resonance system.Results The rates of obliteration and complications after stereotactic gamma knife radiosurgery were significantly related to the target volume,the Spetzlcr-Martin grade,the method of localization,the peripheral dosage and the quality control.The obliteration rate within two years was more than 78.5% in the patients with AVM≤5 cm3 in volume,Spetzler-Martin grade<Ⅲ in Spetzler-Martin grading system or peripheral dosage≥20Gy.4 cases had recurrent hemorrhage after the treatment and 9 cases had complications of obvious symptom of irradiated brain edema.Conclusions Stereotactic gamma knife radiosurgery is an effective and safe method for the brain AVM.There is a higher obliteration rate for AVM of grade Ⅰ-Ⅱ or the volume≤5.0 cm3 and the peripheral dosage≥20Gy.Accurate localization of the lesions by magnetic resonance angiography (MRA) combined with digital subtraction angiography (DSA) contributes to improve the obliteration rate and decrease the complications.%目的 评估伽玛刀(γ-刀)立体定向放射手术治疗脑动静脉畸形(AVM)的疗效;探讨脑AVM的γ-刀治疗定位方法.方法 用立体定向LekseⅡγ-刀放射外科治疗系统对216例脑AVM进行γ-刀立

  17. Molecular clouds and star formation toward the Galactic plane within 216.25° ≤ l ≤ 218.75° and -0.75° ≤ b ≤ 1.25°

    Science.gov (United States)

    Gong, Y.; Mao, R. Q.; Fang, M.; Zhang, S. B.; Su, Y.; Yang, J.; Jiang, Z. B.; Xu, Y.; Wang, M.; Wang, Y.; Lu, D. R.; Sun, J. X.

    2016-04-01

    Context. Molecular clouds trace the spiral arms of the Milky Way and all its star forming regions. Large-scale mapping of molecular clouds will provide an approach to understand the processes that govern star formation and molecular cloud evolution. Aims: As a part of the Milky Way Imaging Scroll Painting (MWISP) survey, the aim is to study the physical properties of molecular clouds and their associated star formation toward the Galactic plane within 216.25° ≤ l ≤ 218.75° and -0.75° ≤ b ≤ 1.25°, which covers the molecular cloud complex S287. Methods: Using the 3 × 3 Superconducting Spectroscopic Array Receiver (SSAR) at the PMO-13.7m telescope, we performed a simultaneous 12CO (1-0), 13CO (1-0), C18O (1-0) mapping toward molecular clouds in a region encompassing 3.75 square degrees. We also make use of archival data to study star formation within the molecular clouds. Results: We reveal three molecular clouds, the 15 km s-1 cloud, the 27 km s-1 cloud, and the 50 km s-1 cloud, in the surveyed region. The 50 km s-1 cloud is resolved with an angular resolution of ~1' for the first time. Investigating their morphology and velocity structures, we find that the 27 km s-1 cloud is likely affected by feedback from the stellar association Mon OB3 and the 50 km s-1 cloud is characterized by three large expanding molecular shells. The surveyed region is mapped in C18O (1-0) for the first time. We discover seven C18O clumps that are likely to form massive stars, and 15 dust clumps based on the Bolocam Galactic Plane Survey (BGPS) archive data. Using infrared color-color diagrams, we find 56 Class I and 107 Class II young stellar object (YSO) candidates toward a slightly larger region of 5.0 square degrees. Based on the distribution of YSO candidates, an overdensity is found around the HII region S287 and the intersection of two shells; this is probably indicative of triggering. The star formation efficiency (SFE) and rate (SFR) of the 27 km s-1 cloud are

  18. 48 CFR 1652.216-70 - Accounting and price adjustment.

    Science.gov (United States)

    2010-10-01

    ... rate reconciliation will be performed. The carrier must promptly pay any amount owed to OPM. Any amount recoverable by the carrier is limited to the amount in the contingency reserve for the terminating plan as...

  19. 27 CFR 40.216a - Notice for pipe tobacco.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Notice for pipe tobacco... Notice for pipe tobacco. (a) Product designation. Every package of pipe tobacco shall, before removal... “pipe tobacco.” (b) Product weight. Every package of pipe tobacco shall, before removal subject to...

  20. 48 CFR 552.216-72 - Placement of Orders.

    Science.gov (United States)

    2010-10-01

    ... parties of certain electronic transaction conventions and to recognize the rights and responsibilities of..., the third party provider(s) through which electronic orders are placed, the transaction sets used... electronic transaction conventions and to recognize the rights and responsibilities of the parties as...

  1. 8 CFR 216.3 - Termination of conditional resident status.

    Science.gov (United States)

    2010-01-01

    ... of termination, the director shall issue a notice to appear in accordance with 8 CFR part 239. During..., whichever is applicable, are true, or it becomes known to the government that an alien entrepreneur who was... applicable, are true, or that an alien entrepreneur who was admitted pursuant to section 203(b)(5) of the...

  2. 50 CFR 216.165 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Shock Testing the USS MESA VERDE (LPD 19... one who has graduated from a veterinary school accredited by the American Veterinary Medical... Response Program. Necropsies will be performed and tissue samples taken from any dead animals....

  3. Dicty_cDB: VSF216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Value (Q54ID4) RecName: Full=Protein LZIC; AltName: Full=Leucine zippe... 220 1e-68 DQ058007_1( DQ058007 |...pid:none) Danio rerio leucine zipper and ICA... 165 7e-44 BT079000_1( BT079000 |pid:none) Esox lucius clone ...eluc-evq-514-298... 164 9e-44 (Q6DHH7) RecName: Full=Protein LZIC; AltName: Full=...e) Sequence 142 from Patent EP1661986. 161 4e-42 (Q8WZA0) RecName: Full=Protein LZIC; AltName: Full=Leucine ...zippe... 161 4e-42 (Q5PQN7) RecName: Full=Protein LZIC; AltName: Full=Leucine zip

  4. 50 CFR 216.241 - Effective dates and definitions.

    Science.gov (United States)

    2010-10-01

    ... MAMMALS Taking and Importing Marine Mammals; U.S. Navy's Atlantic Fleet Active Sonar Training (AFAST... pair of any of the following marine mammals of concern: beaked whale of any species, dwarf or...

  5. Dicty_cDB: AFH216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BM260251.1 baa17f06.x1 Cassava EYC library1 Manihot esculenta cDNA 3' similar to...SC cDNA library Populus alba x Populus glandulosa cDNA clone PopSC00059, mRNA sequence. 46 1e-06 2 BM260251

  6. 12 CFR Appendix A to Part 216 - Model Privacy Form

    Science.gov (United States)

    2010-01-01

    ... conspicuous direct link to the opt-out page. The opt-out choices made available to the consumer who contacts...; credit history; credit scores; assets; investment experience; credit-based insurance scores; insurance... the FCRA and 12 CFR part 222, subpart C, with respect to the initial notice and opt-out and...

  7. 50 CFR 216.104 - Submission of requests.

    Science.gov (United States)

    2010-10-01

    ... MAMMALS General Regulations Governing Small Takes of Marine Mammals Incidental to Specified Activities... authorizing the taking by U.S. citizens of small numbers of marine mammals incidental to a specified...

  8. 48 CFR 1552.216-77 - Award term incentive.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Award term incentive. 1552... Award term incentive. As prescribed in 1515.406(c), insert a clause substantially the same as follows: Award Term Incentive (FEB 2008) (a) General. This contract may be extended as set forth in paragraph...

  9. 48 CFR 1552.216-78 - Award term incentive plan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Award term incentive plan... Award term incentive plan. As prescribed in 1515.406(c), insert a clause substantially the same as follows: Award Term Incentive Plan (FEB 2008) (a) The Award Term Incentive Plan provides for...

  10. 50 CFR 216.242 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... annually). (G) Blue whale (Balaenoptera musculus)—4005 (an average of 801 annually). (ii) Odontocetes: (A... of 4202 annually). (C) Minke whale (Balaenoptera acutorostrata)—2075 (an average of 415 annually). (D) Sei whale (Balaenoptera borealis)—5285 (an average of 1057 annually). (E) Fin whale...

  11. 50 CFR 216.272 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... novaeangliae)—110 (an average of 22 annually) (B) Fin whale (Balaenoptera physalus)—870 (an average of 174 annually) (C) Blue whale (Balaenoptera musculus)—3085 (an average of 617 annually) (D) Minke whale (Balaenoptera acutorostrata)—665 (an average of 133 annually) (E) Gray whale (Eschrichtius robustus)—27340...

  12. 36 CFR 223.216 - Special Forest Products definitions.

    Science.gov (United States)

    2010-07-01

    ..., Christmas trees, cones, ferns, firewood, forbs, fungi (including mushrooms), grasses, mosses, nuts, pine..., derrick poles, minerals, animals, animal parts, insects, worms, rocks, water, and soil....

  13. 28 CFR 21.6 - Proceedings in forma pauperis.

    Science.gov (United States)

    2010-07-01

    ...) Civil cases. There are currently no provisions for payment of witnesses called by the indigent. If the indigent party prevails, witness fees and expenses may be taxed as costs in accordance with 28 U.S.C. 1920... subpoenaed on behalf of an indigent defendant be paid in the same manner as witnesses called on behalf of...

  14. 50 CFR 216.172 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... dolphin (Tursiops truncatus)—3670 ( an average of 734 annually). (I) Pan-tropical dolphins (Stenella attenuata)—10995 (an average of 2199 annually). (J) Spinner dolphins (Stenella longirostris)—2105 (an... (Peponocephala electra), Pantropical spotted dolphin (Stenella attenuata), Pygmy killer whale (Feresa...

  15. Dicty_cDB: SSD216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SEQUENCE, 13 unordered pieces. 52 0.008 1 CD035209 |CD035209.1 mgmt019xA08f.b Ma...ted culture Magnaporthe grisea cDNA clone mgmt019xA08 5', mRNA sequence. 52 0.008 1 AF160643 |AF160643.2 D02

  16. 50 CFR 216.245 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... to categorize in any way, the observed behavior of the animals (such as animal closing to bow ride... explosive detonations. The Navy shall provide NMFS with species or description of the animal(s), the condition of the animal(s) (including carcass condition if the animal is dead), location, time of...

  17. Dicty_cDB: CFK216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sllmkinselhqamkp*wklsri*kprttefqslkmkl ml*iyy*mksqkvlkscalavvplmksvsrkfisvmilhsst...sllmkinselhqamkp*wklsri*kprtte fqslkmklml*iyy*mksqkvlkscalavvplmksvsrkfisvmilhsstfikrf*lyql inklmlvkml*phntf

  18. 50 CFR 216.37 - Marine mammal parts.

    Science.gov (United States)

    2010-10-01

    ...: (1) The person transferring the part receives no remuneration of any kind for the marine mammal part... specifically authorized by the Regional Director, consistent with the requirements of paragraphs (a)(1) and (a... Regional Director of the transfer, including a description of the part, the person to whom the part...

  19. 24 CFR 884.216 - Termination of tenancy.

    Science.gov (United States)

    2010-04-01

    ... domestic violence, dating violence, stalking, or criminal activity directly related to domestic violence...). Failure of the family to sign and submit consent forms for the obtaining of wage and claim information from State Wage Information Collection Agencies, as provided by 24 CFR part 5, shall be grounds...

  20. 50 CFR 216.175 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ship (opening, closing, parallel). (N) Observed behavior—Watchstanders shall report, in plain language... plain language and without trying to categorize in any way, the observed behavior of the animal(s)...

  1. Education in Healthy Lifestyles: Curriculum Implications. Fastback 216.

    Science.gov (United States)

    Seffrin, John R.; Torabi, Mohammad R.

    The nature of a healthy lifestyle and its significance to quality of life is examined. Following a discussion on what is involved in a healthy lifestyle, major health problems are described: (1) smoking; (2) alcohol and drug abuse; (3) sexually transmitted diseases; (4) diet and obesity; (5) stress; and (6) inadequate sleep. Recommendations are…

  2. 48 CFR 216.601 - Time-and-materials contracts.

    Science.gov (United States)

    2010-10-01

    ... contract type for non-commercial items if the price is expected to be based on adequate competition. ...-Hour Proposal Requirements—Non-Commercial Item Acquisition with Adequate Price Competition, with 252... SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS...

  3. 48 CFR 852.216-70 - Estimated quantities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Estimated quantities. 852... Estimated quantities. As prescribed in 816.504(a), insert the following clause: Estimated Quantities (APR... percent of the estimated requirement or which provide that the Government shall guarantee any...

  4. 48 CFR 1352.216-70 - Estimated and allowable costs.

    Science.gov (United States)

    2010-10-01

    ... Estimated and allowable costs. As prescribed in 48 CFR 1316.307(a), insert the following clause: Estimated and Allowable Costs (APR 2010) (a) Estimated Costs. The estimated cost of this contract is... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Estimated and...

  5. 50 CFR 216.185 - Requirements for monitoring.

    Science.gov (United States)

    2010-10-01

    ... SURTASS LFA sonar transmission; (2) Continue between transmission pings; and (3) Continue either for at least 15 minutes after completion of the SURTASS LFA sonar transmission exercise, or, if marine mammals are exhibiting unusual changes in behavioral patterns, for a period of time until behavior...

  6. 22 CFR 1203.735-216 - Miscellaneous statutory provisions.

    Science.gov (United States)

    2010-04-01

    ... Government (18 U.S.C. 285). (15) The prohibition against political activities in subchapter III of chapter 73... (18 U.S.C. 219). (17) The prohibition against discrimination because of politics, race, religion,...

  7. 50 CFR 216.275 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... adaptive management tool shall include: (1) A method for prioritizing monitoring projects that clearly...—indication of whale/dolphin/pinniped) (C) Number of individuals (D) Calves observed (y/n) (E) Initial...) Species (if not possible, indicate whale, dolphin or pinniped) (C) Number of individuals (D)...

  8. 48 CFR 352.216-70 - Additional cost principles.

    Science.gov (United States)

    2010-10-01

    ... needed to support the bids, proposals, and applications. (2) B & P costs of the current accounting period are allowable as indirect costs. (3) B & P costs of past accounting periods are unallowable in...

  9. 48 CFR 552.216-73 - Ordering Information.

    Science.gov (United States)

    2010-10-01

    ... transmission or □ computer-to-computer Electronic Data Interchange (EDI). (b) An offeror electing to receive computer-to-computer EDI is requested to indicate below the name, address, and telephone number of the representative to be contacted regarding establishment of an EDI interface. (c) An offeror electing to...

  10. Dicty_cDB: VSD216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HSP's gapped (non-prelim): 0 length of query: 90 length of database: 80,480,566 effective... HSP length: 16 effective length of query: 74 effective length of database: 78,918,790 effective se...uery: 90 length of database: P,794,892,705 effective HSP length: 21 effective length of query: 69 effective ...length of database: P,261,936,330 effective search space: 2226073606770 effective search space used: 2226073...arch space: 5839990460 effective search space used: 5839990460 T: 0 A: 0 X1: 6 (11.9 bits) X2: 15 (29.7 bits

  11. 50 CFR 216.217 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ..., and any other Federal, state or local agency with regulatory authority over the offshore oil-and-gas...) Acoustic surveys will be run concurrent with requisite pre-detonation surveys, beginning with the surface observations and concluding at the finish of the aerial surveys when the detonation(s) is allowed to...

  12. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  13. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE,CERN

    OpenAIRE

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spec...

  14. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  15. 12 CFR 216.6 - Information to be included in privacy notices.

    Science.gov (United States)

    2010-01-01

    ... examples to illustrate the types of third parties in each category. (i) Financial service providers; (ii) Non-financial companies; and (iii) Others. (4) Disclosures under exception for service providers and... SYSTEM PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Privacy and Opt Out Notices §...

  16. 48 CFR 552.216-71 - Economic Price Adjustment-Special Order Program Contracts.

    Science.gov (United States)

    2010-10-01

    ... adjustment, a maximum of ___*___ percent shall apply. Any price adjustment for the product code shall be... first option period, any price adjustment for the product code shall be based upon the percentage change... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Economic Price...

  17. 42 CFR 57.216 - What additional Department regulations apply to schools?

    Science.gov (United States)

    2010-10-01

    ...—Nondiscrimination on the basis of sex in education programs and activities receiving or benefiting from Federal... limited to: 45 CFR part 76—Governmentwide Debarment and Suspension (nonprocurement) and Governmentwide Requirements for Drug-Free Workplace (Grants) 45 CFR part 80—Nondiscrimination under programs receiving...

  18. 18 CFR 380.16 - Environmental reports for section 216 Federal Power Act Permits.

    Science.gov (United States)

    2010-04-01

    ... may substitute “survey centerline stationing” if so preferred. However, whatever method is chosen must... proposed facility and operational site on sugar maple stands, orchards and nurseries, landfills,...

  19. 50 CFR 216.22 - Taking by State or local government officials.

    Science.gov (United States)

    2010-10-01

    ... sick, it shall be permissible to place it in temporary captivity until such time as it is able to be... in accordance with this subsection whether the animal is dead at the time of taking or dies... Secretary, the report shall contain a description of: (1) The animal involved; (2) The...

  20. 20 CFR 216.42 - How a private railroad pension affects a supplemental annuity.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How a private railroad pension affects a... pension affects a supplemental annuity. (a) What is a private railroad pension. The Board determines whether a pension established by a railroad employer is a private pension that will cause a reduction...

  1. 216-Day report for Tank 241-C-111, cores 58 and 59

    International Nuclear Information System (INIS)

    Three core samples from tank C-111, and a field blank, were received by the 222-S laboratories. Cores 58, 59, and the field blank were analyzed in accordance with plans. A hot cell blank was analyzed at the direction of the hot cell chemist. No sample results exceeded the notification limits. Core 60 was not analyzed

  2. W-026 acceptance test plan plant control system hardware (submittal {number_sign} 216)

    Energy Technology Data Exchange (ETDEWEB)

    Watson, T.L., Fluor Daniel Hanford

    1997-02-14

    Acceptance Testing of the WRAP 1 Plant Control System Hardware will be conducted throughout the construction of WRAP I with the final testing on the Process Area hardware being completed in November 1996. The hardware tests will be broken out by the following functional areas; Local Control Units, Operator Control Stations in the WRAP Control Room, DMS Server, PCS Server, Operator Interface Units, printers, DNS terminals, WRAP Local Area Network/Communications, and bar code equipment. This document will contain completed copies of each of the hardware tests along with the applicable test logs and completed test exception reports.

  3. 7 CFR 2.16 - Under Secretary for Farm and Foreign Agricultural Services.

    Science.gov (United States)

    2010-01-01

    ... products and general economic analyses of the international financial and monetary aspects of agricultural... information gathering and access requests and orders; compliance with Federal health and safety standards and... applicable pollution control standards and section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p....

  4. 42 CFR 457.216 - Treatment of uncashed or canceled (voided) CHIP checks.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Treatment of uncashed or canceled (voided) CHIP... canceled (voided) CHIP checks. (a) Purpose. This section provides rules to ensure that States refund the... section— Canceled (voided) check means an CHIP check issued by a State or fiscal agent that prior to...

  5. Length-weight relationships of 216 North Sea benthic invertebrates and fish

    NARCIS (Netherlands)

    Robinson, L.; Greenstreet, S.P.R.; Reiss, H.; Callaway, R.; Craeymeersch, J.A.M.; Boois, de I.J.

    2010-01-01

    Size-based analyses of marine animals are increasingly used to improve understanding of community structure and function. However, the resources required to record individual body weights for benthic animals, where the number of individuals can reach several thousand in a square metre, are often pro

  6. 32 CFR Appendix A of Part 216 - Military Recruiting Sample Letter of Inquiry

    Science.gov (United States)

    2010-07-01

    ... been unable to recruit or have been refused student-recruiting information 3 at (subelement of) ABC... . 3 Student-recruiting information refers to a student's name, address, telephone listing, age (or...), and major(s). Current Federal law (10 U.S.C. 983) denies the use of certain Federal funds...

  7. 32 CFR Appendix B to Part 216 - ROTC Sample Letter of Inquiry

    Science.gov (United States)

    2010-07-01

    ... Federal law (10 U.S.C. 983) denies the use of certain Federal funds through grants or contracts, to... institution of higher education, or to an individual, to be available solely for student financial assistance... 32 National Defense 2 2010-07-01 2010-07-01 false ROTC Sample Letter of Inquiry B Appendix B...

  8. 20 CFR 216.3 - Other regulations related to this part.

    Science.gov (United States)

    2010-04-01

    ... eligibility. Where eligibility for an annuity is based upon a family relationship to an employee (for example, a widow's annuity), the definition of such family relationship may be found in part 222 of...

  9. 50 CFR 216.270 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    ... pings per dip) (v) SSQ-62 (Directional Command Activated Sonobuoy System (DICASS) sonobuoys)—up to 21275 sonobuoys over the course of 5 years (an average of 4255 sonobuoys per year) (vi) MK-48 (heavyweight... average of 227 hours per year) (x) AN/SSQ-125 (AEER sonar sonobuoy)—up to 540 sonobuoys (total, of...

  10. 50 CFR 216.170 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    ... year) (iv) SSQ-62 (sonobuoys)—up to 12115 sonobuoys over the course of 5 years (an average of 2423 sonobuoys per year) (v) MK-48 (torpedoes)—up to 1565 torpedoes over the course of 5 years (an average of...

  11. 50 CFR 216.240 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    ... (MFAS) sources, high frequency active sonar (HFAS) sources, or explosive sonobuoys for U.S. Navy anti...) SSQ-62 (Directional Command Activated Sonobuoy System (DICASS) sonobuoys)—up to 29265 sonobuoys over the course of 5 years (an average of 5853 sonobuoys per year). (7) MK-48 (heavyweight torpedoes)—up...

  12. 20 CFR 216.51 - Who is eligible for a spouse annuity.

    Science.gov (United States)

    2010-04-01

    ...: (1) Retirement age or older; (2) Less than retirement age and have in his or her care a disabled... old if the spouse claimant is a husband) of the employee; or (3) Age 62 or older but under retirement age. In such case, all annuity components are reduced for each month the spouse is under...

  13. 20 CFR 216.31 - Who is eligible for an age annuity.

    Science.gov (United States)

    2010-04-01

    ... Retirement Act provides annuities based on the employee's age for employees who have been credited with at...) Has attained retirement age; or (2) Has attained age 62 (the annuity cannot begin prior to the first full month during which the employee is age 62) but is less than retirement age. All components of...

  14. 20 CFR 216.61 - Who is eligible for an annuity as a widow(er).

    Science.gov (United States)

    2010-04-01

    ... eligible for an annuity if he or she: (1) Has not remarried; and either (2) Has attained retirement age; (3... less than retirement age but has in his or her care a child who either is under age 18 (16 with respect... part; or (5) Is at least 60 years of age but has not attained retirement age. (In this case,...

  15. 20 CFR 216.62 - Who is eligible for an annuity as a surviving divorced spouse.

    Science.gov (United States)

    2010-04-01

    ... retirement age; (4) Is at least 50 years of age but less than retirement age and is disabled as defined in... annuity.); (5) Is less than retirement age but has in his or her care a child who either is under age 16... years of age but has not attained retirement age. In this case, the annuity is reduced for each......

  16. 216-Day report for Tank 241-C-111, cores 58 and 59

    Energy Technology Data Exchange (ETDEWEB)

    Rice, A.D.

    1994-12-05

    Three core samples from tank C-111, and a field blank, were received by the 222-S laboratories. Cores 58, 59, and the field blank were analyzed in accordance with plans. A hot cell blank was analyzed at the direction of the hot cell chemist. No sample results exceeded the notification limits. Core 60 was not analyzed.

  17. Corrosion and hydrogen permeation of A216 Grade WCA steel in hydrothermal magnesium-containing brines

    International Nuclear Information System (INIS)

    Corrosion rates determined at 1 month in 150/degree/C brine increased with magnesium concentration. The structure of the corrosion product, as determined by x-ray diffraction, depended upon the magnesium concentration. In brines with less than 10,000 ppM magnesium, the primary corrosion product had a spinel structure characteristic of magnetite or magnesioferrite. In brines containing magnesium concentrations greater than 20,000 ppM, the primary corrosion product had the amakinite structure characteristic of a complex iron-magnesium hydroxide. The high corrosion rates observed in brines containing high magnesium concentrations suggest that the corrosion products having the amakinite structure is less protective than corrosion products having the spinel structure. Corrosion rates in high-magnesium (inclusion) brine determined over a 6-month test duration were essentially constant. Hydrogen permeation rates observed in exposing mild steel to high-Mg/sup 2/plus// brine at 150/degree/C could be potentially damaging to a mild steel waste package container. The rate of hydrogen permeation was proportional to the brine flow rate in the autoclave. Thiourea additions to the brine increased the hydrogen permeation rate; sulfate and bromide ion additions did not. The maximum gaseous hydrogen pressure attainable is not known (based on 3Fe /plus/ 4H2O /plus/ Fe(sub 3)O /plus/ 4H2, would be /approximately/900 atmospheres), and the dependence of permeation rate on temperature is not known. 8 refs., 13 figs., 3 tabs

  18. 24 CFR 5.216 - Disclosure and verification of Social Security and Employer Identification Numbers.

    Science.gov (United States)

    2010-04-01

    ... of the individual owner applicant's household who will be obligated to pay the debt evidenced by the...; Procedures for Obtaining Income Information Disclosure and Verification of Social Security Numbers and... regularly scheduled reexamination or recertification of family composition or income, or other...

  19. 18 CFR 367.2161 - Account 216.1, Unappropriated undistributed subsidiary earnings.

    Science.gov (United States)

    2010-04-01

    ..., FEDERAL POWER ACT AND NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2161... HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS...

  20. 49 CFR 216.11 - Special notice for repairs-railroad freight car.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Special notice for repairs-railroad freight car...—railroad freight car. (a) When an FRA Motive Power and Equipment Inspector or a State Equipment Inspector determines that a railroad freight car is not in conformity with the requirements of the FRA Freight...

  1. NKE 2.16, Nuclide Explorer tool for retrieving interactively detailed data on radionuclides properties

    International Nuclear Information System (INIS)

    1 - Description of program or function: The Nuclide Explorer (NKE) program is a tool for retrieving interactively detailed data on radionuclides properties. The data that can be retrieved are: a) elements information (average mass, density, neutron cross sections); b) nuclear ground/metastable states properties (half-life and decay channels percentage); c) decay alpha, beta, gamma, electron, positron radiation information (spectra and lines); d) fission products yields (for various fissionable target nuclides); e) thermal neutron cross sections and resonance integrals (capture and fission); f) fission spectrum average threshold neutron reactions cross sections for (n,p), (n,alpha), (n,2n), (n,n') and (n,gamma) reactions. Fast neutron fission has been added. It contains data on more than 3000 nuclides (approximately 3700 ground and metastable states). The data were mined from various public data bases. 2 - Methods: Users interact with the main program screen which is Segre nuclide chart to obtain detailed nuclide/element information. It contains a built-in decay calculator and filter utility. For instance users can filter data using various criteria (e.g. half-life, decay modes and particles energies)

  2. 12 CFR 216.5 - Annual privacy notice to customers required.

    Science.gov (United States)

    2010-01-01

    ... annually during the continuation of the customer relationship. Annually means at least once in any period...-month period, but you must apply it to the customer on a consistent basis. (2) Example. You provide a... notice to the customer once in each calendar year following the calendar year in which you provided...

  3. People and things. CERN Courier, July-August 1980, v. 21(6)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Over the last several years a new 'language', MULTI, has made a major hit at Fermilab. MULTI is a program that can flexibly handle interactive on-line computing from widely differing experimental CAMAC configurations. By now twothirds of the running experiments at Fermilab are using the system. It is literally true that an on-line system can be put into practical operation over a weekend. The demands of particle accelerator builders frequently stretch modern technology to the full. Recently a new possibility has emerged, using the technique of non-evaporable 'getters' - NEG. Getters are substances capable of absorbing gas molecules, so setting up a pumping action; The workshop for electron-proton physics at the proposed HERA machine will take place at the University of Wuppertal (Federal Republic of Germany) on 2-3 October. There will be reviews on the physics potential of electron-proton collisions, on the different electron-proton collider projects, on detectors and on polarization.One of CERN's annual sporting high lights is the 3.9 km relay race around the Meyrin site. This year some 40 runners lined up at the start

  4. 48 CFR 1552.216-79 - Award term availability of funds.

    Science.gov (United States)

    2010-10-01

    ... Government's obligation under any award term is contingent upon the availability of appropriated funds from which payment can be made. No legal liability on the part of the Government for any award term...

  5. 76 FR 50172 - Reorganization of Foreign-Trade Zone 216 Under Alternative Site Framework, Olympia, WA

    Science.gov (United States)

    2011-08-12

    ... Board adopted the alternative site framework (ASF) (74 FR 1170, 01/12/2009; correction 74 FR 3987, 01/22/2009; 75 FR 71069- 71070, 11/22/2010) as an option for the establishment or reorganization of general... (76 FR 27987, 05/13/2011) and the application has been processed pursuant to the FTZ Act and the...

  6. 26 CFR 1.216-2 - Treatment as property subject to depreciation.

    Science.gov (United States)

    2010-04-01

    ... year 1967 with respect to such stock as follows: Price paid for each share of stock in Y corporation purchased by C on 1-1-67 ($15,000÷100) $150 Per share price paid by C multiplied by total shares of stock in... computing such tenant-stockholder's proportionate share of such annual depreciation (amortization),...

  7. 19 CFR 10.216 - Maintenance of records and submission of Certificate by importer.

    Science.gov (United States)

    2010-04-01

    ..., quality, and reputation. (c) Correction and nonacceptance of Certificate. If the port director determines... importation of an article whose value does not exceed US$2,500, provided that, unless waived by the...

  8. Shelf-Life of ɛ-Lysyl-3-(Trimethylstannyl)Benzamide Immunoconjugates, Precursors for 211At Labeling of Antibodies

    OpenAIRE

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per; Jensen, Holger; Holgersson, Stellan; Lindegren, Sture

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity and the complex radiochemistry of 211At are major obstacles for research and prospective clinical applications. In the present study, astatination of immunoconjugates, already prepared well in advance...

  9. Recurso de amparo, incidente de nulidad de actuaciones y tutela de los derechos fundamentales de la personalidad. Comentario a la STC (pleno) 216/2013, de 19 de diciembre (RTC 2013, 216).

    OpenAIRE

    Verda y Beamonte, José Ramón de

    2014-01-01

    Cuando el objeto del proceso consista en el estudio de la lesión directa de un derecho fundamental de carácter sustantivo, como es el caso del derecho al honor o a la intimidad, que tenga su origen en un acto de particulares, la interposición del recurso de amparo no requiere el previo planteamiento del incidente de nulidad de actuaciones.

  10. 5 CFR 531.216 - Setting pay when an employee moves from a Department of Defense or Coast Guard nonappropriated...

    Science.gov (United States)

    2010-01-01

    ... employee moves from a Department of Defense or Coast Guard nonappropriated fund instrumentality. (a... pay retention in 5 CFR 536.302(a). (3) For the purpose of this paragraph (d), “moved involuntarily... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Setting pay when an employee moves from...

  11. 12 CFR 216.14 - Exceptions to notice and opt out requirements for processing and servicing transactions.

    Science.gov (United States)

    2010-01-01

    ... otherwise paid using a debit, credit, or other payment card, check, or account number, or by other payment means; (B) The transfer of receivables, accounts, or interests therein; or (C) The audit of debit... credit card program or other extension of credit on behalf of such entity; or (3) A proposed or...

  12. 8 CFR 216.6 - Petition by entrepreneur to remove conditional basis of lawful permanent resident status.

    Science.gov (United States)

    2010-01-01

    ... full-time jobs for qualifying employees. In the case of a “troubled business” as defined in 8 CFR 204.6... qualifying employees. In the case of a “troubled business” as defined in 8 CFR 204.6(j)(4)(ii), the alien... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Petition by entrepreneur to...

  13. 50 CFR 216.24 - Taking and related acts incidental to commercial fishing operations by tuna purse seine vessels...

    Science.gov (United States)

    2010-10-01

    ... an observer, or to harass (including sexual harassment) an observer by conduct that has the purpose... governing permit sanctions and denials are found at subpart D of 15 CFR part 904. (ii) Observer placement... experimental fishing waiver in accordance with 15 CFR part 904 if the terms and conditions of the waiver or...

  14. SU-E-J-216: A Sequence Independent Approach for Quantification of MR Image Deformations From Brachytherapy Applicators

    International Nuclear Information System (INIS)

    Purpose: MRI is increasingly used as a single imaging modality for brachytherapy treatment planning. The presence of a brachytherapy applicator may cause distortions in the images, especially at higher field strengths. Our aim is to develop a procedure to quantify these distortions theoretically for any MR-sequence and to verify the estimated deformations for clinical sequences. Methods: Image distortions due to perturbation of the B0-field are proportional to the ratio of the induced frequency shift and the read-out bandwidth of the applied sequence. By reconstructing a frequency-shift map from the phase data from a multi-echo sequence, distortions can be calculated for any MR-sequence. Verification of this method for estimating distortions was performed by acquiring images with opposing read-out directions and consequently opposing distortions. The applicator shift can be determined by rigidly matching these images. Clinically, T2W-TSE-images are used for this purpose. For pre-clinical tests, EPI-sequences with narrow read-out bandwidth (19.5–47.5Hz), consequently large distortions, were added to the set of clinical MRsequences. To quantify deformations of the Utrecht Interstitial CT/MR applicator (Elekta Brachytherapy) on a Philips Ingenia 3T MRI, pre-clinical tests were performed in a phantom with the applicator in water, followed by clinical validation. Results: Deformations observed in the narrow bandwidth EPI-images were well predicted using the frequency-shift, the latter giving an overestimation up to 30%/up to 1 voxel. For clinically applied MR-sequences distortions were well below the voxel size. In patient setup distortions determined from the frequency-shift map were at sub-voxel level (<0.7mm). Using T2W-images larger distortions were found (1–2mm). This discrepancy was caused by patient movement between/during acquisition of the T2W-images with opposing read-out directions. Conclusion: Phantom experiments demonstrated the feasibility of a clinical procedure for quantification of MR-image distortions for any MR-sequence. In a clinical set-up the distortions from a Utrecht interstitial CT/MR applicator are sub-voxel level. This work was partially funded by Elekta Brachytherpy

  15. 21 CFR 216.24 - Drug products withdrawn or removed from the market for reasons of safety or effectiveness.

    Science.gov (United States)

    2010-04-01

    .... Bromfenac sodium: All drug products containing bromfenac sodium. Butamben: All parenteral drug products... use as a patient preoperative skin preparation. Chlormadinone acetate: All drug products containing... containing vinyl chloride. Zirconium: All aerosol drug products containing zirconium. Zomepirac sodium:...

  16. 77 FR 56611 - Foreign-Trade Zone 216-Olympia, WA; Authorization of Production Activity; Callisons, Inc. (Mint...

    Science.gov (United States)

    2012-09-13

    ...), including notice in the Federal Register inviting public comment (77 FR 28568, 5-15-2012). The FTZ Board has...; Callisons, Inc. (Mint Products); Lacey and Chehalis, WA On May 10, 2012, the Port of Olympia, grantee of...

  17. 8 CFR 216.4 - Joint petition to remove conditional basis of lawful permanent resident status for alien spouse.

    Science.gov (United States)

    2010-01-01

    ... Act and 8 CFR part 239. The alien's lawful permanent resident status shall be terminated as of the... third parties having knowledge of the bona fides of the marital relationship, the petitioner must...) Affidavits of third parties having knowledge of the bona fides of the marital relationship, or (vi)...

  18. A WFPC2 Study of the Resolved Stellar Population of the Pegasus Dwarf Irregular Galaxy (DDO 216)

    CERN Document Server

    Gallagher, J S; Dohm-Palmer, R C; Skillman, E D; Cole, A A; Hössel, J G; Saha, A; Mateo, M; Tolstoy, Eline; Dohm-Palmer, Robbie C.

    1998-01-01

    The stellar population of the Pegasus dwarf irregular galaxy is investigated in images taken in the F439W (B), F555W (V), and F814W (I) bands with WFPC2. These and ground-based data are combined to produce color-magnitude diagrams which show the complex nature of the stellar population in this small galaxy. A young (< 0.5 Gyr) main sequence stellar component is present and clustered in two centrally-located clumps, while older stars form a more extended disk or halo. The colors of the main sequence require a relatively large extinction of A_V = 0.47 mag. The mean color of the well-populated red giant branch is relatively blue, consistent with a moderate metallicity young, or older, metal-poor stellar population. The red giant branch also has significant width in color, implying a range of stellar ages and/or metallicities. A small number of extended asymptotic giant branch stars are found beyond the red giant branch tip. Near the faint limits of our data is a populous red clump superimposed on the red gian...

  19. 8 CFR 216.5 - Waiver of requirement to file joint petition to remove conditions by alien spouse.

    Science.gov (United States)

    2010-01-01

    ..., medical personnel, school officials and social service agency personnel. The Service must be satisfied... the appropriate fee required under § 103.7(b) of this Chapter. (c) (d) Interview. The service center... conditional resident parent of a battered or abused child may apply for the waiver regardless of the...

  20. 20 CFR 216.63 - Who is eligible for an annuity as a remarried widow(er).

    Science.gov (United States)

    2010-04-01

    ...) Has attained retirement age; (4) Is at least 50 but less than 60 years of age and is disabled as... reduced annuity); (5) Has not attained retirement age but has in his or her care a child who either is... at least age 60 but has not attained retirement age. (In this case, the annuity is reduced for...

  1. 5 CFR 551.216 - Law enforcement activities and 7(k) coverage for FLSA pay and exemption determinations.

    Science.gov (United States)

    2010-01-01

    ... the scene of a crime, interviewing witnesses, and evaluating evidence to locate suspects; and... of persons or firms to enforce or obtain compliance with laws and regulations (e.g., immigration...

  2. SU-E-J-216: A Sequence Independent Approach for Quantification of MR Image Deformations From Brachytherapy Applicators

    Energy Technology Data Exchange (ETDEWEB)

    Wieringen, N van; Heerden, L van; Gurney-Champion, O; Kesteren, Z van; Houweling, A; Pieters, B; Bel, A [Academic Medical Center, Amsterdam (Netherlands)

    2015-06-15

    Purpose: MRI is increasingly used as a single imaging modality for brachytherapy treatment planning. The presence of a brachytherapy applicator may cause distortions in the images, especially at higher field strengths. Our aim is to develop a procedure to quantify these distortions theoretically for any MR-sequence and to verify the estimated deformations for clinical sequences. Methods: Image distortions due to perturbation of the B0-field are proportional to the ratio of the induced frequency shift and the read-out bandwidth of the applied sequence. By reconstructing a frequency-shift map from the phase data from a multi-echo sequence, distortions can be calculated for any MR-sequence. Verification of this method for estimating distortions was performed by acquiring images with opposing read-out directions and consequently opposing distortions. The applicator shift can be determined by rigidly matching these images. Clinically, T2W-TSE-images are used for this purpose. For pre-clinical tests, EPI-sequences with narrow read-out bandwidth (19.5–47.5Hz), consequently large distortions, were added to the set of clinical MRsequences. To quantify deformations of the Utrecht Interstitial CT/MR applicator (Elekta Brachytherapy) on a Philips Ingenia 3T MRI, pre-clinical tests were performed in a phantom with the applicator in water, followed by clinical validation. Results: Deformations observed in the narrow bandwidth EPI-images were well predicted using the frequency-shift, the latter giving an overestimation up to 30%/up to 1 voxel. For clinically applied MR-sequences distortions were well below the voxel size. In patient setup distortions determined from the frequency-shift map were at sub-voxel level (<0.7mm). Using T2W-images larger distortions were found (1–2mm). This discrepancy was caused by patient movement between/during acquisition of the T2W-images with opposing read-out directions. Conclusion: Phantom experiments demonstrated the feasibility of a clinical procedure for quantification of MR-image distortions for any MR-sequence. In a clinical set-up the distortions from a Utrecht interstitial CT/MR applicator are sub-voxel level. This work was partially funded by Elekta Brachytherpy.

  3. Three-Dimensional Modeling of DNAPL in the Subsurface of the 216-Z-9 Trench at the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Oostrom, Mart; Rockhold, Mark L.; Thorne, Paul D.; Last, George V.; Truex, Michael J.

    2004-11-02

    This work describes numerical modeling for simulating carbon tetrachloride flow and transport as outlined in two DOE reports for the 200-PW-1 Operable Unit and the 200-PW-1, 200-PW-3, and 200-PW-6 Operable Units. Simulations using the multifluid flow model STOMP were conducted to estimate how disposed dense nonaqueous phase liquid migrates in the vadose zone.

  4. 77 FR 29683 - Outer Continental Shelf (OCS) Consolidated Central Gulf of Mexico Planning Area Sale; 216/222

    Science.gov (United States)

    2012-05-18

    ... Mexico are specified as (1) less than 800 meters and (2) 800 meters or more. Per 64 FR 37560, if...-Spatial-Data.aspx . For the current status of all CPA leasing maps and OPD's, please refer to 66 FR 28002 (published May 21, 2001), 69 FR 23211 (published April 28, 2004), 72 FR 27590 (published May 16, 2007), 72...

  5. VizieR Online Data Catalog: ExoMol line lists for H216O2 (Al-Refaie+, 2016)

    Science.gov (United States)

    Al-Refaie, A. F.; Polyansky, O. L.; Tennyson, J.; Yurchenko, S. N.

    2016-06-01

    The data are in two parts. The first, h2o20-85.dat contains a list of 7,560,352 rovibrational states. Each state is labelled with: six normal mode vibrational quantum numbers the torsional symmetry number (tau) and the vibrational symmetry; three rotational quantum numbers including the total angular momentum J and rotational symmetry; the total symmetry quantum number Gamma and the running number in the same J,Gamma block. In addition there are six local mode vibrational numbers and the largest coefficient used to assign the state in question. Each rovibrational state has a unique number, which is the number of the row in which it appears in the file. This number is the means by which the state is related to the second part of the data system, the transitions files. The total degeneracy is also given to facilitate the intensity calculations. Because of their size, the transitions are listed in 60 separate files, each containing all the transitions in a 100cm-1 frequency range. These and their contents are ordered by increasing frequency. The name of the file includes the lowest frequency in the range; thus the a-0500.dat file contains all the transitions in the frequency range 500-600cm-1. The transition files contain three columns: the reference number in the energy file of the upper state; that of the lower state; and the Einstein A coefficient of the transition. The energy file and the transitions files are zipped, and need to be extracted before use. There is a Fortran 90 programme, s_APTY.f90 which may be used to generate synthetic spectra (see s_APTY.txt for details). Using this, it is possible to generate absorption or emission spectra in either 'stick' form or else cross-sections convoluted with a gaussian with the half-width at half maximum being specified by the user, or with a the temperature-dependent doppler half-width. Sample input files s*.inp for use with sAPTY.f90 are supplied. (10 data files).

  6. In Situ Raman Spectroscopy of Supported Transition Metal Oxide Catalysts: 18O2-16O2 Isotopic Labeling Studies

    OpenAIRE

    Weckhuysen, B.M.; Jehng, J.M.; Wachs, I.E.

    2000-01-01

    The isothermal isotopic exchange reaction of 18O2 with 16O of CrO3, MoO3, Nb2O5, WO3, V2O5, and Re2O7 supported on ZrO2 has been investigated with in situ laser Raman spectroscopy. Isotopic exchange of the oxygen atoms of the supported transition metal oxides with 18O2 is difficult and requires several successive reduction-18O2 reoxidation cycles at relatively high temperatures. The Raman spectroscopy data reveal that all the supported transition metal oxides are present as a monooxo species ...

  7. Oahu Hyperspectral Imagery 2000 (216-0611-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  8. 47 CFR 15.216 - Disclosure requirements for wireless microphones and other low power auxiliary stations capable...

    Science.gov (United States)

    2010-10-01

    ... Alert Consumer Alert Most users do not need a license to operate this wireless microphone system... also be aware that the FCC is currently evaluating use of wireless microphone systems, and these rules... 47 Telecommunication 1 2010-10-01 2010-10-01 false Disclosure requirements for...

  9. The Mycoplasma hominis P120 membrane protein contains a 216 amino acid hypervariable domain that is recognized by the human humoral immune response

    DEFF Research Database (Denmark)

    Nyvold, Charlotte Guldborg; Birkelund, Svend; Christiansen, Gunna

    1997-01-01

    In the antigenically heterogeneous species Mycoplasma hominis a monoclonal antibody, mAb 26.7D, was previously found to recognize a 120 kDa polypeptide from M. hominis 7488. This antibody did not react with the type strain PG21. The homologous gene from M. hominis PG21 was cloned and sequenced an...... response. Such a variable domain may be important in evasion of the host's immune response, and thus aid survival of the micro-organism....

  10. Oxidation of methionine 216 in sheep and elk prion protein is highly dependent upon the amino acid at position 218 but is not important for prion propagation

    Science.gov (United States)

    We developed a sensitive mass spectrometry-based method of quantitating the prions present in elk and sheep. Calibration curves relating the area ratios of the selected analyte peptides and their homologous stable isotope labeled internal standards were prepared. This method was compared to the ELIS...

  11. BPC216全自动生化分析仪速率法检测血清CK-MB酶海力

    Institute of Scientific and Technical Information of China (English)

    詹伦琴

    1994-01-01

    肌酸激酶(Creatine Kinase,CK)是由B和M两条亚基组成的二聚体,有三种同工酶。存在于脑和前列腺等非肌组织者为CK-BB,存在于骨骼肌及心肌中为CK-MM,心肌除以CK-MM型为主外,尚有CK-MB型。正常血清中绝大部分为CK-MM型,

  12. Does excitatory fronto-extracephalic tDCS lead to improved working memory performance? [v1; ref status: indexed, http://f1000r.es/216

    Directory of Open Access Journals (Sweden)

    Níall Lally

    2013-10-01

    Full Text Available Evidence suggests that excitatory transcranial direct current stimulation (tDCS may improve performance on a wide variety of cognitive tasks. Due to the non-invasive and inexpensive nature of the method, harnessing its potential could be particularly useful for the treatment of neuropsychiatric illnesses involving cognitive dysfunction. However, questions remain regarding the efficacious stimulation parameters. Here, using a double-blind between-subjects design, we explored whether 1 mA excitatory (anodal left dorsolateral prefrontal cortex stimulation with a contralateral extracephalic reference electrode, leads to enhanced working memory performance across two days, relative to sham stimulation. Participants performed the 3-back, a test of working memory, at baseline, and during and immediately following stimulation on two days, separated by 24-48 hours. Active stimulation did not significantly enhance performance versus sham over the course of the experiment. However, exploratory comparisons did reveal a significant effect of stimulation group on performance during the first stimulation phase only, with active stimulation recipients performing better than sham. While these results do not support the hypothesis that dorsolateral prefrontal cortex tDCS boosts working memory, they raise the possibility that its effects may be greatest during early learning stages.

  13. Selected papers, in: Modern Aspects of the Theory of Partial Differential Equations, M. Ruzhansky, J. Wirth (Eds); Operator Theory: Advances and Applications, Vol. 216, 367 pp.

    OpenAIRE

    Bucci, Francesca; Lasiecka, Irena

    2011-01-01

    The book provides a quick overview of a wide range of active research areas in partial differential equations such as evolution equations and estimates for their solutions, control theory, inverse problems, nonlinear equations, elliptic theory on singular domains, numerical approaches. It will serve as a useful source of information to mathematicians, scientists and engineers.

  14. Does excitatory fronto-extracephalic tDCS lead to improved working memory performance? [v1; ref status: indexed, http://f1000r.es/216

    OpenAIRE

    Níall Lally; Nord, Camilla L.; Vincent Walsh; Roiser, Jonathan P.

    2013-01-01

    Evidence suggests that excitatory transcranial direct current stimulation (tDCS) may improve performance on a wide variety of cognitive tasks. Due to the non-invasive and inexpensive nature of the method, harnessing its potential could be particularly useful for the treatment of neuropsychiatric illnesses involving cognitive dysfunction. However, questions remain regarding the efficacious stimulation parameters. Here, using a double-blind between-subjects design, we explored whether 1 mA exci...

  15. Shelf-life of ɛ-lysyl-3-(trimethylstannyl)benzamide immunoconjugates, precursors for 211At labeling of antibodies

    DEFF Research Database (Denmark)

    Aneheim, Emma; Halleröd, Jenny; Albertsson, Per;

    2015-01-01

    Astatine-211 is possibly the most promising radionuclide for targeted α-particle therapy when it comes to the treatment of occult disseminated cancer. Preclinical research has proven effective, and patient studies have been initiated based on these results. However, a lack of production capacity ...

  16. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  17. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  18. Separation of 211At from irradiated bismuth target and labelling of a model protein

    International Nuclear Information System (INIS)

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  19. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  20. Dicty_cDB: SLC575 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available U034586 ) Dictyostelium discoideum slug cDNA, clone SLC575. 216 8e-54 2 ( AU053333 ) Dictyostelium discoideum slug... cDNA, clone SLI409. 216 1e-53 2 ( AU038601 ) Dictyostelium discoideum slug... cDNA, clone SSL233. 216 1e-53 2 ( AU052355 ) Dictyostelium discoideum slug cDNA, clone SLD187. 216 2e-53 2 ...( AU053301 ) Dictyostelium discoideum slug cDNA, clone SLI347. 216 2e-53 2 ( AU039583 ) Dictyostelium discoideum slug... cDNA, clone SLE787. 216 2e-53 2 ( AU062090 ) Dictyostelium discoideum slug cDNA, clone SLH520. 216

  1. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  2. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  3. Radiopharmaceutical Chemistry of Targeted Radiopharmaceutics. Synthesis of 211At-Labeled Radiopharmaceuticals at High Activities for Clinical Use

    International Nuclear Information System (INIS)

    Targeted α-particle radiotherapy is an appealing approach to cancer treatment because of the potential for delivering curative doses of radiation to tumor with minimal damage to normal tissue due to a range equivalent to only a few cell diameters. Compared with β-emitters they have significant advantages from a radiobiological perspective. The LET of 211At α-particles is more than 400 times higher than the β-particles emitted by 90Y, in addition the distance between ionizing events is almost the same as that between the two strands of DNA, yielding a high probability of creating non-repairable DNA damage. It gives the ability to kill cancer cells not compromised by hypoxia, dose rate effects or cell cycle position, enhancing their attractiveness for targeted radiotherapy. However, translation of the concept to the clinic has been slow, many obstacles had to be surmounted before clinical studies could be initiated, the first clinical evaluation of a 211At- labeled mAb was made in 2001. This study circumvents many of the challenges to entering clinical studies with 211At. But several problems were encountered in maintaining efficient labeling with escalating radiation dose of alpha-particle likely related to radiolysis. The impact of the radiolysis produced by the α-particle over the labeling chemistry is much higher in comparison with typical β-emitters due to a deposition of energy in the solvent in a highly localized manner two orders of magnitude per unit volume higher than 90Y or 131I. Due to these difficulties a comprehensive basic science study about the radiolytic effects of astatine alpha-particles over the synthesis of 211At-labeled radiopharmaceuticals was carried out. Its main goal was overcoming the problem of the synthesis of 211At-labeled radiopharmaceuticals at the high activities necessaries for therapy and also to extend the shelf life of astatine elutions. Briefly this study held several steps, the first one was to study the role of solvent

  4. Early detection of response to experimental chemotherapeutic Top216 with [18F]FLT and [18F]FDG PET in human ovary cancer xenografts in mice

    DEFF Research Database (Denmark)

    Jensen, Mette Munk; Erichsen, Kamille Dumong; Björkling, Fredrik;

    2010-01-01

    3'-Deoxy-3'-[(18)F]fluorothymidine ((18)F-FLT) is a tracer used to assess cell proliferation in vivo. The aim of the study was to use (18)F-FLT positron emission tomography (PET) to study treatment responses to a new anti-cancer compound. To do so, we studied early anti-proliferative effects of t...

  5. Kõnetehnoloogiat edendades : [rets. : Meister, Einar. Promoting Estonian speech technology : from resources to prototypes. Dissertationes linguisticae Universitatis Tartuensis 4. Tartu : Tartu Ülikooli Kirjastus, 2003. 216 lk.] / Meelis Mihkla

    Index Scriptorium Estoniae

    Mihkla, Meelis

    2004-01-01

    Retsenseeritava raamatu põhjal kaitses Tallinna Tehnikaülikooli Küberneetika Instituudi foneetika ja kõnetehnoloogia labori juhataja Einar Meister 26. juunil 2003 Tartu Ülikoolis doktoriväitekirja

  6. Computational prediction of MicroRNAs targeting GABA receptors and experimental verification of miR-181, miR-216 and miR-203 targets in GABA-A receptor

    OpenAIRE

    Zhao Chunling; Huang Chaoqun; Weng Tingting; Xiao Xiao; Ma Hong; Liu Lin

    2012-01-01

    Abstract Background GABA receptors are well known as the inhibitory receptors in the central nervous system and are also found in peripheral tissues. We have previously shown that GABA receptors are involved in lung development and fluid homeostasis. However, the microRNAs that regulate GABA receptors have not yet been identified. Results In this study, we used the online software, TargetScan and miRanda, to query the microRNAs that directly target GABA receptors and then selected some of the...

  7. A Practical Guide to End of Life Care Sadler Clair A Practical Guide to End of Life Care 216pp £16.79 Open University Press 9780335263561 0335263569 [Formula: see text].

    Science.gov (United States)

    2016-02-17

    This book looks beyond medical care, and considers a range of issues including legal matters and the processes surrounding death. Each chapter is based on a question which is explored in detail through case studies and activities, encouraging the reader to reflect on their own situation. PMID:26884024

  8. Molecular clouds and star formation toward the Galactic plane within 216.25$^{\\rm o}\\le$ l $\\le$218.75$^{\\rm o}$ and $-$0.75$^{\\rm o} \\le$ b $\\le$1.25$^{\\rm o}$

    CERN Document Server

    Gong, Y; Fang, M; Zhang, S B; Su, Y; Yang, J; Jiang, Z B; Xu, Y; Wang, M; Wang, Y; Lu, D R; Sun, J X

    2016-01-01

    As a part of the Milky Way Imaging Scroll Painting (MWISP) survey, we performed a simultaneous 12CO(1-0), 13CO(1-0), C18O(1-0) mapping toward molecular clouds in a region encompassing 3.75 square degrees. We reveal three molecular clouds, the 15 km/s cloud, the 27 km/s cloud, and the 50 km/s cloud, in the surveyed region. The 50 km/s cloud is resolved with an angular resolution of around 1' for the first time. Investigating their morphology and velocity structures, we find that the 27 km/s cloud is likely affected by feedback from the stellar association Mon OB3 and the 50 km/s cloud is characterised by three large expanding molecular shells. The region is mapped in C18O (1-0) for the first time. We discover seven C18O clumps, which are likely to form massive stars, and 15 dust clumps based on the BGPS archival data. Using infrared color-color diagrams, we find 56 Class I and 107 Class II young stellar object (YSO) candidates. According to the distribution of YSO candidates, an overdensity is found around the...

  9. High-accuracy measurement of the π-p total cross section for the search of narrow baryon resonances with masses between 2,16 GeV/c2 and 5,2 GeV/c2

    International Nuclear Information System (INIS)

    The principle of the apparatus and of the momentum measurement, and the resonance detection ranges with which the study deals are presented. The acquisition systems includes a micro-computer μA. An on-line acquisition program has been developed. The principle of narrow resonance detection consists in measuring their σsub(TOT) or excitation function without taking into account systematic errors from one data acquisition to another one; this excitation function is obtained from raw data without substracting the effect of empty target. The e-, K-, antip contamination is measured. The corrections to one-line measurements consist, on one hand, of the unefficiency, and on the other hand of the overefficiency of the muon detector. Finally, the study deals with the search of N* and Δ resonances

  10. Jérôme Dubois J., 2009, Les politiques publiques territoriales. La gouvernance multi-niveaux face aux défis de l’aménagement. Presses Universitaires de Rennes, 216 p.

    OpenAIRE

    Gaudin, Jean-Pierre

    2009-01-01

    Voilà un ouvrage portant sur un sujet compliqué, qui rend très bien compte analytiquement de cette complication et qui aboutit à des conclusions qui ne sont dès lors pas simples … Jérôme Dubois s’intéresse ici aux défis les plus actuels que posent les politiques publiques dans leur « déclinaison » territoriale : arbitrages souvent opaques, territoires pas toujours pertinents, logiques de « chasseurs de primes » chez les élus locaux face aux guichets nationaux et européens, etc …Dans ces condi...

  11. Multibeam collection for KN216-03: Multibeam data collected aboard Knorr from 2014-03-13 to 2014-04-01, departing from Tromso, Norway and returning to Woods Hole, MA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  12. Comparison of trajectory models in calculations of N2-broadened half-widths and N2-induced line shifts for the rotational band of H216O and comparison with measurements

    International Nuclear Information System (INIS)

    In this work, Complex Robert-Bonamy calculations of half-widths and line shifts were done for N2-broadening of water for 1639 transitions in the rotational band using two models for the trajectories. The first is a model correct to second order in time, the Robert-Bonamy parabolic approximation. The second is the solution of Hamilton's equations. Both models use the isotropic part of the atom-atom potential to determine the trajectories. The present calculations used an intermolecular potential expanded to 20th order to assure the convergence of the half-widths and line shifts. The aim of the study is to assess if the difference in the half-widths and line shifts determined from the two trajectory models is greater than the accuracy requirements of the spectroscopic and remote sensing communities. The results of the calculations are compared with measurements of the half-widths and line shifts. It is shown that the effects of the trajectory model greatly exceed the needs of current remote sensing measurements and that line shape parameters calculated using trajectories determined by solving Hamilton's equations agree better with measurement.

  13. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211At and 124I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[211At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[211At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [124I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[124I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of macromolecules

  14. 211At production and recovery: first results of a new start

    International Nuclear Information System (INIS)

    Full text: 211At is the only alpha-emitting isotope which can be introduced into organic molecular structures by covalent chemical binding and possesses superior decay characteristics for therapeutic applications when compared with other alpha emitters. However, its production requires a minimum of 27,5 MeV alpha-particles, which are relatively rarely available. In view of the revival of alpha-therapy approaches a production of 211At has been set up at the MHH cyclotron (MC-35). The first aim of this project was to establish a target- and work-up-system for the reliable production of several ten MBq-quantities of 211At for animal- and cell-research. An aluminum-target-system holds a 1.3 cm diameter Bi-disc of 0.25 mm thickness. The disk is pressed onto a the aluminum backing with 2 tons/cm2. The front is covered with a 125 μm Al foil, cooled by a He jet which is separated from the vacuum by a 250 μm Ti foil. Starting with 27.5 MeV alpha-particles the resulting target-energy is 25 MeV. This relatively low energy is chosen to avoid any contamination with 210At and 210Po in the first experimental period. A beam current of 10 μA for 15 min (9 mCoulomb) yields 16.4 MBq 211At theoretically. Astatine is recovered from the target by a dry distillation technique, using various gases as a transport support-medium. The small all-quartz distillation-apparatus is heated up to 900 oC. Astatine is recovered in a small cool able vessel containing various trapping media. Distillation and trapping can be monitored with small radioactivity monitors. The whole system fits in a cubical 0.5 m glove box. Continuous monitoring of the distillation process allowed to optimize the heating rate, the transport support-medium and its flow-rate. Various trapping solutions were tested for their efficiency. Different beam dispersion in the target seems to influence the release and distillation of astatine from the molten bismuth-target. Two different release patterns were observed. The first

  15. 78 FR 13905 - Government-Owned Inventions, Available for Licensing

    Science.gov (United States)

    2013-03-01

    ... Center at Lewis Field, Code 21-14, Cleveland, OH 44135; telephone (216) 433-5754; fax (216) 433-6790... Etching of Silicon Carbide; NASA Case No.: LEW-18674-1: Polymer Electrolyte-Based Sensors; NASA Case...

  16. Inclusive measurement of (p,πsup(-)xn) double charge exchange reactions on bismuth from threshold to 800 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the total angle-integrated cross section for the production of astatine isotopes from (p,πsup(-)xn) double charge exchange reactions on bismuth (sup(209)Bi) was measured from 120 to 800 MeV using activation and radiochemical techniques. Chemical yields were estimated by direct radioassaying of sup(211)At activity in thin (approximately 1 mg/cmsup(2)), irradiated bismuth targets. Calculations of the contributions of secondary (2-step) reactions to these measured astatine yields were performed, based partially upon the observed sup(211)At activity although even at the highest energies, the contribution to products lighter than sup(207)At was negligible. These data for products with as many as 7 neutrons removed from the doubly coherent product (sup(210)At) display nearby gaussian shapes for the mass distributions of the astatine residues with the maximum occurring for about sup(204)At. The most probable momentum transfer deduced from these distributions for the initial πsup(-) production step was 335 MeV/c. The observed excitation functions display a behaviour similar to that observed for the yield of sup(210)Po from a (p,πsup(O)) reaction on sup(209)Bi, but radically different from that observed for inclusive πsup(-) reactions on a heavy nucleus. These data are discussed in terms of recent theoretical approaches to negative pion production from bismuth. In addition, a simple, schematic model is developed to treat the rapidly decreasing percentage of the total inclusive πsup(-) emission which is observed for this double charge exchange reaction. This model reflects the capacity of a nucleus to a source of internal energetic protons

  17. Dicty_cDB: SSE172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available trep. 216 3e-54 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3...H. 216 3e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 3e-54 2 AJ510165 |AJ510...165.1 Cloning vector pDXA-3FLAG. 216 3e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3...C. 216 3e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. ...216 3e-54 2 AF269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 3e-54 2 X85120 |X85120.1 Artificial

  18. Dicty_cDB: SSH838 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 630 e-177 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 8e-55 2 X85119 |X85119.1 Artificial sequenc...es cloning vector DNA pDXA-3H. 216 8e-55 2 X85122 |X85122.1 Artificial sequences ...cloning vector DNA pDXA-HY. 216 8e-55 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 8e-55 2 X85118 |X85118.1 Artificial... sequences cloning vector DNA pDXA-3C. 216 8e-55 2 X85123 |X85123.1 Artificial sequences ...FLAG, complete sequence. 216 8e-55 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 9

  19. Dicty_cDB: SSH804 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available loning vector pDXA-3strep. 216 4e-54 2 X85119 |X85119.1 Artificial sequences clon...ing vector DNA pDXA-3H. 216 4e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 4e...-54 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 4e-54 2 X85118 |X85118.1 Artificial sequences clon...ing vector DNA pDXA-3C. 216 4e-54 2 X85123 |X85123.1 Artificial sequences cloning... vector DNA pDXA-HC. 216 4e-54 2 AF269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 4e-54 2 X85120 |X85120.1 Artif

  20. Dicty_cDB: SSE603 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ector pDXA-3strep. 216 9e-54 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 9e-54 2 X85122 |X85122.1 Artific...vector pDXA-3FLAG. 216 9e-54 2 X85118 |X85118.1 Artificial sequences cloning vect...or DNA pDXA-3C. 216 9e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 9e-54 2 AF...269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 9e-54 2 X85120 |X85120.1 Artificial sequ...ial sequences cloning vector DNA pDXA-HY. 216 9e-54 2 AJ510165 |AJ510165.1 Cloning

  1. Dicty_cDB: SSE437 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 64 |AJ510164.1 Cloning vector pDXA-3strep. 216 6e-54 2 X85119 |X85119.1 Artificial sequences cloning vector ...DNA pDXA-3H. 216 6e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 6e-54 2 AJ510...165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 6e-54 2 X85118 |X85118.1 Artificial... sequences cloning vector DNA pDXA-3C. 216 6e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA... pDXA-HC. 216 6e-54 2 AF269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 6e-54 2 X85120 |X85120.1 Artificial

  2. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    OpenAIRE

    BAYRAM, Ali

    1998-01-01

    In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 1...

  3. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  4. Dicty_cDB: SSH692 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pDXA-3strep. 216 7e-55 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 7e-55 2 X85122 |X85122.1 Artificial... |AJ510165.1 Cloning vector pDXA-3FLAG. 216 7e-55 2 X85118 |X85118.1 Artificial sequences cloning vector DNA... pDXA-3C. 216 7e-55 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 7e-55 2 AF269236... |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 7e-55 2 X85120 |X85120.1 Artificial

  5. Dicty_cDB: SSH510 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ase 1. 686 0.0 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 1e-54 2 X85119 |X85119.1 Artificial... sequences cloning vector DNA pDXA-3H. 216 1e-54 2 X85122 |X85122.1 Artificial seque...nces cloning vector DNA pDXA-HY. 216 1e-54 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 1e-54 2 X85118 |X85118.1 Artificial... sequences cloning vector DNA pDXA-3C. 216 1e-54 2 X85123 |X85123.1 Artificial...pDXA-FLAG, complete sequence. 216 1e-54 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H.

  6. Dicty_cDB: SSL359 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ficial sequences cloning vector DNA pDXA-3H. 216 2e-54 2 X85122 |X85122.1 Artificial...ficial sequences cloning vector DNA pDXA-3C. 216 2e-54 2 X85123 |X85123.1 Artific...vector pDXA-FLAG, complete sequence. 216 2e-54 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pD...scoideum mRNA for cysteine proteinase 1. 436 0.0 3 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 2e-54 2 X85119 |X85119.1 Arti... sequences cloning vector DNA pDXA-HY. 216 2e-54 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 2e-54 2 X85118 |X85118.1 Arti

  7. Dicty_cDB: SSK793 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available teinase 1. 1084 0.0 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 3e-54 2 X85119 |X85119.1 Artificial... sequences cloning vector DNA pDXA-3H. 216 3e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DN...cial sequences cloning vector DNA pDXA-3C. 216 3e-54 2 X85123 |X85123.1 Artificial ...quence. 216 3e-54 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD...A pDXA-HY. 216 3e-54 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 3e-54 2 X85118 |X85118.1 Artifi

  8. Dicty_cDB: SSL190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 Cloning vector pDXA-3strep. 216 3e-67 3 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H.... 216 3e-67 3 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 2...16 3e-67 3 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 3e-67 3 X85118 |X85118.1 Artificial sequences... cloning vector DNA pDXA-3C. 216 3e-67 3 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 2...3e-67 3 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 3e-67 3 AJ510166 |AJ510166.1 C

  9. Dicty_cDB: SSM804 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ficial sequences cloning vector DNA pDXA-3H. 216 3e-54 2 X85122 |X85122.1 Artific...vector pDXA-3FLAG. 216 3e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 3e-54 2 X85123 |X85123.1 Artific...269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 3e-54 2 X85120 |X85120.1 Artificial sequ...coideum mRNA for cysteine proteinase 1. 1233 0.0 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 3e-54 2 X85119 |X85119.1 Arti...ial sequences cloning vector DNA pDXA-HY. 216 3e-54 2 AJ510165 |AJ510165.1 Cloning

  10. Fruit intake associated with urinary estrogen metabolites in healthy premenopausal women

    OpenAIRE

    Reding, Kerryn W.; Atkinson, Charlotte; Westerlind, Kim C.; Stanczyk, Frank; Bowles, Erin J. Aiello; Yong, Mellissa; Newton, Katherine M.; Lampe, Johanna W.

    2012-01-01

    Urinary concentrations of 2:16-hydroxyestrone (2:16-OHE1) approximate concentrations of 2-OHE1 and 16α -OHE1 in breast tissue. As estrogens are purported to be involved in breast cancer development, the 2:16-OHE1 ratio can provide an indication of estrogen metabolite exposure in the breast. With prior studies observing associations between urinary estrogen metabolites and dietary intake of fruits, vegetables, and fiber ascertained from food questionnaires, we examined associations between die...

  11. Dicty_cDB: Contig-U08414-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gtcgttgnattatctaca 70 Query: 71 acttttctttcnccnactgttgaattaaccgtncaactcaataatgatgattcttcaact 130 |||||||||||...||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 71 acttttctttcnccnactgtt...|||||||||||||||||| Sbjct: 275 aaattaggaagtgcacctttgataaatcaattctaaanncngtcgttgnattatctacaa 216 Query: 72 cttttctttcnccna...|||||||||||||| Sbjct: 215 cttttctttcnccnactgttgaattaaccgtncaactcaataatgatgattcttcaactc 156 Query: 132 atacca

  12. "Pelas lentes do cinema. Bioética e ética em pesquisa". Dirce Guilhem, Debora Diniz, Fabio Zicker (Eds. ) . Letras Livres, Universidade de Brasí l i a , Brasília 2007, 216 páginas.

    OpenAIRE

    Lecuona Ramírez, Itziar de

    2008-01-01

    Comentario de un libro que está directamente relacionado con el binomio Bioética y Cine. Bajo el título "Pelas lentes do Cinema. Bioética e Ética em Pesquisa" subyace una interesante e innovadora propuesta pedagógica, sobre todo, desde el punto de vista metodológico, para la enseñanza de la Bioética a través de las películas y los documentales.

  13. Book Review: Feng Tian-yu and Xie Gui-an (2003) Destructing Despotism: Research on Neo-people- oriented Thought in Late Ming & Early Qing Dynasty , Hubei, P.R.China: Hubei Publishing House, ISBN 7-216-03727-8 / D

    OpenAIRE

    Qianfang, Xia

    2006-01-01

    Is Chinese neo-people-oriented thought a completely endogenous phenomenon or is it an outcome of eastern-western cultural exchange? This is a vexed problem that has been puzzling Chinese academia for a long period. Some scholars argue that all through its history China has never had any democratic tradition, since the required soil for the production of democracy in terms of political culture is absent. On the contrary, other scholars contend that old-line Chinese peopleoriented thought is ac...

  14. 48 CFR 1204.804-570 - Supporting closeout documents.

    Science.gov (United States)

    2010-10-01

    ...://www.dior.whs.mil/forms/DD0882.PDF, see (FAR) 48 CFR 52.227-14. (b) The forms listed in paragraph (a...) 48 CFR 52.216-7; (2) Form DOT F 4220.45, Contractor's Assignment of Refunds, Rebates, Credits and Other Amounts, (FAR) 48 CFR 52.216-7; (3) Form DOT F 4220.46, Cumulative Claim and...

  15. 77 FR 10530 - Agency Information Collection Request; 30-Day Public Comment Request

    Science.gov (United States)

    2012-02-22

    ... Public 5,544 1 10/60 924 Web usability testing General Public 144 1 1.5 216 Web usability screening... Health Professional 4,320 1 10/60 720 Web usability testing Health Professional 144 1 1.5 216 Screening... the campaign and be used to inform campaign strategies, messages, materials and Web sites. Due to...

  16. Drug: D01421 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available purate sodium; Paraaminohippurate (TN) C9H9N2O3. Na 216.0511 216.1691 D01421.gif Diagnostic aid [renal funct...ly for therapeutic purpose 72 Intracorporeal diagnostic agents 722 Various function testing reagents 7225 Diagnostic

  17. Spatial distribution of absorbed dose on the spherical phantom at Russian Service Module of ISS measured by passive detectors

    Czech Academy of Sciences Publication Activity Database

    Jadrníčková, Iva; Yasuda, N.; Kawashima, H.; Kurano, M.; Uchihori, Y.; Kitamura, H.; Akatov, YU.; Shurshakov, V.; Kobayashi, I.; Ohguchi, H.; Koguchi, Y.

    Busan : AOGS, 2008. s. 216-216. ISBN N. [Annual Meeting AOGS 2008 /5./. 16.06.2008-20.06.2008, Busan] Grant ostatní: ESA(XE) ILSRA - 2004 - 248 Institutional research plan: CEZ:AV0Z10480505 Keywords : space dosimetry * passive detectors * International space station Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders www.asiaoceania.org

  18. Locus: 3997 [

    Lifescience Database Archive (English)

    Full Text Available Hs.6111 H. sapiens + S: gi|29824586|ref|NC_000015.4|NC_000015 NC_000015 Homo sapiens mRNA; cDNA ... DKFZp686M216 (from clone DKFZp686M216) aryl hydrocarbon ... receptor binding | aryl hydrocarbon ... receptor nucle ...

  19. The design and properties of arc heaters for gas heating

    Czech Academy of Sciences Publication Activity Database

    Šenk, J.; Jakubová, I.; Chumak, Oleksiy

    Bologna : Universitá di Bologna, 2012. PS2.16-PS2.16. ISBN N. [European Plasma Conference, HTTP -12. 24.06.2012-29.06.2012, Bologna] Institutional research plan: CEZ:AV0Z20430508 Keywords : Electric arc * thermal plasma * gas heater * arc plasma torch Subject RIV: BL - Plasma and Gas Discharge Physics

  20. Sediment traps as a new tool for estimation of longevity of planktonic foraminifera

    Digital Repository Service at National Institute of Oceanography (India)

    Nigam, R.

    stream_size 9 stream_content_type text/plain stream_name Antarct_Geosci_Ocean-Atmos_Interact_Paleocli_2005_216.pdf.txt stream_source_info Antarct_Geosci_Ocean-Atmos_Interact_Paleocli_2005_216.pdf.txt Content-Encoding ISO-8859...

  1. Life history traits and threat status: a comparative study of two Onobrychis-feeding lycaenid butterflies in SE Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Šlancarová, J.; Nečasová, B.; Hula, V.; Konvička, Martin

    Praha : Czech University of Life Sciences, 2009. s. 216-216. ISBN 978-80-213-1961-5. [European Congress of Conservation Biology /2./. 01.09.2009-05.09.2009, Prague] R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50070508 Keywords : butterflies Subject RIV: EH - Ecology, Behaviour

  2. Review for the Korean Health Professionals and International Cooperation Doctors Dispatched to Peru by the Korea International Cooperation Agency (KOICA).

    Science.gov (United States)

    Kim, Bongyoung

    2015-04-01

    South Korea dispatches Korean nationals to partner developing countries as an Official Development Assistance (ODA) project through the Korea International Cooperation Agency (KOICA). In the health sector, KOICA dispatches international cooperation doctors (ICDs), nurses, physical therapists, radiologic technologists, nutritionists, medical laboratory technologists, occupational therapists, and dental hygienists. A total of 216 ICDs were dispatched over 19 times from 1995 until 2013. There were 19 areas of specialties among the ICDs. The most common specialty was internal medicine (61/216, 28.2%), the second most common specialty was general surgery (43/216, 19.9%), followed by oriental medicine (27/216, 12.5%), pediatrics (17/216, 7.9%), orthopedics (16/216, 7.4%), family medicine (16/216, 7.4%), and odontology (14/216, 6.5%). The ICDs have worked in 21 countries. KOICA dispatched the highest number of ICDs to Asia (97/216, 44.9%), followed by Africa (50/216, 23.1%), Latin America (34/216, 15.7%), the commonwealth of independent states (31/216, 14.4%), and Oceania (4/216, 1.9%). Nobody was dispatched to the Middle East. A total of 134 KOICA health professionals were dispatched to Peru from 1996 until October 1, 2014. Of these, 19.4% (26/134) were ICDs, 44.8% (60/216) were nurses, 20.1% (27/134) were physical therapists, 6.7% (9/134) were radiologic technologists, 2.2% (3/134) were nutritionists, and 6.7% (9/134) were medical laboratory. ICDs' specialties comprised internal medicine (13/26, 50%), family medicine (8/26, 30.8%), pediatrics (2/26, 7.7%), otorhinolaryngology (1/26, 3.8%), orthopedics (1/26, 3.8%), and oriental medicine (1/26, 3.8%). Most of the dispatched health professionals worked at institutions that were supported by KOICA. For this reason, the proportion of health professionals who worked at public health centers (PHCs) was the highest (58.2%, 78/134) when classified by workplace type. Other KOICA health professionals worked at hospitals

  3. Dicty_cDB: SSJ694 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available steine proteinase 1. 1217 0.0 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 8e-54 2 X85119 |X85119.1 Artificial... sequences cloning vector DNA pDXA-3H. 216 8e-54 2 X85122 |X85122.1 Artificial...216 8e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 8e-54 2 X85123 |X85123.1 Artificial...Cloning vector pDXA-FLAG, complete sequence. 216 8e-54 2 X85120 |X85120.1 Artificial sequences cloning vecto

  4. Dicty_cDB: SSD429 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 622 e-175 1 AJ510162 |AJ510162.1 Cloning vector pDXA-YFP-NotI. 216 1e-52 1 X85120 |X85120.1 Artificial seque...pDXA-GFP2, complete sequence. 216 1e-52 1 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. ...XA-CFP. 216 1e-52 1 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA...-HC. 216 1e-52 1 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 1e-52 1 AJ510166 |AJ5

  5. Fluorescent TEM-1 β-lactamase with wild-type activity as a rapid drug sensor for in vitro drug screening

    Directory of Open Access Journals (Sweden)

    Wing‑Lam Cheong

    2014-09-01

    Full Text Available We report the development of a novel fluorescent drug sensor from the bacterial drug target TEM-1 β-lactamase through the combined strategy of Val216→Cys216 mutation and fluorophore labelling for in vitro drug screening. The Val216 residue in TEM-1 is replaced with a cysteine residue, and the environment-sensitive fluorophore fluorescein-5-maleimide is specifically attached to the Cys216 residue in the V216C mutant for sensing drug binding at the active site. The labelled V216C mutant has wild-type catalytic activity and gives stronger fluorescence when β-lactam antibiotics bind to the active site. The labelled V216C mutant can differentiate between potent and impotent β-lactam antibiotics and can distinguish active-site binders from non-binders (including aggregates formed by small molecules in aqueous solution by giving characteristic time-course fluorescence profiles. Mass spectrometric, molecular modelling and trypsin digestion results indicate that drug binding at the active site is likely to cause the fluorescein label to stay away from the active site and experience weaker fluorescence quenching by the residues around the active site, thus making the labelled V216C mutant to give stronger fluorescence in the drug-bound state. Given the ancestor's role of TEM-1 in the TEM family, the fluorescent TEM-1 drug sensor represents a good model to demonstrate the general combined strategy of Val216→Cys216 mutation and fluorophore labelling for fabricating tailor-made fluorescent drug sensors from other clinically significant TEM-type β-lactamase variants for in vitro drug screening.

  6. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  7. A route for polonium 210 production from alpha-particle irradiated bismuth-209 target

    International Nuclear Information System (INIS)

    A method is proposed for production of polonium-210 via the 209Bi(α,3n)210 At nuclear reaction. Bombardment of a bismuth-209 target was performed with a 37 MeV alpha-particle beam that leads to the production of astatine-210 (T1/2 = 8.1 h), which decays to polonium-210. It is purified from the bismuth target matrix by employing liquid-liquid extraction using tributyl phosphate (TBP) in para-xylene from 7 M hydrochloric acid. Back extraction of polonium-210 was performed by 9 M nitric acid. This method allows to purify a tracer amount of Po-210 (2.6 x 10-13 mol) from macroscopic amount of Bi (2.8 x 10-2 mol).

  8. Effective bond orders from two-step spin–orbit coupling approaches: The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} case studies

    Energy Technology Data Exchange (ETDEWEB)

    Maurice, Rémi, E-mail: remi.maurice@subatech.in2p3.fr; Montavon, Gilles [SUBATECH, CNRS UMR 6457, IN2P3/EMN Nantes/Université de Nantes, 4 rue Alfred Kastler, BP 20722, 44307 Nantes Cedex 3 (France); Réal, Florent; Gomes, André Severo Pereira; Vallet, Valérie [Laboratoire PhLAM, CNRS UMR 8523, Université de Lille, 59655 Villeneuve d’Ascq Cedex (France); Galland, Nicolas [CEISAM, UMR CNRS 6230, Université de Nantes, 2 rue de la Houssinière, BP 92208, 44322 Nantes Cedex 3 (France)

    2015-03-07

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I{sub 2}, At{sub 2}, IO{sup +}, and AtO{sup +} species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At{sub 2} even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems.

  9. Effective bond orders from two-step spin–orbit coupling approaches: The I2, At2, IO+, and AtO+ case studies

    International Nuclear Information System (INIS)

    The nature of chemical bonds in heavy main-group diatomics is discussed from the viewpoint of effective bond orders, which are computed from spin–orbit wave functions resulting from spin–orbit configuration interaction calculations. The reliability of the relativistic correlated wave functions obtained in such two-step spin–orbit coupling frameworks is assessed by benchmark studies of the spectroscopic constants with respect to either experimental data, or state-of-the-art fully relativistic correlated calculations. The I2, At2, IO+, and AtO+ species are considered, and differences and similarities between the astatine and iodine elements are highlighted. In particular, we demonstrate that spin–orbit coupling weakens the covalent character of the bond in At2 even more than electron correlation, making the consideration of spin–orbit coupling compulsory for discussing chemical bonding in heavy (6p) main group element systems

  10. Different ways to improve the clinical effectiveness of radioimmunotherapy in solid tumors

    Directory of Open Access Journals (Sweden)

    Chatal Jean-Francois

    2009-09-01

    Full Text Available Radioimmunotherapy (RIT has been proven effective in the treatment of radiosensitive non-Hodgkin lymphoma but, for radioresistant solid tumors, new approaches are necessary to improve the clinical effectiveness. A real improvement has been the introduction of the pretargeting technology which appeared to be able to significantly increase tumor-to-normal organ uptake ratios.Another very promising approach consists in associating RIT with other treatment modalities. Finally the use of alpha particle-emitting radionuclides such as astatin-211 or bismuth-213 (alpha-RIT should allow to efficiently eradicate disseminated microscopic clusters of tumor cells or isolated tumor cells which fit well with the short path length of alpha particles.

  11. Sequential radioimmunotherapy with 177Lu- and 211At-labeled monoclonal antibody BR96 in a syngeneic rat colon carcinoma model

    DEFF Research Database (Denmark)

    Eriksson, Sophie E; Elgström, Erika; Bäck, Tom;

    2014-01-01

    UNLABELLED: Alpha-particle emitters, such as astatine-211 (211At), are generally considered suitable for the treatment of small cell clusters due to their short path length, while beta-particle emitters, for example, Lutetium-177 (177Lu), have a longer path length and are considered better for...... small, established tumors. A combination of such radionuclides may be successful in regimens of radioimmunotherapy. In this study, rats were treated by sequential administration of first a 177Lu-labeled antibody, followed by a 211At-labeled antibody 25 days later. METHODS: Rats bearing solid colon...... carcinoma tumors were treated with 400 MBq/kg body weight 177Lu-BR96. After 25 days, three groups of animals were given either 5 or 10 MBq/kg body weight of 211At-BR96 simultaneously with or without a blocking agent reducing halogen uptake in normal tissues. Control animals were not given any 211At-BR96...

  12. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  13. Development of 211At Chemistry for Labelling Biomolecules

    International Nuclear Information System (INIS)

    Our studies have demonstrated that high recovery of 211At can be obtained using a “wet chemistry” approach to isolation from the bismuth target. We have also demonstrated that direct labelling of antibody-B10 conjugates with 211At can be performed in high yields, and that the astatinated antibodies are stable to in vivo deastatination. While these results will allow us to enter clinical studies with 211At-labelled antibodies, the chemistry associated with 211At is not fully understood. Therefore, it is important that many more basic studies to be conducted with 211At, so the optimal labelling reagent for each type of disease-targeting agent becomes apparent

  14. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena;

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... levels of γH2AX decreased during the first 24h in both cycling and stationary cultures and complete repair was seen in all cultures but cycling cells exposed to (211)At. Compared to stationary cells alpha particles were more harmful for cycling cultures, an effect also seen at the pChk2 levels...... cultures at a modest level of damage, clearly demonstrating that cell cycle status influences the relative effectiveness of alpha particles....

  15. An improved synthesis of an 125I and 211At labelled benzamide for melanoma imaging

    International Nuclear Information System (INIS)

    Recent studies have indicated that benzamides can exhibit affinity for malignant melanoma and may be exploited diagnostically in the treatment of this cancer. Radioiodinated N-(2-diethylaminoethyl)-3-[123I/131I]iodo-4-methoxybenzamide (*I-IMBA) is a benzamide with promising diagnostic properties. A new synthesis procedure was developed to obtain 125I-IMBA suitable for use in vivo. The assets of the procedure include the use of less toxic reagents and better reproducible results when radiolabelling the precursor. The procedure also facilitates the synthesis of the astatinated N-(2-diethylaminoethyl)-3-[211At]astatine-4-methoxybenzamide (211At-AMBA), a new benzamide with a therapeutic potential. The regiospecific no-carrier-added 125I- and 211At-labeling of the benzamide is performed by demetalation of an organotin precursor. Using tributylstannyl as a leaving group, the radiochemical yield obtained after 15 minutes of reaction was 70 %-90 % for both 125I-IMBA and 211At-AMBA. The labelling was performed in a solution of MeOH:AcOH with NCS as the oxidising agent. The organotin precursor N-(2-diethylaminoethyl)-3-(tri-n-butylstannyl)-4-methoxy-benzamide was synthesized from 3-bromo-4-methoxybenzoic acid, with n-BuLi (2 eq) and Bu3SnCl (1 eq) in THF, giving 3-(tri-n-butylstannyl)-4-methoxybenzoic acid. The amide function was introduced by converting the acid group into an active N-succinimidyl-ester, a good leaving group in the reaction with 2-(diethylamino)ethylamine. The overall yield of the organotin precursor was 65 %

  16. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, B.A., E-mail: bruce.marsh@cern.ch [CERN, CH-1211 Geneva (Switzerland); Andel, B. [Comenius University, Bratislava (Slovakia); Andreyev, A.N. [University of York, Department of Physics, York YO10 5DD (United Kingdom); Antalic, S. [Comenius University, Bratislava (Slovakia); Atanasov, D. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Barzakh, A.E. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Bastin, B. [Grand Accérateur National d’Ions Lourds (GANIL), Bd Henri Becquerel, F-14076 Caen (France); Borgmann, Ch. [Max-Planck-Institut für Kernphysik, Saupfercheckweg 1, 69117 Heidelberg (Germany); Capponi, L. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Cocolios, T.E.; Day Goodacre, T. [CERN, CH-1211 Geneva (Switzerland); University of Manchester, Manchester (United Kingdom); Dehairs, M. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Derkx, X. [University of the West of Scotland, School of Engineering, Paisley PA1 2BE (United Kingdom); De Witte, H. [KU Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fedorov, D.V. [Petersburg Nuclear Physics Institute, NRC Kurchatov Institute, 188300 Gatchina (Russian Federation); Fedosseev, V.N.; Focker, G.J. [CERN, CH-1211 Geneva (Switzerland); Fink, D.A. [Ruprecht-Karls Universität, Seminarstr. 2, 69117 Heidelberg (Germany); CERN, CH-1211 Geneva (Switzerland); Flanagan, K.T. [University of Manchester, Manchester (United Kingdom); Franchoo, S. [CSNSM-IN2P3-CNRS, Université Paris-Sud, 91406 Orsay (France); and others

    2013-12-15

    Highlights: • Upgrade of the lasers, detectors and data acquisition for in-source resonance ionization spectroscopy at ISOLDE. • First use of the ISOLTRAP MR-ToF MS in combination with laser spectroscopy at ISOLDE. • Resonance ionization of astatine for the study of its nuclear structure. -- Abstract: At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  17. Analysis of natural isolates of Lactobacilli resistant to bacteriocin nisin

    Directory of Open Access Journals (Sweden)

    Strahinić Ivana D.

    2005-01-01

    Full Text Available The collection of lactic acid bacteria (LAB was made by isolation of microorganisms from fermented products traditionally manufactured in different geographical regions (high mountains, river valleys, seaside, etc. Among collected LAB, 51 isolates were identified as Lactobacillus sp. Results showed that all isolated lactobacilli were mesophilic strains, since they grew at 15°C and 30°C but not at 45°C. Testing the ability of isolated lactobacilli to grow in the presence of nisin revealed that Lactobacillus sp. isolates designed BGCGK4, BGHN40, BGBUK2-8, BGBUK2-7 and BGBUK2-16 were resistant to nisin. Determination of the minimal inhibitory concentrations (MIC for nisin revealed that the most resistant isolate was Lactobacillus sp. BGCGK4. Isolate BGBUK2-16, determined as Lactobacillus paracasei subsp. paracasei, produces bacteriocin, named Bac217 and showed a resistance to 8000 IU/ml of nisin. Plasmid curing of BGBUK2-16 resulted in derivatives BGBUK2-16/K2 and BGBUK2-16/K4. Derivative BGBUK2-16/K2 retained resistance to Bac217 and nisin, but lost the ability to synthesise Bac217. Derivative BGBUK2-16/K4 lost concomitantly the resistance to both Bac217 and nisin.

  18. The Surgical Management of Concomitant Gallbladder and Common Bile Duct Stones.

    Science.gov (United States)

    Darrien, J H; Connor, K; Janeczko, A; Casey, J J; Paterson-Brown, S

    2015-01-01

    Background. The management of choledocholithiasis has evolved from open common bile duct exploration (OCBDE) to therapeutic endoscopic retrograde cholangiopancreatography (ERCP) to laparoscopic common bile duct exploration (LCBDE). Each entails a degree of difficulty. Aim. To review 5-year results of bile duct exploration in an UGI unit. Methods. Common bile duct explorations (CBDEs) performed between January 2008 and January 2013 were identified from a prospectively collected clinical audit system and results reviewed retrospectively. Results. 216 CBDEs were performed, 119 (55%) as an emergency and 52 (24%) following failed ERCP. Open CBDE (OCBDE) was performed primarily in 34/216 (16%) patients and attempted laparoscopically in 182 (84%). Fifty nine (32%) Laparoscopic CBDEs (LCBDEs) were converted to OCBDE. Of the remaining 123 LCBDEs, 51 (41%) primary choledochotomies and 72 (59%) primary transcystic CBDEs (TC-CBDEs) were performed. Forty nine (68%) TC-CBDEs were considered successful and 23 (32%) failed. Fifteen failed TC-CBDEs were converted to a successful laparoscopic choledochotomy. Ductal clearance was achieved in 187/216 (87%) patients and retained stones were identified in 20/123 (16%) LCBDEs. Complications occurred in 52/216 (24%) patients. There were 8/216 (4%) bile leaks requiring further intervention. Postoperative ERCP was carried out in 32/216 (15%) patients and 9/216 (4%) required relaparoscopy/laparotomy. No patient died. Conclusions. Successful management of choledocholithiasis requires a breadth of laparoscopic and endoscopic expertise. PMID:26420916

  19. The Surgical Management of Concomitant Gallbladder and Common Bile Duct Stones

    Directory of Open Access Journals (Sweden)

    J. H. Darrien

    2015-01-01

    Full Text Available Background. The management of choledocholithiasis has evolved from open common bile duct exploration (OCBDE to therapeutic endoscopic retrograde cholangiopancreatography (ERCP to laparoscopic common bile duct exploration (LCBDE. Each entails a degree of difficulty. Aim. To review 5-year results of bile duct exploration in an UGI unit. Methods. Common bile duct explorations (CBDEs performed between January 2008 and January 2013 were identified from a prospectively collected clinical audit system and results reviewed retrospectively. Results. 216 CBDEs were performed, 119 (55% as an emergency and 52 (24% following failed ERCP. Open CBDE (OCBDE was performed primarily in 34/216 (16% patients and attempted laparoscopically in 182 (84%. Fifty nine (32% Laparoscopic CBDEs (LCBDEs were converted to OCBDE. Of the remaining 123 LCBDEs, 51 (41% primary choledochotomies and 72 (59% primary transcystic CBDEs (TC-CBDEs were performed. Forty nine (68% TC-CBDEs were considered successful and 23 (32% failed. Fifteen failed TC-CBDEs were converted to a successful laparoscopic choledochotomy. Ductal clearance was achieved in 187/216 (87% patients and retained stones were identified in 20/123 (16% LCBDEs. Complications occurred in 52/216 (24% patients. There were 8/216 (4% bile leaks requiring further intervention. Postoperative ERCP was carried out in 32/216 (15% patients and 9/216 (4% required relaparoscopy/laparotomy. No patient died. Conclusions. Successful management of choledocholithiasis requires a breadth of laparoscopic and endoscopic expertise.

  20. Carga parasitária de Rondonia rondoni, Travassos, 1920 (Nematoda, Atrictidae e fator de condição do armado, Pterodoras granulosus, Valenciennes, 1833 (Pisces, Doradidae - DOI: 10.4025/actascibiolsci.v26i2.1613 Effect of parasitic load of Rondonia rondoni, Travassos, 1920 (Nematoda, Atrictidae over the condition factor of thorny catfish Pterodoras Granulosus (Valenciennes, 1833 (Pisces, Doradidae - DOI: 10.4025/actascibiolsci.v26i2.16

    Directory of Open Access Journals (Sweden)

    Marion Haruko Machado

    2004-04-01

    Full Text Available Objetiva-se avaliar o efeito da carga parasitária de Rondonia rondoni sobre o fator de condição de armados, Pterodoras granulosus. Foram necropsiados 51 espécimes de armados, coletados no rio Paraná (Porto Rico/Paraná. Para as análises, utilizaram-se os testes de “t”, de Student, para determinar se o comprimento dos hospedeiros machos e fêmeas eram semelhantes; “U”, de Mann-Whitney, para determinar o efeito do sexo do hospedeiro na intensidade de infecção da espécie de parasito; “G” Log-likelihood, para determinar o efeito do sexo do hospedeiro na prevalência do parasito; coeficiente de correlação (CC “r”, para determinar a correlação entre o comprimento do hospedeiro e a prevalência de infecção; CC por postos de Spearman “rs”, para determinar as possíveis correlações entre a intensidade de infecção e a diversidade parasitária com o comprimento do hospedeiro e para verificar a correlação entre a intensidade parasitária e o fator de condição (K. Os resultados permitiram concluir que, apesar das variações no comprimento entre machos e fêmeas, o sexo não influencia na intensidade e na prevalência de infecção. Porém a intensidade de parasitismo e a prevalência aumentaram com o incremento do comprimento do hospedeiro, e a intensidade parece não afetar o fator de condição de armado, o qual parece estar em equilíbrio com esse parasita nesse ambienteAiming to evaluate the effect of parasitic load of Rondonia rondoni over the condition factor of Pterodoras granulosus. Fifty one specimens of P. granulosus were collected in Paraná River, (Porto Rico/Paraná. To analyze were used: Student’s “t”, to determine if length of hosts males and females were similar; Mann-Whitney test “U”, to determine the effect of sex of host on the intensity of infestion of the parasite; “G” Log-likelihood test, to determine the effect of sex of the host on the prevalence of parasite; coefficient of correlation “r”, to determine the correlation between the length of host and the prevalence of infection; Spearman rank correlation coefficient “rs”, to determine as possible correlation’s between the intensity of infection and the parasitic diversity with the length of the host, and to examine the correlation between the parasitic intensity and the condition factor (K. Based in this results we conclude, that despite of variations in the length, between males and females, the sex does not influence in the intensity and prevalence of infection. However, the intensity of parasites and the prevalence of R. rondoni increased with the length of host being that, the intensity does not affect the condition factor of Pterodoras granulosus, which mean to be in equilibrium with the parasite in this local

  1. Vztahy v letech 1989-1993. Rekonstrukce vzájemných vztahů po 17. listopadu 1989

    Czech Academy of Sciences Publication Activity Database

    Voráček, Emil

    PR-Aspekt International : Praha, 2014 - (Sudlenkova, N.), s. 206-216 ISBN 978-80-904339-0-8 Institutional support: RVO:67985963 Keywords : reconstruction * withdrawal * soviet army Subject RIV: AB - History

  2. Vývoj rodové identity dětí mladšího a středního školního věku

    Czech Academy of Sciences Publication Activity Database

    Janošová, Pavlína

    2003-01-01

    Roč. 38, č. 3 (2003), s. 216-235. ISSN 0555-5574 Institutional research plan: CEZ:AV0Z7025918 Keywords : gender role acquirement * gender identity development * younght school age Subject RIV: AN - Psychology

  3. Where to Go Next?

    Czech Academy of Sciences Publication Activity Database

    Kindlmann, Pavel

    1st ed. Dodrecht : Springer, 2012 - (Kindlmann, P.), s. 215-216 ISBN 978-94-007-1801-2. - (Biomedical and Life Sciences) Institutional research plan: CEZ:AV0Z60870520 Keywords : conservation * Himalayan Subject RIV: EH - Ecology, Behaviour

  4. Effect of increased urea levels on mouse preimplantation embryos develop in vivo and in vitro

    Czech Academy of Sciences Publication Activity Database

    Bystriansky, J.; Burkuš, J.; Juhás, Štefan; Fabian, D.; Koppel, J.

    2012-01-01

    Roč. 56, č. 2 (2012), s. 211-216. ISSN 0042-4870 Institutional support: RVO:67985904 Keywords : mouse * preimplantation embryo * urea Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.377, year: 2012

  5. Assessing Interdisciplinary Education in U.S. Dental Hygiene Programs.

    Science.gov (United States)

    Holt, Lorie; Bray, Kimberly; Mayberry, Bill; Overman, Pamela

    2000-01-01

    Survey responses from 136 of 216 dental hygiene programs indicated that 31% included interdisciplinary activities in the curriculum; only 15% included both clinical and instructional interdisciplinary coursework. However, 74% felt that students would benefit from interdisciplinary experiences. (SK)

  6. 76 FR 5328 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-01-31

    ... Agricultural Research Service's (ARS) Agricultural System Competitiveness and Sustainability National Program... a currently valid OMB control number. Agricultural Research Service Title: National Program 216... and communication channels in transferring new technologies developed under the Agricultural...

  7. Organic heterostructures based on arylenevinylene oligomers deposited by MAPLE

    Czech Academy of Sciences Publication Activity Database

    Socol, M.; Preda, N.; Vacareanu, L.; Grigoras, M.; Socol, G.; Mihailescu, I. N.; Stanculescu, F.; Jelínek, Miroslav; Stanculescu, A.; Stoicanescu, M.

    2014-01-01

    Roč. 302, May (2014), s. 216-222. ISSN 0169-4332 Institutional support: RVO:68378271 Keywords : organic heterostructures * MAPLE * oligomer * optoelectronica Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.711, year: 2014

  8. State waste discharge permit application: Hydrotest, maintenance and construction discharges. Revision 0

    International Nuclear Information System (INIS)

    On December 23, 1991, the US DOE< Richland Operation Office (RL) and the Washington State Department of Ecology (Ecology) agreed to adhere to the provisions of the Department of Ecology Consent Order No. DE91NM-177 (216 Consent Order) (Ecology and US DOE 1991). The 216 Consent Order list regulatory milestones for liquid effluent streams at the Hanford Site and requires compliance with the permitting requirements of Washington Administrative Code. Hanford Site liquid effluent streams discharging to the soil column have been categorized on the 216 Consent Order as follows: Phase I Streams; Phase II Streams; Miscellaneous Streams. Phase I and Phase II Streams were initially addressed in two report. Miscellaneous Streams are subject to the requirements of several milestones identified in the 216 Consent Order. This document constitutes the Categorical State Waste Discharge Permit application for hydrotest,maintenance and construction discharges throughout the Hanford Site. This categorical permit application form was prepared and approved by Ecology

  9. K problému sekundárního (nepřímého) tlumočení v moderním českém biblickém překladu

    Czech Academy of Sciences Publication Activity Database

    Bartoň, Josef

    2013-01-01

    Roč. 5, č. 2 (2013), s. 207-216. ISSN 1804-1132 Institutional support: RVO:67985955 Keywords : Czech Biblical translation * indirect translation * second-hand translation Subject RIV: AI - Linguistics

  10. Weather-related Tree Swallow Mortality and Reduced Nesting Effort

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report documents the spring 2007 die-off of 216 Tree Swallows in western New York due to a period of unseasonably warm temperatures followed immediately by a...

  11. Co-doping effects on luminescence and scintillation properties of Ce doped Lu.sub.3./sub.Al.sub.5./sub.O.sub.12./sub. scintillator

    Czech Academy of Sciences Publication Activity Database

    Kamada, K.; Nikl, Martin; Kurosawa, S.; Beitlerová, Alena; Nagura, A.; Shoji, Y.; Pejchal, Jan; Ohashi, Y.; Yokota, Y.; Yoshikawa, A.

    2015-01-01

    Roč. 782, May (2015), s. 9-12. ISSN 0168-9002 Institutional support: RVO:68378271 Keywords : garnet * single crystal * scintillator * cerium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.216, year: 2014

  12. Copolymerization of N-(prop-1-yne-3-yl)-4-(piperidine-1-yl)-1,8-naphthalimide with arylacetylenes into fluorescent polyacetylene-type conjugated polymers

    Czech Academy of Sciences Publication Activity Database

    Sivkova, R.; Trhlíková, Olga; Zedník, J.; Sedláček, J.

    2015-01-01

    Roč. 216, č. 21 (2015), s. 2115-2128. ISSN 1022-1352 Institutional support: RVO:61389013 Keywords : copolymerization * fluorescence * naphthalimide Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.616, year: 2014

  13. Assessment of Undiscovered Oil and Gas Resources of Southeast Asia, 2010

    Science.gov (United States)

    2010-01-01

    Using a geology-based assessment methodology, the U.S. Geological Survey (USGS) estimated means of 21.6 billion barrels of oil and 299 trillion cubic feet of undiscovered natural gas in 22 provinces of southeast Asia.

  14. Medline Plus

    Full Text Available ... Cardiac Catheterization: The New Frontier of Coronary Intervention (University of Chicago Medical Center, Chicago, IL, 6/26/ ... Miami, FL, 5/07/2009) Hybrid Arch Debranching (University of Maryland Medical Center, Baltimore, MD, 2/16/ ...

  15. Origin and spectral degradation of the photoluminescence from a-SiOx

    Science.gov (United States)

    Kistner, J.; Schubert, M. B.

    2013-11-01

    This paper reports for the first time on a spectral degradation of photoluminescence from a-SiOx that occurs due to the storage of the samples in ambient atmosphere. The spectra of samples with an initial emission peak EPL,ini > 2.16 eV shift to lower energies. The degraded spectra have a common maximum at EPL,deg ≈ 2.16 eV. In the spectra of samples with EPL,ini EPL ≈ 2.16 eV develops. The initial photoluminescence spectra result from radiative recombination between tail states. The degraded luminescence is dominated by two effects. On the one hand, band tail luminescence still occurs. On the other hand, the prevalent emission around EPL,deg ≈ 2.16 eV originates from recombination attributed to Si = O bonds.

  16. The Slaw and the Slow Cooked: Culture and Barbecue in the Mid-South

    OpenAIRE

    Jon D. Holtzman

    2012-01-01

    Review of The Slaw and the Slow Cooked: Culture and Barbecue in the Mid-South. James R. Veteto and Edward M. Maclin, eds. 2011 Vanderbilt University Press, Nashville. Pp. 216 $22.95 (paperback). ISBN 978-0826518019. 

  17. Mapping the Kathmandu Valley With Aerial Photographs by Erwin Schneider

    OpenAIRE

    Urmi Sengupta

    2015-01-01

    Reviewed: Mapping the Kathmandu Valley With Aerial Photographs by Erwin Schneider By Neils Gutschow and Hermann Kreutzmann. Kathmandu, Nepal: Himal Books, 2013. 216 pp. US $ 48.00. ISBN 978-9937-597-06-7.

  18. The Case C-34/09 Ruiz Zambrano v. ONEm - the Timeless Judgment of the Court of Justice on EU Citizenship

    Czech Academy of Sciences Publication Activity Database

    Hamerník, Pavel

    151/2, č. 9/3 TLQ (2012), s. 216-224. ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : EU Citizenship * cross-border situations * third country nationals Subject RIV: AG - Legal Sciences

  19. What are the transitions of woodlands at the landscape level? Change trajectories of forest, non-forest and reclamation woody vegetation elements in a mining landscape in North-western Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Skaloš, J.; Novotný, M.; Woitsch, Jiří; Zacharová, J.; Berchová, K.; Svoboda, M.; Křováková, K.; Romportl, D.; Keken, Z.

    2015-01-01

    Roč. 58, March (2015), s. 206-216. ISSN 0143-6228 Institutional support: RVO:68378076 Keywords : Forest history * Change trajectories * GIS * Mining landscape Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 2.494, year: 2014

  20. Design procedure of pressure losses for hydrotransport of the high concentration pulps

    Czech Academy of Sciences Publication Activity Database

    Aleksandrov, V.I.; Vlasák, Pavel

    2015-01-01

    Roč. 216 (2015), s. 37-43. ISBN 978-5-94211-749-8. ISSN 0135-3500 Institutional support: RVO:67985874 Keywords : pressure losses * concentration * slurry * rheological parameters Subject RIV: BK - Fluid Dynamics