WorldWideScience

Sample records for astatine 216

  1. Radiochemistry of astatine

    International Nuclear Information System (INIS)

    Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs

  2. Formation and decomposition of astatine molecules

    International Nuclear Information System (INIS)

    Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi

    1989-01-01

    A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine

  3. Organic astatine compounds, their preparation and properties

    Energy Technology Data Exchange (ETDEWEB)

    Vasaros, L; Berei, K

    1985-01-01

    Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.

  4. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1992-02-01

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  5. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1994-03-01

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  6. Experimental and computational evidence of halogen bonds involving astatine

    Science.gov (United States)

    Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas

    2018-03-01

    The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.

  7. The reaction of astatine with aromatic diazonium compounds

    International Nuclear Information System (INIS)

    Visser, G.W.M.; Diemer, E.L.

    1982-01-01

    Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    Science.gov (United States)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620

  9. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  10. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...

  11. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Visser, G.W.M.

    1982-01-01

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  12. 50 CFR 216.216 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.216 Mitigation. (a) The...

  13. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.

    2003-01-01

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  14. Estimation of the chemical form and the boiling point of elementary astatine by radiogas-chromatography

    International Nuclear Information System (INIS)

    Otozai, K.; Takahashi, N.

    1982-01-01

    After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)

  15. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    Czech Academy of Sciences Publication Activity Database

    Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.

    2003-01-01

    Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003

  16. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Pruszynski, M.; Bilewicz, A.

    2006-01-01

    211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex

  17. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  18. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  19. Thermogravimetric determination of the enthalpy of astatine and radon adsorption on palladium surfaces

    International Nuclear Information System (INIS)

    Eichler, B.; Son Chun, K.

    1985-01-01

    In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)

  20. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  1. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    International Nuclear Information System (INIS)

    Lahiri, Susanta; Roy, Kamalika; Sen, Souvik

    2008-01-01

    No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h

  2. Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis

    International Nuclear Information System (INIS)

    Zalutsky, Michael R.

    2012-01-01

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted

  3. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  4. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  5. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)

    2005-11-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  6. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    International Nuclear Information System (INIS)

    Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.

    2005-01-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  7. High-efficiency astatination of antibodies using N-iodosuccinimide as the oxidising agent in labelling of N-succinimidyl 3-(trimethylstannyl)benzoate

    International Nuclear Information System (INIS)

    Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.

    2001-01-01

    Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling

  8. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  9. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  10. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  11. 216-T-4 interim stabilization final report

    International Nuclear Information System (INIS)

    Smith, D.L.

    1996-01-01

    This report provides a general description of the activities performed for the interim stabilization of the 216-T-4-1 ditch, 216-T-4-2 ditch, and 216-T-4-2 pond. Interim stabilization was required to reduce the amount of surface-contaminated acres and to minimize the migration of radioactive contamination. Work associated with the 216-T4-1 ditch and 216-T-4-2 pond was performed by the Radiation Area Remedial Action (RARA) Project. Work associated with the 216-T-4-2 ditch was done concurrently but was funded by Westinghouse Hanford Company (WHC) Tank Waste Remediation Systems (TWRS)

  12. Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death

    Energy Technology Data Exchange (ETDEWEB)

    Claesson, Kristina

    2011-05-15

    In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At

  13. 50 CFR 216.86 - Local regulations.

    Science.gov (United States)

    2010-10-01

    ... Pribilof Islands Administration § 216.86 Local regulations. Local regulations will be published from time... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Local regulations. 216.86 Section 216.86 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION...

  14. 50 CFR 216.42 - Photography. [Reserved

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Photography. [Reserved] 216.42 Section 216.42 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Special Exceptions § 216.42...

  15. 50 CFR 216.82 - Dogs prohibited.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Dogs prohibited. 216.82 Section 216.82... Pribilof Islands Administration § 216.82 Dogs prohibited. In order to prevent molestation of fur seal herds, the landing of any dogs at Pribilof Islands is prohibited. [41 FR 49488, Nov. 9, 1976. Redesignated at...

  16. 48 CFR 216.603-2 - Application.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Application. 216.603-2 Section 216.603-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM...-Hour, and Letter Contracts 216.603-2 Application. (c)(3) In accordance with 10 U.S.C. 2326, establish...

  17. 10 CFR 216.1 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Introduction. 216.1 Section 216.1 Energy DEPARTMENT OF ENERGY OIL MATERIALS ALLOCATION AND PRIORITY PERFORMANCE UNDER CONTRACTS OR ORDERS TO MAXIMIZE DOMESTIC ENERGY SUPPLIES § 216.1 Introduction. (a) This part describes and establishes the procedures to be used...

  18. 22 CFR 216.8 - Public hearings.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public hearings. 216.8 Section 216.8 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.8 Public hearings. (a) In most instances AID will be able to gain the benefit of public participation in the impact statement process...

  19. 50 CFR 216.87 - Wildlife research.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Wildlife research. 216.87 Section 216.87 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Pribilof Islands Administration § 216.87 Wildlife research. (a) Wildlife research, other than research on...

  20. 22 CFR 216.5 - Endangered species.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Endangered species. 216.5 Section 216.5 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.5 Endangered species. It is A... endangered or threatened species and their critical habitats. The Initial Environmental Examination for each...

  1. 27 CFR 28.216 - Export marks.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.216 Section 28.216 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback § 28.216...

  2. 31 CFR 0.216 - Privacy Act.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Privacy Act. 0.216 Section 0.216... RULES OF CONDUCT Rules of Conduct § 0.216 Privacy Act. Employees involved in the design, development, operation, or maintenance of any system of records or in maintaining records subject to the Privacy Act of...

  3. 25 CFR 216.8 - Performance bond.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Performance bond. 216.8 Section 216.8 Indians BUREAU OF... RECLAMATION OF LANDS General Provisions § 216.8 Performance bond. (a) Upon approval of an exploration plan or mining plan, the operator shall be required to file a suitable performance bond of not less than $2,000...

  4. 49 CFR 216.7 - Penalties.

    Science.gov (United States)

    2010-10-01

    ... hazard of death or injury to persons, or has caused death or injury, a penalty not to exceed $100,000 per... 49 Transportation 4 2010-10-01 2010-10-01 false Penalties. 216.7 Section 216.7 Transportation... § 216.7 Penalties. Any person (an entity of any type covered under 1 U.S.C. 1, including but not limited...

  5. 50 CFR 216.253 - Prohibitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.253... shall: (a) Take any marine mammal not specified in § 216.250(b); (b) Take any marine mammal specified in...

  6. 50 CFR 216.184 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Mitigation. 216.184 Section 216.184 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... the coast from 47°07′ N. to 48°30′ N. latitude December January, March and May. (9) Flower Garden...

  7. 29 CFR 553.216 - Other exemptions.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Other exemptions. 553.216 Section 553.216 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS APPLICATION OF THE FAIR LABOR STANDARDS ACT TO EMPLOYEES OF STATE AND LOCAL GOVERNMENTS Fire Protection and Law...

  8. 42 CFR 93.216 - Notice.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Notice. 93.216 Section 93.216 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT...

  9. 50 CFR 216.251 - Effective dates.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.251...

  10. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  11. 48 CFR 216.470 - Other applications of award fees.

    Science.gov (United States)

    2010-10-01

    ... award fees. 216.470 Section 216.470 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contracts 216.470 Other applications of award fees. See PGI 216.470 for guidance on other applications of award fees. [71 FR 39008, July 11, 2006] ...

  12. 20 CFR 216.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... means a company, individual, or other entity determined to be a covered employer under the Railroad... in section 216(1) of the Social Security Act. Social Security Act means the Social Security Act as amended. Tier I benefit means the benefit component calculated using Social Security Act formulas and...

  13. 50 CFR 216.212 - Effective dates.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.212 Effective dates...

  14. 50 CFR 216.214 - Prohibitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.214 Prohibitions. No...

  15. 50 CFR 216.254 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.254... greatest extent practicable, adverse impacts on marine mammal species and stocks and their habitats. When...

  16. 10 CFR 216.7 - Conflict in priority orders.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Conflict in priority orders. 216.7 Section 216.7 Energy... DOMESTIC ENERGY SUPPLIES § 216.7 Conflict in priority orders. If it appears that the use of assistance pursuant to DPA section 101(c) creates or threatens to create a conflict with priorities and allocation...

  17. 9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...

  18. 22 CFR 216.10 - Records and reports.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Records and reports. 216.10 Section 216.10 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.10 Records and... statements, Determinations and Declarations which will be available to the public under the Freedom of...

  19. 42 CFR 2.16 - Security for written records.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Security for written records. 2.16 Section 2.16 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS CONFIDENTIALITY OF ALCOHOL AND DRUG ABUSE PATIENT RECORDS General Provisions § 2.16 Security for written records...

  20. 50 CFR 216.83 - Importation of birds or mammals.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Importation of birds or mammals. 216.83 Section 216.83 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... MAMMALS Pribilof Islands Administration § 216.83 Importation of birds or mammals. No mammals or birds...

  1. 48 CFR 216.405 - Cost-reimbursement incentive contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-reimbursement incentive contracts. 216.405 Section 216.405 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contracts 216.405 Cost-reimbursement incentive contracts. ...

  2. 216-B-3 expansion ponds closure plan

    Energy Technology Data Exchange (ETDEWEB)

    1994-10-01

    This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA.

  3. 216-B-3 expansion ponds closure plan

    International Nuclear Information System (INIS)

    1994-10-01

    This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA

  4. 216-Z-8 French drain characterization study

    International Nuclear Information System (INIS)

    Marratt, M.C.; Kasper, R.B.; Van Luik, A.E.

    1984-09-01

    The 216-Z-8 French drain study is one of a series of studies examining historical transuranic waste facilities no longer in use at the Hanford Site. The 216-Z-8 French drain underground disposal system consisted of a large settling tank that overflowed into a French drain. The French drain consisted of two large-diameter, gravel filled, vitrified clay pipes placed on end, end-to-end, over a gravel-filled excavation. The top of the drain was sealed with concrete to prevent the upward flow of waste solution. The waste solution discharged to the 216-Z-8 waste disposal system was a neutralized, transuranic recovery process, filter cake, backflush slurry. The primary objective of this study was to determine the distribution of plutonium and americium beneath the French drain. Transuranic activity under the French drain did not exceed 5 nCi/g in the soil samples obtained from a well within 1 m of the drain structure. Conservative estimates indicated that 4 to 5 m 3 of radioactive contaminated sediments, 10 nCi/g may lie directly under the 216-Z-8 French drain. The secondary objective of the study was to evaluate the possibility of a leak in the settling tank. Results from the analysis of soil samples from wells drilled around the settling tank indicated the presence of low-level transuranic contamination (on the order of 0.001 nci/g) in the soil surrounding the tank. However, the distribution of the contamination does not support a leak as a plausible mechanism to account for the observed activity surrounding the tank. The bulk of the plutonium was confirmed to be in the sludge that remained in the tank; thus, no significant environmental impact would be expected even if there has been a leak

  5. Identification of the zinc finger 216 (ZNF216) in human carcinoma cells: a potential regulator of EGFR activity

    Science.gov (United States)

    Mincione, Gabriella; Di Marcantonio, Maria Carmela; Tarantelli, Chiara; Savino, Luca; Ponti, Donatella; Marchisio, Marco; Lanuti, Paola; Sancilio, Silvia; Calogero, Antonella; Di Pietro, Roberta; Muraro, Raffaella

    2016-01-01

    Epidermal Growth Factor Receptor (EGFR), a member of the ErbB family of receptor tyrosine kinase (RTK) proteins, is aberrantly expressed or deregulated in tumors and plays pivotal roles in cancer onset and metastatic progression. ZNF216 gene has been identified as one of Immediate Early Genes (IEGs) induced by RTKs. Overexpression of ZNF216 protein sensitizes 293 cell line to TNF-α induced apoptosis. However, ZNF216 overexpression has been reported in medulloblastomas and metastatic nasopharyngeal carcinomas. Thus, the role of this protein is still not clearly understood. In this study, the inverse correlation between EGFR and ZNF216 expression was confirmed in various human cancer cell lines differently expressing EGFR. EGF treatment of NIH3T3 cells overexpressing both EGFR and ZNF216 (NIH3T3-EGFR/ZNF216), induced a long lasting activation of EGFR in the cytosolic fraction and an accumulation of phosphorylated EGFR (pEGFR) more in the nuclear than in the cytosolic fraction compared to NIH3T3-EGFR cells. Moreover, EGF was able to stimulate an increased expression of ZNF216 in the cytosolic compartment and its nuclear translocation in a time-dependent manner in NIH3T3-EGFR/ZNF216. A similar trend was observed in A431 cells endogenously expressing the EGFR and transfected with Znf216. The increased levels of pEGFR and ZNF216 in the nuclear fraction of NIH3T3-EGFR/ZNF216 cells were paralleled by increased levels of phospho-MAPK and phospho-Akt. Surprisingly, EGF treatment of NIH3T3-EGFR/ZNF216 cells induced a significant increase of apoptosis thus indicating that ZNF216 could sensitize cells to EGF-induced apoptosis and suggesting that it may be involved in the regulation and effects of EGFR signaling. PMID:27732953

  6. 50 CFR 216.91 - Dolphin-safe labeling standards.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Dolphin-safe labeling standards. 216.91... MAMMALS Dolphin Safe Tuna Labeling § 216.91 Dolphin-safe labeling standards. (a) It is a violation of... include on the label of those products the term “dolphin-safe” or any other term or symbol that claims or...

  7. 36 CFR 2.16 - Horses and pack animals.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Horses and pack animals. 2.16... RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.16 Horses and pack animals. The following are prohibited: (a) The use of animals other than those designated as “pack animals” for purposes of transporting...

  8. 17 CFR 256.216 - Unappropriated retained earnings.

    Science.gov (United States)

    2010-04-01

    ... retained earnings. This account shall include the balance, either debit or credit, arising from earnings... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Unappropriated retained earnings. 256.216 Section 256.216 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  9. 27 CFR 40.216a - Notice for pipe tobacco.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Notice for pipe tobacco. 40.216a Section 40.216a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS...

  10. 27 CFR 40.216 - Notice for smokeless tobacco.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Notice for smokeless tobacco. 40.216 Section 40.216 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS...

  11. 20 CFR 802.216 - Service and form of papers.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Service and form of papers. 802.216 Section... Prereview Procedures Initial Processing § 802.216 Service and form of papers. (a) All papers filed with the...), date of signature, and certificate of service. (b) For each paper filed with the Board, the original...

  12. 48 CFR 1852.216-78 - Firm fixed price.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Firm fixed price. 1852.216... 1852.216-78 Firm fixed price. As prescribed in 1816.202-70, insert the following clause: Firm Fixed Price (DEC 1988) The total firm fixed price of this contract is $[Insert the appropriate amount]. (End...

  13. 48 CFR 1352.216-77 - Ceiling price.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Ceiling price. 1352.216-77... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.216-77 Ceiling price. As prescribed in 48 CFR 1316.601-70 and 1316.602-70, insert the following clause: Ceiling Price (APR 2010) The...

  14. 48 CFR 452.216-74 - Ceiling Price.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Ceiling Price. 452.216-74... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.216-74 Ceiling Price. As prescribed in 416.670, insert the following clause: Ceiling Price (FEB 1988) The ceiling price of this...

  15. 48 CFR 1652.216-71 - Accounting and Allowable Cost.

    Science.gov (United States)

    2010-10-01

    ... of FEHBP Clauses 1652.216-71 Accounting and Allowable Cost. As prescribed in section 1616.7002, the...). Accounting and Allowable Cost (FEHBAR 1652.216-71) (JAN 2003) (a) Annual Accounting Statements. (1) The... addition, the Carrier must: (i) on request, document and make available accounting support for the cost to...

  16. 12 CFR Appendix B to Part 216 - Sample Clauses

    Science.gov (United States)

    2010-01-01

    ... CONSUMER FINANCIAL INFORMATION (REGULATION P) Pt. 216, App. B Appendix B to Part 216—Sample Clauses Link to..., such as “call the following toll-free number: (insert number)”]. A-7—Confidentiality and security (all...

  17. 48 CFR 216.104-70 - Research and development.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Research and development... Contract Types § 216.104-70 Research and development. Follow the procedures at PGI 216.104-70 for selecting the appropriate research and development contract type. [71 FR 39007, July 11, 2006] ...

  18. 48 CFR 452.216-70 - Award Fee.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Award Fee. 452.216-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.216-70 Award Fee. As prescribed in 416.405, insert a clause substantially as follows: Award Fee (FEB 1988) The amount of award fee...

  19. 12 CFR 216.2 - Model privacy form and examples.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Model privacy form and examples. 216.2 Section... PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) § 216.2 Model privacy form and examples. (a... of this part, although use of the model privacy form is not required. (b) Examples. The examples in...

  20. 25 CFR 216.6 - Approval of exploration plan.

    Science.gov (United States)

    2010-04-01

    ... control fire, soil erosion, pollution of surface and ground water, damage to fish and wildlife or other... 25 Indians 1 2010-04-01 2010-04-01 false Approval of exploration plan. 216.6 Section 216.6 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS SURFACE EXPLORATION, MINING, AND...

  1. Monitoring plan for borehole logging at 216-Z-1A Tile Field, 216-Z-9 Trench, and 216-Z-12 Crib

    International Nuclear Information System (INIS)

    Horton, D.G.

    1998-04-01

    This plan describes the fiscal year 1998 vadose monitoring of three inactive, liquid waste disposal facilities associated with the Plutonium Finishing Plant (Z-Plant): the 216-Z-1A Tile Field, the 216-Z-9 Trench, and the 216-Z-12 Crib. Monitoring will consist of spectral gamma ray logging of 21 boreholes. This plan describes the physical characteristics of the facilities, their operational histories, the subsurface geology and known contamination distribution at each facility. The plan then describes the specific monitoring to be done including the boreholes to be logged, the methods of data acquisition, data reduction, and data evaluation, and finally, the quality control, data management and data reporting for this effort. The three liquid waste disposal facilities at the Z Plant were chosen to be monitored because they were identified as containing some of the most significant sources of radioactive contamination in the Hanford vadose zone. Johnson's analysis was based on the relative hazard obtained by combining curie quantities disposed to the facilities with appropriate health risk standards. The basic question to be addressed by this logging activity addresses the configuration of subsurface contamination since it was last measured. Historical data from the 216-Z-1A Tile Field, the 216-Z-9 Trench, and the 216-Z-12 Crib form the baseline for comparisons to answer this question

  2. Statistical evaluation of unobserved nonuniform corrosion in A216 steel

    International Nuclear Information System (INIS)

    Pulsipher, B.A.

    1988-07-01

    Tests designed to promote nonuniform corrosion have been conducted at PNL on A216 steel. In all of the tests performed to date, there have been no manifestations of significant nonuniform corrosion. Although this may suggest that nonuniform corrosion in A216 steel may not be a significant problem in the nuclear waste repository, a question arises as to whether enough tests have been conducted for a sufficient length of time to rule out nonuniform corrosion of A216 steel. In this report, a method for determining the required number of tests is examined for two of the mechanisms of nonuniform corrosion: pitting and crevice corrosion

  3. Soil/sediment characterization for 216-A-29 ditch

    International Nuclear Information System (INIS)

    Mitchell, R.M.

    1997-01-01

    This document provides a detailed description of the environmental samples collected from the 216-A-29 Ditch in 1988. Tables summarizing the laboratory data for radionuclides, metals, and soil chemistry are included

  4. Soil/sediment characterization for 216-A-29 ditch

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, R.M.

    1997-03-01

    This document provides a detailed description of the environmental samples collected from the 216-A-29 Ditch in 1988. Tables summarizing the laboratory data for radionuclides, metals, and soil chemistry are included.

  5. 50 CFR 216.272 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ...) (iii) Pinnipeds: (A) Northern elephant seal (Mirounga angustirostris)—4795 (an average of 959 annually... of the species listed in § 216.272(c)(1)(ii)(D) through (G) over the course of the 5-year regulations. ...

  6. 216-U-10 Pond and 216-Z-19 Ditch characterization studies

    Energy Technology Data Exchange (ETDEWEB)

    Last, G.V.; Duncan, D.W.; Graham, M.J.; Hall, M.D.; Hall, V.W.; Landeen, D.S.; Leitz, J.G.; Mitchell, R.M.

    1994-02-01

    The chemical, reprocessing of spent nuclear fuels at the US Department of Energy`s Hanford Site has generated large volumes of radioactive liquid effluents. The majority of these effluents have been used strictly for cooling or other supportive functions and have been discharged to ditches and ponds. The 216-U-10 Pond and 216-Z-19 Ditch are two such disposal facilities. These facilities are components of an integrated system of ditches, ponds, and overflow facilities collectively referred to as the U-Pond disposal system. The U-Pond system has been used since 1943 and has received a large variety of radioisotopes from several sources. This study covered tho major aspects of the environment, including wind resuspension, biological uptake and transport, geologic distribution in surface and subsurface sediments, and ground-water impacts. The long-term use of U-Pond and the Z-19 Ditch has resulted in the localized accumulation of transuranic and fission product inventories as a result of sorption and filtration of particulates onto the uppermost sediments.

  7. 216-U-10 Pond and 216-Z-19 Ditch characterization studies

    International Nuclear Information System (INIS)

    Last, G.V.; Duncan, D.W.; Graham, M.J.; Hall, M.D.; Hall, V.W.; Landeen, D.S.; Leitz, J.G.; Mitchell, R.M.

    1994-02-01

    The chemical, reprocessing of spent nuclear fuels at the US Department of Energy's Hanford Site has generated large volumes of radioactive liquid effluents. The majority of these effluents have been used strictly for cooling or other supportive functions and have been discharged to ditches and ponds. The 216-U-10 Pond and 216-Z-19 Ditch are two such disposal facilities. These facilities are components of an integrated system of ditches, ponds, and overflow facilities collectively referred to as the U-Pond disposal system. The U-Pond system has been used since 1943 and has received a large variety of radioisotopes from several sources. This study covered tho major aspects of the environment, including wind resuspension, biological uptake and transport, geologic distribution in surface and subsurface sediments, and ground-water impacts. The long-term use of U-Pond and the Z-19 Ditch has resulted in the localized accumulation of transuranic and fission product inventories as a result of sorption and filtration of particulates onto the uppermost sediments

  8. Results of 1998 spectral gamma-ray monitoring of boreholes at the 216-Z-1A tile field, 216-Z-9 trench, and 216-Z-12 crib

    International Nuclear Information System (INIS)

    Horton, D.G.; Randall, R.R.

    1998-09-01

    This document describes the results of fiscal year 1998 vadose zone monitoring of three inactive liquid waste disposal facilities associated with the Plutonium Finishing Plant: the 216-Z-1A tile field, the 216-Z-9 trench, and the 216-Z-12 crib. Monitoring consisted of spectral gamma-ray logging of 21 boreholes. This work was performed by Pacific Northwest National Laboratory in conjunction with Three Rivers Scientific and Waste management Federal Services, inc. Northwest Operations. These three liquid waste disposal facilities were chosen for monitoring because they were identified as containing some of the most significant sources of radioactive contamination in the Hanford Site vadose zone. The basic question addressed by this logging activity is ''Has the configuration of subsurface contamination changed since it was last measured?'' Previous borehole logging and laboratory analyses provide the baseline data to help answer this question

  9. Swelling behavior of manganese-bearing AISI 216 steel

    International Nuclear Information System (INIS)

    Gelles, D.S.; Garner, F.A.

    1984-01-01

    The inclusion of 8.5 wt % manganese in AISI 216 does not appear to alter the swelling behavior from that found to be typical of austenitic alloys with comparable levels of other austentite-stabilizing elements. The swelling in AISI 216 in EBR-II is quite insensitive to irradiation temperature in the range 400-650 0 C. Microscopy reveals that this may arise from the low level of precipitation that occurs in the alloy

  10. Sampling and Analysis Plan for the 216-A-29 Ditch

    International Nuclear Information System (INIS)

    Petersen, S.W.

    1998-06-01

    This sampling and analysis plan defines procedures to be used for collecting and handling samples to be obtained from the 216-A-29 Ditch, and identifies requirements for field and laboratory measurements. The sampling strategy describes here is derived from a Data Quality Objectives workshop conducted in January 1997 to support sampling to assure worker safety during construction and to assess the validity of a 1988 ditch sampling campaign and the effectiveness of subsequent stabilization. The purpose of the proposed sampling and analysis activities is to characterize soil contamination in the vicinity of a proposed road over the 216-A-29 Ditch

  11. Combination RCRA groundwater monitoring plan for the 216-A-10, 216-A-36B, and 216-A-37-1 PUREX cribs

    International Nuclear Information System (INIS)

    Lindberg, J.W.

    1997-06-01

    This document presents a groundwater quality assessment monitoring plan, under Resource Conservation and Recovery Act of 1976 (RCRA) regulatory requirements for three RCRA sites in the Hanford Site's 200 East Area: 216-A-10, 216-A-36B, and 216-A-37-1 cribs (PUREX cribs). The objectives of this monitoring plan are to combine the three facilities into one groundwater quality assessment program and to assess the nature, extent, and rate of contaminant migration from these facilities. A groundwater quality assessment plan is proposed because at least one downgradient well in the existing monitoring well networks has concentrations of groundwater constituents indicating that the facilities have contributed to groundwater contamination. The proposed combined groundwater monitoring well network includes 11 existing near-field wells to monitor contamination in the aquifer in the immediate vicinity of the PUREX cribs. Because groundwater contamination from these cribs is known to have migrated as far away as the 300 Area (more than 25 km from the PUREX cribs), the plan proposes to use results of groundwater analyses from 57 additional wells monitored to meet environmental monitoring requirements of US Department of Energy Order 5400.1 to supplement the near-field data. Assessments of data collected from these wells will help with a future decision of whether additional wells are needed

  12. 9 CFR 93.216 - Poultry from Canada.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Poultry from Canada. 93.216 Section 93... EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS FOR MEANS OF...

  13. 48 CFR 3052.216-72 - Performance evaluation plan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Performance evaluation... CONTRACT CLAUSES Text of Provisions and Clauses 3052.216-72 Performance evaluation plan. As prescribed in... Evaluation Plan (DEC 2003) (a) A Performance Evaluation Plan shall be unilaterally established by the...

  14. 48 CFR 2452.216-73 - Performance evaluation plan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Performance evaluation plan... 2452.216-73 Performance evaluation plan. As prescribed in 2416.406(e)(3), insert the following clause in all award fee contracts: Performance Evaluation Plan (AUG 1987) (a) The Government shall...

  15. 48 CFR 1252.216-72 - Performance evaluation plan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance evaluation....216-72 Performance evaluation plan. As prescribed in (TAR) 48 CFR 1216.406(b), insert the following clause: Performance Evaluation Plan (OCT 1994) (a) A Performance Evaluation Plan shall be unilaterally...

  16. 50 CFR 216.165 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ...) by Detonation of Conventional Explosives in the Offshore Waters of the U.S. Atlantic Coast § 216.165... Response Program. Necropsies will be performed and tissue samples taken from any dead animals. After completion of the necropsy, animals not retained for shoreside examination will be tagged and returned to the...

  17. 10 CFR 216.3 - Requests for assistance.

    Science.gov (United States)

    2010-01-01

    ... DOMESTIC ENERGY SUPPLIES § 216.3 Requests for assistance. (a) Persons who believe that they perform work..., performance data (capacity, life duration, etc.), standards, acceptable tolerances in dimensions and.... (10) Any known conflicts with rated orders already issued pursuant to the DPA for supplies of the...

  18. 22 CFR 216.2 - Applicability of procedures.

    Science.gov (United States)

    2010-04-01

    ... § 216.2(c)(2) for which an Initial Environmental Examination, Environmental Assessment and Environmental... have an effect on the physicial and natural environment for which financing is provided by A.I.D.; (iii) Research activities which may have an affect on the physicial and natural environment but will not have a...

  19. 22 CFR 1203.735-216 - Miscellaneous statutory provisions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Miscellaneous statutory provisions. 1203.735-216..., United States Code, relating to bribery, graft, and conflicts of interest, as appropriate to the... employee acting as the agent of a foreign principal registered under the Foreign Agents Registration Act...

  20. 50 CFR 216.256 - Applications for Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.256 Applications for Letters of Authorization. To incidentally take...

  1. 50 CFR 216.257 - Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.257 Letters of Authorization. (a) A Letter of Authorization, unless suspended or revoked...

  2. 50 CFR 216.258 - Renewal of Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.258 Renewal of Letters of Authorization. (a) A Letter of Authorization...

  3. 50 CFR 216.259 - Modifications to Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.259 Modifications to Letters of Authorization. (a) Except as provided in...

  4. 50 CFR 216.252 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.252 Permissible methods of taking. (a) Under Letters of Authorization issued pursuant to...

  5. 50 CFR 216.213 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.213 Permissible...

  6. 50 CFR 216.215 - Definitions, terms, and criteria

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.215 Definitions...

  7. 50 CFR 216.218 - Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.218 Letters of...

  8. 22 CFR 216.7 - Environmental impact statements.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Environmental impact statements. 216.7 Section... Environmental impact statements. (a) Applicability. An Environmental Impact Statement shall be prepared when... Environmental Impact Statement relating to paragraph (a)(2) of this section shall comply with the CEQ...

  9. Adsorption gas chromatography with 150-ms {sup 216}Po

    Energy Technology Data Exchange (ETDEWEB)

    Vogt, A [Bern Univ. (Switzerland); Gaeggeler, H W; Tuerler, A [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-09-01

    A gas chromatography apparatus was developed, which allows experiments with volatile radionuclides having shorter half-lives than one second. This apparatus was tested with the 150-ms isotope {sup 216}Po. Experimental data were compared with a Monte Carlo model to determine the adsorption enthalpy {Delta}H{sub a}. (author) 2 figs., 2 refs.

  10. 27 CFR 555.216 - Repair of magazines.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Repair of magazines. 555... EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.216 Repair of magazines. Before repairing the interior of magazines, all explosive materials are to be removed and the interior...

  11. Nuclear structure of 216 Ra at high spin

    Indian Academy of Sciences (India)

    Bi(10B, 3n) reaction at an incident beam energy of 55 MeV and 209Bi(11B, 4n) reaction at incident beam energies ranging from 65 to 78 MeV. Based on coincidence data, the level scheme for 216Ra has been considerably extended up to ...

  12. 48 CFR 3452.216-70 - Additional cost principles.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Additional cost principles... Clauses 3452.216-70 Additional cost principles. Insert the following clause in solicitations and contracts as prescribed in 3416.307(b): Additional Cost Principles (AUG 1987) (a) Bid and Proposal Costs. Bid...

  13. 50 CFR 216.171 - Effective dates and definitions.

    Science.gov (United States)

    2010-10-01

    ... concern listed in next bullet) found dead or live on shore within a two day period and occurring on same... distress. (2) Shutdown (this definition specifically applies only to the word as used in § 216.174(a)(1... live, in the water animal involved in a USE. ...

  14. 13 CFR 134.216 - Alternative dispute resolution procedures.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Alternative dispute resolution....216 Alternative dispute resolution procedures. At any time during the pendency of a case, the parties may submit a joint motion requesting that the Judge permit the use of alternative dispute resolution...

  15. 75 FR 80885 - Fifteenth Meeting: EUROCAE WG-72: RTCA Special Committee 216: Aeronautical Systems Security...

    Science.gov (United States)

    2010-12-23

    ..., Boeing Commercial Airplane Group. FOR FURTHER INFORMATION CONTACT: RTCA Secretariat, 1828 L Street, NW..., 2010 (RTCA Paper No. 250-10/SC216-031). Report on the PMC/ICC action on SC 216 TOR. Publication...

  16. 50 CFR 216.107 - Incidental harassment authorization for Arctic waters.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Incidental harassment authorization for Arctic waters. 216.107 Section 216.107 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL... Incidental to Specified Activities § 216.107 Incidental harassment authorization for Arctic waters. (a...

  17. 25 CFR 216.4 - Technical examination of prospective surface exploration and mining operations.

    Science.gov (United States)

    2010-04-01

    ... mining sites and mining operations vary widely with respect to topography, climate, surrounding land uses... and mining operations. 216.4 Section 216.4 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS SURFACE EXPLORATION, MINING, AND RECLAMATION OF LANDS General Provisions § 216...

  18. 48 CFR 52.216-16 - Incentive Price Revision-Firm Target.

    Science.gov (United States)

    2010-10-01

    ...-Firm Target. 52.216-16 Section 52.216-16 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.216-16 Incentive Price Revision—Firm Target. As prescribed in 16.406(a), insert the following clause: Incentive Price Revision—Firm Target (OCT 1997) (a) General. The supplies or services identified...

  19. 50 CFR 216.41 - Permits for scientific research and enhancement.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Permits for scientific research and... AND IMPORTING OF MARINE MAMMALS Special Exceptions § 216.41 Permits for scientific research and enhancement. In addition to the requirements under §§ 216.33 through 216.38, permits for scientific research...

  20. 38 CFR 3.216 - Mandatory disclosure of social security numbers.

    Science.gov (United States)

    2010-07-01

    ... social security numbers. 3.216 Section 3.216 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF... Requirements § 3.216 Mandatory disclosure of social security numbers. Any person who applies for or receives..., furnish the Department of Veterans Affairs upon request with his or her social security number and the...

  1. 48 CFR 216.203 - Fixed-price contracts with economic price adjustment.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Fixed-price contracts with economic price adjustment. 216.203 Section 216.203 Federal Acquisition Regulations System DEFENSE... CONTRACTS Fixed-Price Contracts 216.203 Fixed-price contracts with economic price adjustment. ...

  2. 29 CFR 1952.216 - Where the plan may be inspected.

    Science.gov (United States)

    2010-07-01

    ... and copied during normal business hours at the following locations: Office of State Programs... 29 Labor 9 2010-07-01 2010-07-01 false Where the plan may be inspected. 1952.216 Section 1952.216..., DEPARTMENT OF LABOR (CONTINUED) APPROVED STATE PLANS FOR ENFORCEMENT OF STATE STANDARDS Maryland § 1952.216...

  3. Laparoscopic cholecystectomy for acute cholecystitis: clinical analysis of 216 cases

    Directory of Open Access Journals (Sweden)

    DAI Juntao

    2014-07-01

    Full Text Available ObjectiveTo investigate the clinical experience of laparoscopic cholecystectomy (LC for acute cholecystitis. MethodsA retrospective analysis was performed on the clinical records of 216 patients with acute cholecystitis who underwent LC in Qingpu Branch of Zhongshan Hospital, Fudan University from January 2010 to January 2013. LC was performed under intubation general anaesthesia, with three holes conventionally and four holes if necessary. After operation, the drainage tube was placed for 1-3 d, and antibiotics were administered for 3-5 d. The time of operation, length of postoperative hospital stay, and incidence of postoperative complications were determined. All patients were followed up for at least 0.5 year after operation. ResultsLC was successfully performed in 188 (87.0% of all patients; 28 (13.0% of all patients were converted to open surgery. The mean time of operation was 62.00±11.27 min; the mean length of hospital stay was 4.60±2.16 d; the incidence of postoperative complications was 2.3%(5/216. All patients were cured and discharged. During follow-up, no patients developed other complications and all recovered well. ConclusionLC is safe and feasible in the treatment of acute cholecystitis. Correct manipulation of the Calot's triangle and proper abdominal drainage are the key to successful operation.

  4. Variable stars in the Pegasus dwarf galaxy (DDO 216)

    Energy Technology Data Exchange (ETDEWEB)

    Hoessel, J.G.; Abbott, M.J.; Saha, A.; Mossman, A.E.; Danielson, G.E. (Washburn Observatory, Madison, WI (USA) Space Telescope Science Institute, Baltimore, MD (USA) Palomar Observatory, Pasadena, CA (USA))

    1990-10-01

    Observations obtained over a period of five years of the resolved stars in the Pegasus dwarf irregular galaxy (DDO 216) have been searched for variable stars. Thirty-one variables were found, and periods established for 12. Two of these variable stars are clearly eclipsing variables, seven are very likely Cepheid variables, and the remaining three are probable Cepheids. The period-luminosity relation for the Cepheids indicates a distance modulus for Pegasus of m - M = 26.22 + or - 0.20. This places Pegasus very near the zero-velocity surface of the Local Group. 25 refs.

  5. Addiction-Related Effects of DOV 216,303 and Cocaine

    DEFF Research Database (Denmark)

    Sørensen, Gunnar; Husum, Henriette; Brennum, Lise T

    2014-01-01

    DOV 216,303, an inhibitor of serotonin, noradrenaline and dopamine reuptake, belongs to a new line of drugs called 'triple reuptake inhibitors' that have been proposed for treatment of depression. The addictive drug cocaine has similar mechanism of action and exerts rewarding effects by blocking...... of DOV 216,303, we conducted a comparative study of addiction-related effects of DOV 216,303 and cocaine in mice using acute self-administration, conditioned place preference (CPP) and drug-induced hyperlocomotion. Effects on accumbal extracellular dopamine levels were determined using microdialysis......, and we measured monoamine receptor occupancy as well as brain and plasma exposure. DOV 216,303 was self-administered acutely in the same dose range as cocaine. However, in the CPP model, DOV 216,303 did not induce place preference at doses where cocaine caused place preference. Higher doses of DOV 216...

  6. 23 CFR 450.216 - Development and content of the statewide transportation improvement program (STIP).

    Science.gov (United States)

    2010-04-01

    ... Programming § 450.216 Development and content of the statewide transportation improvement program (STIP). (a... Equity Bonus funds; (5) Emergency relief projects (except those involving substantial functional...

  7. Groundwater impact assessment report for the 216-U-14 Ditch

    Energy Technology Data Exchange (ETDEWEB)

    Singleton, K.M.; Lindsey, K.A.

    1994-01-01

    Groundwater impact assessments are conducted at liquid effluent receiving sites on the Hanford Site to determine hydrologic and contaminant impacts caused by discharging wastewater to the soil column. The assessments conducted are pursuant to the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-17-00A and M-17-00B, as agreed by the US Department of Energy (DOE), Washington State Department of Ecology (Ecology), and the US Environmental Protection Agency (EPA) (Ecology et al. 1992). This report assesses impacts on the groundwater and vadose zone from wastewater discharged to the 216-U-14 Ditch. Contemporary effluent waste streams of interest are 242-S Evaporator Steam Condensate and UO{sub 3}/U Plant wastewater.

  8. Prognostic analysis of 216 cases with penetrating ocular injury

    Directory of Open Access Journals (Sweden)

    Yong Guo

    2013-08-01

    Full Text Available AIM: To analyze the factors of penetrating ocular injury, and to investigate the prognostic factors and treatment strategies. METHODS: A retrospective analysis of 216 ocular trauma patients(221 eyes, in our hospital from November 2009 to November 2011, was completed. RESULTS: The eyeball atrophy inevitably occurred in 13 eye wounds more than 30mm. Retinal prolapse of the eyes, 78%(35/45completed vitrectomy, 33%(15/45were eyeball atrophy. The 51%(20/39of subchoroidal hemorrhage eyes were eyeball atrophy. Retinal prolapse and subchoroidal hemorrhage increased the risk of ocular atrophy(PPCONCLUSION: Serious ocular trauma prognosis related to many factors. The retina prolapse and the subchoroidal hemorrhage were important prognosis testify. A scleral buckling condensation surgery and vitrectomy have a therapeutic effect, and can improve visual function.

  9. Removal of Uranium in Drinking Water: Brimac Environmental Services, Inc. Brimac HA 216 Adsorptive Media

    Science.gov (United States)

    The Brimac HA 216 Adsorptive Media was tested for uranium (U) removal from a drinking water source (well water) at Grappone Toyota located in Bow, New Hampshire. The HA 216 media is a hydroxyapatite-based material. A pilot unit, consisting of a TIGG Corporation Cansorb® C-5 ste...

  10. Groundwater Monitoring Plan for the 216-S-10 Pond and Ditch, Interim Change Notice 1

    International Nuclear Information System (INIS)

    Williams, Bruce A.

    2003-01-01

    During 2003, the upgradient well 299-W26-7 went dry and one new groundwater monitoring well was installed downgradient (well 299-W26-14) of the 216-S-10 pond and ditch. This ICN updates the groundwater monitoring wells for the 216-S-10 pond and ditch and adds a revised well location map to the plan

  11. 27 CFR 40.216b - Notice for roll-your-own tobacco.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Notice for roll-your-own tobacco. 40.216b Section 40.216b Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS...

  12. 48 CFR 216.405-1 - Cost-plus-incentive-fee contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-incentive-fee... Contracts 216.405-1 Cost-plus-incentive-fee contracts. See PGI 216.405-1 for guidance on the use of cost-plus-incentive-fee contracts. [71 FR 39007, July 11, 2006] ...

  13. 12 CFR 216.16 - Protection of Fair Credit Reporting Act.

    Science.gov (United States)

    2010-01-01

    ... PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Relation to Other Laws; Effective Date § 216.16 Protection of Fair Credit Reporting Act. Nothing in this part shall be construed to modify, limit, or... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Protection of Fair Credit Reporting Act. 216.16...

  14. 24 CFR 5.216 - Disclosure and verification of Social Security and Employer Identification Numbers.

    Science.gov (United States)

    2010-04-01

    ... Social Security and Employer Identification Numbers. 5.216 Section 5.216 Housing and Urban Development...; WAIVERS Disclosure and Verification of Social Security Numbers and Employer Identification Numbers; Procedures for Obtaining Income Information Disclosure and Verification of Social Security Numbers and...

  15. 77 FR 2343 - Eighteenth Meeting: RTCA Special Committee 216: Aeronautical Systems Security (Joint Meeting With...

    Science.gov (United States)

    2012-01-17

    ... advise the public of the eighteenth meeting of RTCA Special Committee 216: Aeronautical Systems Security... Agenda Overview and Approval Split Plenary Session (9:15 a.m.--12 p.m.) SC 216 Review of the Summary of....--12 p.m.) WG-72 Introduction, Report about publications and relations EUROCAE Document Discussions, e...

  16. 20 CFR 216.67 - “Child in care.”

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false âChild in care.â 216.67 Section 216.67 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT ELIGIBILITY FOR... used to establish eligibility for the tier II component of a female spouse or widow(er) annuity under...

  17. 22 CFR 216.9 - Bilateral and multilateral studies and concise reviews of environmental issues.

    Science.gov (United States)

    2010-04-01

    ... reviews of environmental issues. 216.9 Section 216.9 Foreign Relations AGENCY FOR INTERNATIONAL... environmental issues. Notwithstanding anything to the contrary in these procedures, the Administrator may... United States is a member or participant; or (b) Concise reviews of the environmental issues involved...

  18. 20 CFR 216.16 - What is regular non-railroad employment.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false What is regular non-railroad employment. 216.16 Section 216.16 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD... the United States Government: (i) Department of Transportation; (ii) Interstate Commerce Commission...

  19. 12 CFR 216.13 - Exception to opt out requirements for service providers and joint marketing.

    Science.gov (United States)

    2010-01-01

    ... this section may include marketing of your own products or services or marketing of financial products... providers and joint marketing. 216.13 Section 216.13 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Exceptions...

  20. 42 CFR 57.216 - What additional Department regulations apply to schools?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false What additional Department regulations apply to schools? 57.216 Section 57.216 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN... schools? (a) Participating schools are advised that in addition to complying with the terms and conditions...

  1. 50 CFR 216.191 - Designation of Offshore Biologically Important Marine Mammal Areas.

    Science.gov (United States)

    2010-10-01

    ...) Detailed information on the biology of marine mammals within the area, including estimated population size... Important Marine Mammal Areas. 216.191 Section 216.191 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS...

  2. 48 CFR 52.216-26 - Payments of Allowable Costs Before Definitization.

    Science.gov (United States)

    2010-10-01

    ... and placed in the production process for use on the contract; (iii) Direct labor; (iv) Direct travel; (v) Other direct in-house costs; and (vi) Properly allocable and allowable indirect costs as shown on... Costs Before Definitization. 52.216-26 Section 52.216-26 Federal Acquisition Regulations System FEDERAL...

  3. 19 CFR 146.52 - Manipulation, manufacture, exhibition or destruction; Customs Form 216.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Manipulation, manufacture, exhibition or... Merchandise in a Zone § 146.52 Manipulation, manufacture, exhibition or destruction; Customs Form 216. (a... application) on Customs Form 216 for permission to manipulate, manufacture, exhibit, or destroy merchandise in...

  4. Radiopotentiation by the oral platinum agent, JM216: role of repair inhibition

    International Nuclear Information System (INIS)

    Amorino, George P.; Freeman, Michael L.; Carbone, David P.; Lebwohl, David E.; Choy, Hak

    1999-01-01

    Purpose: To test for in vitro radiopotentiation by the orally-administered platinum (IV) complex, JM216; to compare these results to cisplatin and carboplatin; and to investigate whether the mechanism of radiopotentiation involves repair inhibition of radiation-induced DNA damage. Methods and Materials: H460 human lung carcinoma cells were incubated with the drugs for 1 h at 37 deg. C, irradiated at room temperature, and returned to 37 deg. C for 20 min. Cells were then rinsed and colony forming ability was assessed. Wild-type V79 Chinese hamster cells and radiosensitive, DNA repair-deficient mutant cells (XR-V15B) were also studied along with H460 cells. Ku86 cDNA, which encodes part of a protein involved in DNA repair, was transfected into XR-V15B cells as previously described. The effect of JM216 on sublethal damage repair (SLDR) was also assessed using split-dose recovery. Results: Using equally cytotoxic doses of JM216, cisplatin, and carboplatin, the radiation dose enhancement ratios (DER) were 1.39, 1.31, and 1.20, respectively; the DER with 20 μM JM216 was 1.57. JM216 (20 μM) did not significantly change the final slope of radiation survival curves, but greatly reduced the survival curve shoulder. V79 cells also showed radioenhancement using 20 μM JM216, but no enhancement occurred using XR-V15B cells. Transfection of Ku86 cDNA into XR-V15B cells restored radiopotentiation by JM216 to wild-type V79 levels. In addition, 20 μM JM216 completely inhibited sublethal damage repair in H460 cells. Conclusion: Our results show that JM216 can potentiate the effects of radiation in human lung cancer cells, and that the mechanism of this effect is probably inhibition of DNA repair by JM216

  5. State Environmental Policy Act (SEPA) Environmental Checklist Form 216-B-3 Expansion Ponds Closure Plan

    International Nuclear Information System (INIS)

    1993-12-01

    The 216-B-3 Expansion Ponds Closure Plan (Revision 1) consists of a Part A Dangerous Waste Permit Application and a Resource Conservation and Recovery Act Closure Plan. An explanation of the Part A submitted with this document is provided at the beginning of the Part A Section. The closure plan consists of nine chapters and five appendices. The 216-B-3 Pond System consists of a series of four earthen, unlined, interconnected ponds and the 216-B-3-3 Ditch that receive waste water from various 200 East Area operating facilities. These four ponds, collectively. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the 216-B-3-3 Ditch. Water discharged to the 216-8-3-3 Ditch flows directly into the 216-B-3 Pond. In the past, waste water discharges to B Pond and the 216-B-3-3 Ditch contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the nonradioactive dangerous portion of mixed waste is regulated under RCRA. Mixed waste also may be considered a hazardous substance under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) when considering remediation of waste sites

  6. Disappearance of a low molecular weight heparin fraction (CY 216) differs from standard heparin in rabbits

    International Nuclear Information System (INIS)

    Boneu, B.; Buchanan, M.R.; Caranobe, C.; Gabaig, A.M.; Dupouy, D.; Sie, P.; Hirsh, J.

    1987-01-01

    In previous studies, we have reported that standard heparin (SH) was cleared by two mechanisms, a saturable mechanism which predominated at low doses (less than 100 anti-factor Xa U/kg) and a non-saturable mechanism which predominated at higher doses, when the first mechanism became saturated. In this study, we examined the importance of these two mechanisms in the disappearance of a low molecular weight heparin fraction (LMWH) (CY 216), by comparing the pharmacokinetics and the pharmacodynamics of a wide range of doses of SH and CY 216 (1.5 to 500 anti-factor Xa U/kg). Pharmacokinetics was measured as the disappearance of 125 I-radiolabelled SH or CY 216. Pharmacodynamics was measured as the disappearance of the anti-factor Xa activity of SH and CY 216. We found that the saturable mechanism contributed little to the disappearance of CY 216 and that it was cleared predominantly by the non-saturable mechanism at all doses tested. Thus, at low doses (less than 100 anti-factor Xa U/kg), SH was cleared more rapidly than CY 216, whereas at higher doses, CY 216 was cleared more rapidly than SH. We conclude that the mechanism of disappearance of LMWH's differ significantly from those of SH, and that this difference may explain the apparent prolonged anticoagulant activity of LMWH's within the therapeutic range doses

  7. 48 CFR 252.216-7000 - Economic price adjustment-basic steel, aluminum, brass, bronze, or copper mill products.

    Science.gov (United States)

    2010-10-01

    ...-basic steel, aluminum, brass, bronze, or copper mill products. 252.216-7000 Section 252.216-7000 Federal... adjustment—basic steel, aluminum, brass, bronze, or copper mill products. As prescribed in 216.203-4-70(a... Mill Products (JUL 1997) (a) Definitions. As used in this clause— Established price means a price which...

  8. Results of the groundwater quality assessment program at the 216-A-29 ditch RCRA facility

    International Nuclear Information System (INIS)

    Votava, J.M.

    1995-01-01

    This report presents the findings of the groundwater quality assessment program for the 216-A-29 Ditch. The information presented in this report Ditch have affected the quality of the groundwater in the unconfined aquifer beneath the facility. The results indicate that the 216-A-29 Ditch is the source of elevated specific conductance in well 299-E25-35 and that the source is nonhazardous. This report describes the current monitoring status of the 216-A-29 Ditch, groundwater chemical data interpretation, and recommends the reinstatement of an indicator-evaluation monitoring program in accordance with 40 CFR 265.93(d)(6)

  9. Yeast Interacting Proteins Database: YNL216W, YLR453C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YNL216W RAP1 DNA-binding protein involved in either activation or repression of transcription, depending...NA-binding protein involved in either activation or repression of transcription, depending on binding site c

  10. Crystal structure and functional characterization of SF216 from Shigella flexneri.

    Science.gov (United States)

    Kim, Ha-Neul; Seok, Seung-Hyeon; Lee, Yoo-Sup; Won, Hyung-Sik; Seo, Min-Duk

    2017-11-01

    Shigella flexneri is a Gram-negative anaerobic bacterium that causes highly infectious bacterial dysentery in humans. Here, we solved the crystal structure of SF216, a hypothetical protein from the S. flexneri 5a strain M90T, at 1.7 Å resolution. The crystal structure of SF216 represents a homotrimer stabilized by intersubunit interactions and ion-mediated electrostatic interactions. Each subunit consists of three β-strands and five α-helices with the β-β-β-α-α-α-α-α topology. Based on the structural information, we also demonstrate that SF216 shows weak ribonuclease activity by a fluorescence quenching assay. Furthermore, we identify potential druggable pockets (putative hot spots) on the surface of the SF216 structure by computational mapping. © 2017 Federation of European Biochemical Societies.

  11. Addiction-Related Effects of DOV 216,303 and Cocaine

    DEFF Research Database (Denmark)

    Sørensen, Gunnar; Husum, Henriette; Brennum, Lise T

    2014-01-01

    DOV 216,303, an inhibitor of serotonin, noradrenaline and dopamine reuptake, belongs to a new line of drugs called 'triple reuptake inhibitors' that have been proposed for treatment of depression. The addictive drug cocaine has similar mechanism of action and exerts rewarding effects by blocking...... reuptake of dopamine, leading to increased extracellular concentrations of dopamine in the nucleus accumbens. Thus, DOV 216,303 and other triple reuptake inhibitors might be speculated to exhibit abuse potential, limiting their future therapeutic use. To further elucidate potential addictive properties...... of DOV 216,303, we conducted a comparative study of addiction-related effects of DOV 216,303 and cocaine in mice using acute self-administration, conditioned place preference (CPP) and drug-induced hyperlocomotion. Effects on accumbal extracellular dopamine levels were determined using microdialysis...

  12. Reconnection of SN-216 to U-D Valve Pit Design Review

    International Nuclear Information System (INIS)

    REED, R.W.

    1999-01-01

    The design for the reconnection of SN-216 to U-D valve pit was reviewed on May 24, 1999. All Review Comment Record comments were resolved and closed at this meeting. The review concluded that the reconnection of SN-216 to U-D valve pit was acceptable. The design was approved with the incorporated comments as recorded on the RCR's. No outstanding comments remain

  13. Diagnostic outcome of contrast videofluoroscopic swallowing studies in 216 dysphagic dogs.

    Science.gov (United States)

    Pollard, Rachel E; Marks, Stanley L; Cheney, Diane M; Bonadio, Cecily M

    2017-07-01

    Determining the anatomic and functional origin for dysphagia is critical for development of an appropriate therapeutic plan and determination of the prognosis. The purpose of this retrospective study was to report the quantitative and qualitative outcome of contrast videofluoroscopic swallowing studies in a large cohort of dysphagic dogs presenting to a tertiary veterinary care hospital. The videofluoroscopic swallowing studies were reviewed to generate values for pharyngeal constriction ratio, timing of swallowing events (maximum pharyngeal contraction, opening of upper esophageal sphincter, closing of upper esophageal sphincter, and reopening of epiglottis), type of esophageal peristalsis generated, and esophageal transit time. One or more anatomic locations for origin of dysphagia were assigned (pharyngeal, cricopharyngeal, esophageal (primary motility disorder), other esophageal (stricture, vascular ring anomaly, mass), lower esophageal sphincter/hiatus. Sixty-one of 216 studies (28%) were deemed unremarkable. Twenty-seven of 216 dogs (13%) had pharyngeal dysphagia, 17/216 dogs (8%) had cricopharyngeal dysphagia, 98/216 dogs (45%) had dysphagia secondary to esophageal dysmotility, 19/216 dogs (9%) had dysphagia secondary to focal esophageal disorders, and 97/216 dogs (45%) had dysphagia of lower esophageal sphincter/hiatus origin. Multiple abnormalities were present in 82/216 (38%) dogs. Elevated pharyngeal constriction ratio was associated with pharyngeal, cricopharyngeal, and esophageal motility disorders, delayed upper esophageal sphincter opening was associated with cricopharyngeal disorders, a lower percentage of primary esophageal peristaltic waves was associated with cricopharyngeal, pharyngeal, or primary esophageal motility disorders. In conclusion, videofluoroscopic swallowing studies was pivotal in the diagnosis of dysphagia with 155/216 (72%) dogs receiving a final diagnosis. © 2017 American College of Veterinary Radiology.

  14. miR-216b suppresses breast cancer growth and metastasis by targeting SDCBP

    International Nuclear Information System (INIS)

    Jana, Samir; Sengupta, Suman; Biswas, Subir; Chatterjee, Annesha; Roy, Himansu; Bhattacharyya, Arindam

    2017-01-01

    Breast cancer is the most deadly cancer among women and the second leading cause of cancer death worldwide. Treatment effectiveness is complicated with tumor invasiveness/drug resistance. To tailor treatments more effectively to individual patients, it is important to define tumor growth and metastasis at molecular levels. SDCBP is highly overexpressed and associated with a strikingly poor prognosis in breast cancer. However the post transcriptional regulation of SDCBP overexpression remains to be an unexplored area. Our study reveals that miR-216b directly regulates SDCBP expression by binding to its 3′UTR region. miR-216b is a tumor suppressive miRNA and it is underexpressed during metastatic breast cancer. Consequently, overexpression of miR-216b resulted in decreased proliferation, migration and invasion in BC cell lines by modulating the expression of SDCBP. Inhibition of miR-216b divergent the tumor suppressive role by inducing the growth proliferation, migration and invasion in vitro. There is therefore a negative correlation between the expression of miR-216b and its target gene SDCBP in the BC tissue samples as well as cell lines. Simultaneous expression of miR-216b and SDCBP rescued the growth, migration and invasion effect suggesting that tumor suppressive action of miR-216b may be directly mediated by SDCBP. In summary, the study identifies miR-216b as a regulator of SDCBP expression in breast cancer which can potentially be targeted for developing newer therapies for the effective treatment of this killer disease.

  15. Reagents for Astatination of Biomolecules. 5. Evaluation of hydrazone linkers in 211At- and 125I-labeled closo-decaborate(2-) conjugates of Fab′ as a means of decreasing kidney retention

    Science.gov (United States)

    Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.

    2011-01-01

    Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate

  16. Guillem Fabre, “Pus dels majors” (BdT 216.2; Id., “Hon mais vey, pus truep sordeyor” (BdT 216.1

    Directory of Open Access Journals (Sweden)

    Linda Paterson

    2013-03-01

    Full Text Available The historical circumstances of Guillem Fabre’s two surviving sirventes has given rise to widely divergent views. This essay builds on Parducci’s contextualisation of BdT 216.2 during the War of the Sicilian Vespers and the so-called Aragonese crusade by the French against Pere III of Aragon in 1284-1285. It argues that Guillem is likely to be referring to events say entre nos because Narbonne was the focal point of the gathering French army and preaching of the crusade. All other textual details are compatible with this period and best explained by this context. But while Parducci places the sirventes in May 1285, it must in fact have preceded the death of Martin IV on 29 March, since his speedily-appointed successor Honorius IV could not be blamed for not having preached a crusade against the heathen before the conflict degenerated into further atrocities. Furthermore a slightly earlier timing better explains the allusion to “the best-known man in the world”, the obvious candidate at this time being Charles of Anjou. Guillem probably composed BdT 216.2 during the build-up to war in 1284, before the death of Charles in January 1285, during the period of war preparations and propaganda speeches. It is also argued here that, pace Parducci, BdT 216.1 did not necessarily precede BdT 216.2.

  17. Interim-status groundwater monitoring plan for the 216-B-63 trench. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Sweeney, M.D.

    1995-06-13

    This document outlines the groundwater monitoring plan for interim-status detection-level monitoring of the 216-B-63 Trench. This is a revision of the initial groundwater monitoring plan prepared for Westinghouse Hanford Company (WHC) by Bjornstad and Dudziak (1989). The 216-B-63 Trench, located at the Hanford Site in south-central Washington State, is an open, unlined, earthern trench approximately 1.2 m (4 ft) wide at the bottom, 427 m (1400 ft) long, and 3 m (10 ft) deep that received wastewater containing hazardous waste and radioactive materials from B Plant, located in the 200 East Area. Liquid effluent discharge to the 216-B-63 Trench began in March 1970 and ceased in February 1992. The trench is now managed by Waste Tank Operations.

  18. Interim-status groundwater monitoring plan for the 216-B-63 trench. Revision 1

    International Nuclear Information System (INIS)

    Sweeney, M.D.

    1995-01-01

    This document outlines the groundwater monitoring plan for interim-status detection-level monitoring of the 216-B-63 Trench. This is a revision of the initial groundwater monitoring plan prepared for Westinghouse Hanford Company (WHC) by Bjornstad and Dudziak (1989). The 216-B-63 Trench, located at the Hanford Site in south-central Washington State, is an open, unlined, earthern trench approximately 1.2 m (4 ft) wide at the bottom, 427 m (1400 ft) long, and 3 m (10 ft) deep that received wastewater containing hazardous waste and radioactive materials from B Plant, located in the 200 East Area. Liquid effluent discharge to the 216-B-63 Trench began in March 1970 and ceased in February 1992. The trench is now managed by Waste Tank Operations

  19. Groundwater impact assessment report for the 216-S-26 Crib, 200 West Area

    Energy Technology Data Exchange (ETDEWEB)

    Lindberg, J.W.; Evelo, S.D.; Alexander, D.J.

    1993-11-01

    This report assesses the impact of wastewater discharged to the 216-S-26 Crib on groundwater quality. The 216-S-26 Crib, located in the southern 200 West Area, has been in use since 1984 to dispose of liquid effluents from the 222-S Laboratory Complex. The 222-S Laboratory Complex effluent stream includes wastewater from four sources: the 222-S Laboratory, the 219-S Waste Storage Facility, the 222-SA Chemical Standards Laboratory, and the 291-S Exhaust Fan Control House and Stack. Based on assessment of groundwater chemistry and flow data, contaminant transport predictions, and groundwater chemistry data, the 216-S-26 Crib has minimal influence on groundwater contamination in the southern 200 West Area.

  20. Groundwater impact assessment report for the 216-S-26 Crib, 200 West Area

    International Nuclear Information System (INIS)

    Lindberg, J.W.; Evelo, S.D.; Alexander, D.J.

    1993-11-01

    This report assesses the impact of wastewater discharged to the 216-S-26 Crib on groundwater quality. The 216-S-26 Crib, located in the southern 200 West Area, has been in use since 1984 to dispose of liquid effluents from the 222-S Laboratory Complex. The 222-S Laboratory Complex effluent stream includes wastewater from four sources: the 222-S Laboratory, the 219-S Waste Storage Facility, the 222-SA Chemical Standards Laboratory, and the 291-S Exhaust Fan Control House and Stack. Based on assessment of groundwater chemistry and flow data, contaminant transport predictions, and groundwater chemistry data, the 216-S-26 Crib has minimal influence on groundwater contamination in the southern 200 West Area

  1. 50 CFR 216.46 - U.S. citizens on foreign flag vessels operating under the International Dolphin Conservation...

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false U.S. citizens on foreign flag vessels operating under the International Dolphin Conservation Program. 216.46 Section 216.46 Wildlife and Fisheries....46 U.S. citizens on foreign flag vessels operating under the International Dolphin Conservation...

  2. 50 CFR 216.27 - Release, non-releasability, and disposition under special exception permits for rehabilitated...

    Science.gov (United States)

    2010-10-01

    ... rehabilitated marine mammal for any activity authorized under subpart D in lieu of animals taken from the wild... disposition under special exception permits for rehabilitated marine mammals. 216.27 Section 216.27 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION...

  3. 41 CFR 302-3.216 - When must I begin my first tour renewal travel from Alaska or Hawaii?

    Science.gov (United States)

    2010-07-01

    ... first tour renewal travel from Alaska or Hawaii? 302-3.216 Section 302-3.216 Public Contracts and... must I begin my first tour renewal travel from Alaska or Hawaii? You must begin your first tour renewal travel within 5 years of your first consecutive tours in either Alaska or Hawaii. ...

  4. 47 CFR 15.242 - Operation in the bands 174-216 MHz and 470-668 MHz.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Operation in the bands 174-216 MHz and 470-668... bands 174-216 MHz and 470-668 MHz. (a) The marketing and operation of intentional radiators under the... services, facilities, and beds for use beyond 24 hours in rendering medical treatment and institutions and...

  5. 50 CFR 216.16 - Prohibitions under the General Authorization for Level B harassment for scientific research.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Prohibitions under the General Authorization for Level B harassment for scientific research. 216.16 Section 216.16 Wildlife and Fisheries... Prohibitions under the General Authorization for Level B harassment for scientific research. It shall be...

  6. 47 CFR 25.216 - Limits on emissions from mobile earth stations for protection of aeronautical radionavigation...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Limits on emissions from mobile earth stations for protection of aeronautical radionavigation-satellite service. 25.216 Section 25.216 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS...

  7. 12 CFR 216.11 - Limits on redisclosure and reuse of information.

    Science.gov (United States)

    2010-01-01

    ... RESERVE SYSTEM PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Limits on Disclosures § 216.11... disclose that information to a third party for marketing purposes or use that information for your own marketing purposes. (b)(1) Information you receive outside of an exception. If you receive nonpublic...

  8. 50 CFR 216.95 - Official mark for “Dolphin-safe” tuna products.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Official mark for âDolphin-safeâ tuna... AND IMPORTING OF MARINE MAMMALS Dolphin Safe Tuna Labeling § 216.95 Official mark for “Dolphin-safe... Department of Commerce that may be used to label tuna products that meet the “dolphin-safe” standards set...

  9. Interim-status groundwater monitoring plan for the 216-B-63 trench

    Energy Technology Data Exchange (ETDEWEB)

    Sweeney, M.D.

    1995-02-09

    This document outlines the groundwater monitoring plan, under RCRA regulations in 40 CFR 265 Subpart F and WAC173-300-400, for the 216-B-63 Trench. This interim status facility is being sampled under detection monitoring criteria and this plan provides current program conditions and requirements.

  10. 18 CFR 367.2161 - Account 216.1, Unappropriated undistributed subsidiary earnings.

    Science.gov (United States)

    2010-04-01

    ..., either debit or credit, of undistributed retained earnings of subsidiary companies since their... account, this account must be debited and account 216, Unappropriated retained earnings (§ 367.2160..., Unappropriated undistributed subsidiary earnings. 367.2161 Section 367.2161 Conservation of Power and Water...

  11. 20 CFR 216.3 - Other regulations related to this part.

    Science.gov (United States)

    2010-04-01

    ... eligibility. Where eligibility for an annuity is based upon a family relationship to an employee (for example, a widow's annuity), the definition of such family relationship may be found in part 222 of this... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Other regulations related to this part. 216.3...

  12. 12 CFR 216.15 - Other exceptions to notice and opt out requirements.

    Science.gov (United States)

    2010-01-01

    ... insurance to the consumer. (2) A consumer may revoke consent by subsequently exercising the right to opt out... RESERVE SYSTEM PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Exceptions § 216.15 Other... consent or at the direction of the consumer, provided that the consumer has not revoked the consent or...

  13. 48 CFR 1852.216-74 - Estimated cost and fixed fee.

    Science.gov (United States)

    2010-10-01

    ... and Clauses 1852.216-74 Estimated cost and fixed fee. As prescribed in 1816.307-70(b), insert the following clause: Estimated Cost and Fixed Fee (DEC 1991) The estimated cost of this contract is ______ exclusive of the fixed fee of ______. The total estimated cost and fixed fee is ______. (End of clause) [62...

  14. 48 CFR 2452.216-70 - Estimated cost, base fee and award fee.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Estimated cost, base fee... Provisions and Clauses 2452.216-70 Estimated cost, base fee and award fee. As prescribed in 2416.406(e)(1), insert the following clause in all cost-plus-award-fee contracts: Estimated Cost, Base Fee and Award Fee...

  15. 48 CFR 1852.216-84 - Estimated cost and incentive fee.

    Science.gov (United States)

    2010-10-01

    ... Provisions and Clauses 1852.216-84 Estimated cost and incentive fee. As prescribed in 1816.406-70(d), insert the following clause: Estimated Cost and Incentive Fee (OCT 1996) The target cost of this contract is $___. The target fee of this contract is $___. The total target cost and target fee as contemplated by the...

  16. 48 CFR 52.216-12 - Cost-Sharing Contract-No Fee.

    Science.gov (United States)

    2010-10-01

    ....216-12 Cost-Sharing Contract—No Fee. As prescribed in 16.307(f), insert the following clause in... nonprofit organization. Cost-Sharing Contract—No Fee (APR 1984) (a) The Government shall not pay to the... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cost-Sharing Contract-No...

  17. 48 CFR 216.306 - Cost-plus-fixed-fee contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-fixed-fee... SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Cost-Reimbursement Contracts 216.306 Cost-plus-fixed-fee contracts. (c) Limitations. (i) Except as provided in...

  18. 48 CFR 52.216-11 - Cost Contract-No Fee.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cost Contract-No Fee. 52....216-11 Cost Contract—No Fee. As prescribed in 16.307(e), insert the following clause in solicitations and contracts when a cost-reimbursement contract is contemplated that provides no fee and is not a...

  19. 48 CFR 216.405-2 - Cost-plus-award-fee contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Cost-plus-award-fee... Contracts 216.405-2 Cost-plus-award-fee contracts. (b) Application. The cost-plus-award-fee (CPAF) contract... avoid— (1) Establishing cost-plus-fixed-fee contracts when the criteria for cost-plus-fixed-fee...

  20. 48 CFR 1852.216-85 - Estimated cost and award fee.

    Science.gov (United States)

    2010-10-01

    ... and Clauses 1852.216-85 Estimated cost and award fee. As prescribed in 1816.406-70(e), insert the following clause: Estimated Cost and Award Fee (SEP 1993) The estimated cost of this contract is $___. The... cost, base fee, and maximum award fee are $___. (End of clause) Alternate I (SEP 1993). As prescribed...

  1. 48 CFR 1852.216-87 - Submission of vouchers for payment.

    Science.gov (United States)

    2010-10-01

    ... and Clauses 1852.216-87 Submission of vouchers for payment. As prescribed in 1816.307-70(e), insert the following clause: Submission for Vouchers for Payment (MAR 1998) (a) The designated billing office for cost vouchers for purposes of the Prompt Payment clause of this contract is indicated below...

  2. 50 CFR 216.219 - Renewal and modifications of Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance.... Gulf of Mexico § 216.219 Renewal and modifications of Letters of Authorization. (a) A Letter of...

  3. 50 CFR 216.211 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    ... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance.... Gulf of Mexico § 216.211 Specified activity and specified geographical region. (a) Regulations in this...

  4. 50 CFR 216.250 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    ... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.250 Specified activity and specified geographical region. (a...

  5. 75 FR 55847 - Fourteenth Meeting: EUROCAE WG-72: RTCA Special Committee 216: Aeronautical Systems Security...

    Science.gov (United States)

    2010-09-14

    ..., (RTCA Paper No. 137-10/SC216-029). Report on the PMC/ICC action on TOR: Publication Progress and Update... Advisory Committee. [FR Doc. 2010-22879 Filed 9-13-10; 8:45 am] BILLING CODE 4910-13-P ...

  6. 29 CFR 1910.216 - Mills and calenders in the rubber and plastics industries.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Mills and calenders in the rubber and plastics industries... Guarding § 1910.216 Mills and calenders in the rubber and plastics industries. (a) General requirements— (1... installed in accordance with this section and Subpart S of this part. (4) Mill roll heights. All new mill...

  7. 25 CFR 900.216 - What other statutes and regulations apply to contract disputes?

    Science.gov (United States)

    2010-04-01

    ... HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT Post-Award Contract Disputes § 900.216 What other statutes and regulations apply to... 25 Indians 2 2010-04-01 2010-04-01 false What other statutes and regulations apply to contract...

  8. 40 CFR 81.216 - Northeast Indiana Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Northeast Indiana Intrastate Air... Air Quality Control Regions § 81.216 Northeast Indiana Intrastate Air Quality Control Region. The Northeast Indiana Intrastate Air Quality Control Region (Indiana) consists of the territorial area...

  9. 9 CFR 381.216 - Procedure for judicial seizure, condemnation, and disposition.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Procedure for judicial seizure... Detention; Seizure and Condemnation; Criminal Offenses § 381.216 Procedure for judicial seizure, condemnation, and disposition. Any poultry or other article subject to seizure and condemnation under this...

  10. 12 CFR 216.12 - Limits on sharing account number information for marketing purposes.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Limits on sharing account number information... GOVERNORS OF THE FEDERAL RESERVE SYSTEM PRIVACY OF CONSUMER FINANCIAL INFORMATION (REGULATION P) Limits on Disclosures § 216.12 Limits on sharing account number information for marketing purposes. (a) General...

  11. Groundwater impact assessment for the 216-U-17 Crib, 200 West Area

    International Nuclear Information System (INIS)

    Reidel, S.P.; Johnson, V.G.; Kline, N.W.

    1993-06-01

    As required by the Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement milestone M-17-00A), this report assesses the impact to groundwater from discharge of process condensate to the ground at the 216-U-17 Crib. The assessment considers impacts associated with moisture movement through soil beneath the crib and the potential transport of contaminants to the groundwater

  12. Borehole Data Package for 216-U-12 Crib Well 299-W22-79

    International Nuclear Information System (INIS)

    DG Horton; BA Williams

    1999-01-01

    One new Resource Conservation and Recovery Act (RCRA) groundwater monitoring well was installed at the 216-U-12 crib in September 1998 in support of Tri-Parly Agreement (Ecology 1996) milestone M-24-36. The new well is 299-W22-79 and is a downgradient well in the groundwater monitoring network. There are a total of six wells in the groundwater monitoring network for the 216-U-12 crib and their locations are shown on Figure 1. The groundwater assessment monitoring plan for the 216-U-12 crib (Chou and Williams 1993) describes the hydrogeology of the 200 West Area and the 216-U-12 crib area. An Interim Change Notice to the assessment plan provides justification for the well (Chou and Williams 1997). The new well was constructed to the specifications and requirements described in Washington Administrative Code (WAC) 173-160, and WAC-173-303, and in Chou and Williams (1997). This document compiles information on the drilling and construction, well development and permanent pump installation applicable to well 299-W22-79. Appendix A contains the geologist's log, the Well Construction Summary Report, and Well Summary Sheet (as-built diagram). Additional documentation concerning well construction is on file with Bechtel Hanford, Inc., Richland, Washington. English units are used in this report because they are used by drillers to measure and report depths and well construction details. The conversion is made by multiplying feet by 0.3048 to obtain meters; or multiplying inches by 2.54 to obtain centimeters

  13. 216-S-1 and S-2 mixed-fission-product crib-characterization study

    Energy Technology Data Exchange (ETDEWEB)

    Van Luik, A. E.; Smith, R. M.

    1982-03-01

    The 216-S-1 and 2 crib is an underground structure that was used for the disposal of radioactively contaminated liquid waste at the Hanford Site. The crib received acidic, intermediate level, mixed fission-product waste solutions from 1952 to 1956. The 1980 status of radioactive contaminants in the sediment beneath the crib was investigated. The results indicate that the radionuclide distributions are stable, with no evidence of significant translocations found since the late 1960's.

  14. 216-S-1 and S-2 mixed-fission-product crib-characterization study

    International Nuclear Information System (INIS)

    Van Luik, A.E.; Smith, R.M.

    1982-03-01

    The 216-S-1 and 2 crib is an underground structure that was used for the disposal of radioactively contaminated liquid waste at the Hanford Site. The crib received acidic, intermediate level, mixed fission-product waste solutions from 1952 to 1956. The 1980 status of radioactive contaminants in the sediment beneath the crib was investigated. The results indicate that the radionuclide distributions are stable, with no evidence of significant translocations found since the late 1960's

  15. Stratigraphy of the late Cenozoic sediments beneath the 216-B and C crib facilities

    International Nuclear Information System (INIS)

    Fecht, K.R.; Last, G.V.; Marratt, M.C.

    1979-02-01

    The stratigraphy of the late Cenozoic sediments beneath the 216-B and C Crib Facilities is presented as lithofacies cross sections and is based on textural variations of the sedimentary sequence lying above the basalt bedrock. The primary source of data in this study is geologic information obtained from well drilling operations and geophysical logging. Stratigraphic interpretations are based primarily on textural analysis and visual examination of sediment samples and supplemented by drillers logs and geophysical logs

  16. Stratigraphy of the late Cenozoic sediments beneath the 216-A Crib Facilities

    International Nuclear Information System (INIS)

    Fecht, K.R.; Last, G.V.; Marratt, M.C.

    1979-02-01

    The stratigraphy of the late Cenozoic sediments beneath the 216-A Crib Facilities is presented as lithofacies cross sections and is based on textural variations of the sedimentary sequence lying above the basalt bedrock. The primary source of data in this study is geologic information obtained from well drilling operations and geophysical logging. Stratigraphic interpretations are based primarily on textural analysis and visual examination of sediment samples and supplemented by drillers logs and geophysical logs

  17. The 1943 K emission spectrum of H216O between 6600 and 7050 cm-1

    Science.gov (United States)

    Czinki, Eszter; Furtenbacher, Tibor; Császár, Attila G.; Eckhardt, André K.; Mellau, Georg Ch.

    2018-02-01

    An emission spectrum of H216O has been recorded, with Doppler-limited resolution, at 1943 K using Hot Gas Molecular Emission (HOTGAME) spectroscopy. The wavenumber range covered is 6600 to 7050 cm-1. This work reports the analysis and subsequent assignment of close to 3700 H216O transitions out of a total of more than 6700 measured peaks. The analysis is based on the Measured Active Rotational-Vibrational Energy Levels (MARVEL) energy levels of H216O determined in 2013 and emission line intensities obtained from accurate variational nuclear-motion computations. The analysis of the spectrum yields about 1300 transitions not measured previously and 23 experimentally previously unidentified rovibrational energy levels. The accuracy of the line positions and intensities used in the analysis was improved with the spectrum deconvolution software SyMath via creating a peak list corresponding to the dense emission spectrum. The extensive list of labeled transitions and the new experimental energy levels obtained are deposited in the Supplementary Material of this article as well as in the ReSpecTh (http://www.respecth.hu) information system.

  18. Astatine-211 labeling. A study towards automatic production of astatinated antibodies

    International Nuclear Information System (INIS)

    Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen

    2015-01-01

    Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)

  19. Integrating the NEPA 216 process with large-scale privatization projects under the US Department of Energy

    International Nuclear Information System (INIS)

    Eccleston, C.H.

    1994-05-01

    The US Department of Energy (DOE) is considering the possibility of replacing the existing Hanford Site 200 Are steam system through a privatization effort. Such an action would be subject to requirements of the National Environmental Policy Act (NEPA) of 1969. Section 216 of the Doe NEPA Implementation Procedures (216 Process) provides a specific mechanism for integrating the DOE procurement process with NEPA compliance requirements

  20. Actinide occurrences in sediments following ground disposal of acid wastes at 216-Z-9

    International Nuclear Information System (INIS)

    Ames, L.L.

    1976-01-01

    Liquid acid wastes from a Pu recovery facility at Hanford were released to the ground via structures collectively termed trenches from 1955 through 1962. Data are presented from a study of the microdistribution of Am and Pu in samples from the 216-Z-9 trench. Solution sediment relationships and associated actinide removal mechanisms under acid conditions were studied. Core wells were drilled into the sediments in which this covered trench is located and in the immediate vicinity to obtain samples for quantitative mineralogical analysis and comparison of sediments from various depths of contaminated and noncontaminated areas. Analytical techniques are described and results are reported

  1. Groundwater impact assessment report for the 216-Z-20 Crib, 200 West Area

    International Nuclear Information System (INIS)

    Johnson, V.G.

    1993-10-01

    As required by the Hanford Federal Facility Agreement and Consent Order ([Tri-Party Agreement] Milestone M-17-00A), this report assesses the impact of wastewater discharges to the 216-Z-20 Crib on groundwater quality. The assessment reported herein extends the initial analysis conducted from 1989 through 1990 for the Liquid Effluent Study Final Project Report. Three primary issues are addressed in response to regulator concerns with the initial analysis: The magnitude and status of the soil column transuranic inventory. Potential interactions of wastewater with carbon tetrachloride from adjacent facilities. Preferential pathways created by unsealed monitoring wells

  2. Groundwater impact assessment report for the 216-Z-20 Crib, 200 West Area

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, V.G.

    1993-10-01

    As required by the Hanford Federal Facility Agreement and Consent Order ([Tri-Party Agreement] Milestone M-17-00A), this report assesses the impact of wastewater discharges to the 216-Z-20 Crib on groundwater quality. The assessment reported herein extends the initial analysis conducted from 1989 through 1990 for the Liquid Effluent Study Final Project Report. Three primary issues are addressed in response to regulator concerns with the initial analysis: The magnitude and status of the soil column transuranic inventory. Potential interactions of wastewater with carbon tetrachloride from adjacent facilities. Preferential pathways created by unsealed monitoring wells.

  3. Field characterization plan for the 216-U-8 vitrified clay pipeline

    International Nuclear Information System (INIS)

    Rowley, C.A.

    1994-01-01

    The 216-U-8 Crib was constructed in 1952 and received waste from 1952 to 1960 as described in Appendix A. This description of work details the field activities associated with the characterization of the vitrified clay pipe (VCP) delivery line to the 216-U-8 Crib and subsurface soil sampling along the pipe route in the 200 West Area of Hanford U Plant. It will serves as a field guide for those performing the work. Soil sampling locations will be determined by a combination of radiological surface surveys and internal camera surveys of the VCP line. Depending on the condition of the pipeline and field conditions, the objectives are as follows: examine the internal condition of the VCP with a survey camera to the extent allowed by field conditions; determine precise location and depth of the VCP; document VCP integrity; document gamma radiation profile through the VCP; and correlate any relationships between surface contamination zones at grade above the VCP to identify breaches in the pipe integrity

  4. 216-A-10 Crib supplemental information to the Hanford Facility Contingency Plan (DOE/RL-93-75)

    International Nuclear Information System (INIS)

    Ingle, S.J.

    1996-05-01

    This document is a unit-specific contingency plan for the 216-A-10 Crib. The Crib is a landfill that received process condensate from the 202-A building Plutonium/Uranium Extraction Plant from 1956 to 1987. The crib has not received waste since March 1987 and will be closed under final facility standards. Waste management activities are no longer required at the crib, and it does not present significant hazard to adjacent units, personnel or the environment. It is unlikely that any incidents presenting hazards to the public health or the environment would occur at the 216-A-10 Crib

  5. 216-S-10 Pond and Ditch supplemental information to the Hanford Facility Contingency Plan (DOE/RL-93-75)

    International Nuclear Information System (INIS)

    Ingle, S.J.

    1996-05-01

    The 216-S-10 Pond and Ditch were used as disposal sites for the Chemical Engineering Laboratory between 1980 and 1983. The 216-S-10 Ditch last received a discharge October 1991. Both the pond and the ditch have been physically isolated, and the pond has been backfilled and decommissioned; both will be closed under final facility standards. Waste management activities are no longer required at the unit. The unit does not present and significant hazard to adjacent units, personnel, or the environment. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the 215-S-10 Pond and Ditch

  6. Groundwater monitoring plan for the Hanford Site 216-B-3 pond RCRA facility

    International Nuclear Information System (INIS)

    Barnett, D.B.; Chou, C.J.

    1998-06-01

    The 216-B-3 pond system was a series of ponds for disposal of liquid effluent from past Hanford production facilities. In operation since 1945, the B Pond system has been a RCRA facility since 1986, with Resource Conservation and Recovery Act (RCRA) interim-status groundwater monitoring in place since 1988. In 1994, discharges were diverted from the main pond, where the greatest potential for contamination was thought to reside, to the 3C expansion pond. In 1997, all discharges to the pond system were discontinued. In 1990, the B Pond system was elevated from detection groundwater monitoring to an assessment-level status because total organic halogens and total organic carbon were found to exceed critical means in two wells. Subsequent groundwater quality assessment failed to find any specific hazardous waste contaminant that could have accounted for the exceedances, which were largely isolated in occurrence. Thus, it was recommended that the facility be returned to detection-level monitoring

  7. Study of two photon production process in proton-proton collisions at 216 MeV

    International Nuclear Information System (INIS)

    Khrykin, A.S.

    2002-01-01

    The energy spectrum for high energy γ-rays (Eγ ≥ 10 MeV) from the process pp → γγX emitted at 90 deg. in the laboratory frame has been measured at 216 MeV. The resulting photon energy spectrum extracted from γ - γ coincidence events consists of a narrow peak (5.3σ) at a photon energy of about 24 MeV and a relatively broad peak (3.5σ) in the energy range of (50 - 70) MeV. This behavior of the photon energy spectrum is interpreted as a signature of the exotic dibaryon resonance d 1 * with a mass of about 1956 MeV which is assumed to be formed in the radiative process pp → γd 1 * followed by its electromagnetic decay via the d 1 * → ppγ mode. The experimental spectrum is compared with those obtained by means of Monte Carlo simulations

  8. Ground water impact assessment report for the 216-B-3 Pond system

    International Nuclear Information System (INIS)

    Johnson, V.G.; Law, A.G.; Reidel, S.P.; Evelo, S.D.; Barnett, D.B.; Sweeney, M.D.

    1995-01-01

    Ground water impact assessments were required for a number of liquid effluent receiving sites according to the Hanford Federal Facility Agreement and Consent Order Milestones M-17-00A and M-17-00B, as agreed upon by the US Department of Energy. This report is one of the last three assessments required and addresses the impact of continued discharge of uncontaminated wastewater to the 216-B-3C expansion lobe of the B Pond system in the 200 East Area until June 1997. Evaluation of past and projected effluent volumes and composition, geohydrology of the receiving site, and contaminant plume distribution patterns, combined with ground water modeling, were used to assess both changes in ground water flow regime and contaminant-related impacts

  9. 40 CFR 80.216 - What standards apply to gasoline produced or imported for use in the GPA?

    Science.gov (United States)

    2010-07-01

    ... Geographic Phase-in Program § 80.216 What standards apply to gasoline produced or imported for use in the GPA? (a) The refinery or importer annual average sulfur standard for gasoline produced or imported for use...), shall be 150.00 ppm. (b) The per-gallon cap standard for gasoline produced or imported for use in the...

  10. 48 CFR 52.216-30 - Time-and-Materials/Labor-Hour Proposal Requirements-Non-Commercial Item Acquisition without...

    Science.gov (United States)

    2010-10-01

    ...-Hour Proposal Requirements-Non-Commercial Item Acquisition without Adequate Price Competition. 52.216... Price Competition. As prescribed in 16.601(e)(2), insert the following provision: Time-and-Materials/Labor-Hour Proposal Requirements—Non-Commercial Item Acquisition Without Adequate Price Competition (FEB...

  11. 50 CFR 216.92 - Dolphin-safe requirements for tuna harvested in the ETP by large purse seine vessels.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Dolphin-safe requirements for tuna... MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Dolphin Safe Tuna Labeling § 216.92 Dolphin-safe requirements for tuna harvested in the ETP by large purse seine vessels. (a) U.S...

  12. 47 CFR 15.216 - Disclosure requirements for wireless microphones and other low power auxiliary stations capable...

    Science.gov (United States)

    2010-10-01

    ... Intentional Radiators Radiated Emission Limits, Additional Provisions § 15.216 Disclosure requirements for... following disclosure requirements: (1) Such persons must display the consumer disclosure text, as specified... point of sale or lease of each such low power auxiliary station. The text must be displayed in a clear...

  13. High-spin states in 214Rn, 216Ra and a study of even-even N = 128 systematics

    International Nuclear Information System (INIS)

    Loennroth, T.; Horn, D.; Baktash, C.; Lister, C.J.; Young, G.R.

    1983-01-01

    High-spin states in 214 Rn and 216 Ra have been studied by means of the reaction 208 Pb( 13 C, α 3n #betta#) 214 Rn and 208 Pb( 13 C, 5n #betta#) 216 Ra at beam energies in the range 75--95 MeV. In-beam spectroscopy techniques, including #betta#-decay excitation functions, α-#betta# coincidences, #betta#-#betta# coincidences, #betta#-ray angular distributions, and pulsed-beam-#betta# timing, were utilized to establish level energies, #betta#-ray multipolarities, J/sup π/ assignments, and isomeric lifetimes. Excited states with spins up to 23h in 214 Rn and roughly-equal30h in 216 Ra were observed. Isomers were found in 214 Rn at 1625 keV (T/sub 1/2/ = 9 ns, J/sup π/ = 8 + ), 1787 keV (22 ns, 10 + ), 3485 keV (95 ns, 16), 4509 keV (230 ns, 20), and 4738 keV (8 ns, 22), and in 216 Ra at 1708 keV (8 ns, 8 + ) and 5868 keV (10 ns, approx.24). B(EL) values were deduced and compared to previously known lead-region electric transition rates. Shell-model calculations were performed and used to make configurational assignments. The absence of major α-decay branching in the isomers is explained and the systematic behavior of N = 128 even-even nuclei is discussed

  14. 5 CFR 551.216 - Law enforcement activities and 7(k) coverage for FLSA pay and exemption determinations.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Law enforcement activities and 7(k... ACT Exemptions and Exclusions § 551.216 Law enforcement activities and 7(k) coverage for FLSA pay and... section 7(k) of the Act apply to certain categories of law enforcement employees based on appropriate...

  15. High-spin states in 214Rn, 216Ra and a study of even-even N = 128 systematics

    International Nuclear Information System (INIS)

    Loennroth, T.; Horn, D.; Baktash, C.; Lister, C.J.; Young, G.R.

    1981-09-01

    High-spin states in 214 Rn and 216 Ra have been studied by means of the reaction 208 Pb( 13 C,α3nγ) 214 Rn and 208 Pb( 13 C,5nγ) 216 Ra at beam energies in the range 75-95 MeV. In-beam spectroscopy techniques, including γ-decay excitation functions, α-γ coincidences, γ-γ coincidences, γ-ray angular distributions and pulsed-beam-γ timing, were utilized to establish level energies, γ-ray multipolarities, JHπ assignments and isomeric lifetimes. Excited states with spins up to 23 h/2π in 214 Rn and 30 h/2π in 216 Ra were established. Isomers are found in 214 Rn at 1625 keV (9 ns, 8 + ), 1787 keV (22 ns, 10 + ), 3485 keV (95 ns, 16 + ), 4509 keV (230 ns, 20 + ) and 4735 keV (8.0 ns, 22 + ) and in 216 Ra at 1710 keV (8 ns, 8 + ) and 5868 keV (10 ns, 24 - ). B(EL) values are derived and compared to previously known lead-region electric transition rates. Shell-model calculations are performed on the basis of which configuration assignment is made. The absence of α-decay branching in the isomers is explained. The systematical behaviour of N = 128 even-even nuclei is discussed. Effective moments of inertia are derived. (author)

  16. Decree of 19 November 1981 listing the insanitary industries in accordance with Section 216 of the health Code

    International Nuclear Information System (INIS)

    1981-01-01

    This Decree issued by the Minister of Health approves an amended list of insanitary industries which are subject to certain obligations under Section 216 of the Health Code of 1934. The amendments concern certain nuclear plants and laboratories. The 1981 Decree modifies a previous Decree of 1976. (NEA) [fr

  17. High-spin states in 214Rn, 216Ra and a study of even-even N=128 systematics

    Science.gov (United States)

    Lönnroth, T.; Horn, D.; Baktash, C.; Lister, C. J.; Young, G. R.

    1983-01-01

    High-spin states in 214Rn and 216Ra have been studied by means of the reaction 208Pb(13C, α 3n γ)214Rn and 208Pb(13C, 5n γ)216Ra at beam energies in the range 75-95 MeV. In-beam spectroscopy techniques, including γ-decay excitation functions, α-γ coincidences, γ-γ coincidences, γ-ray angular distributions, and pulsed-beam-γ timing, were utilized to establish level energies, γ-ray multipolarities, Jπ assignments, and isomeric lifetimes. Excited states with spins up to 23ℏ in 214Rn and ~30ℏ in 216Ra were observed. Isomers were found in 214Rn at 1625 keV (T12=9 ns, Jπ=8+), 1787 keV (22 ns, 10+), 3485 keV (95 ns, 16), 4509 keV (230 ns, 20), and 4738 keV (8 ns, 22), and in 216Ra at 1708 keV (8 ns, 8+) and 5868 keV (10 ns, ~24). B(EL) values were deduced and compared to previously known lead-region electric transition rates. Shell-model calculations were performed and used to make configurational assignments. The absence of major α-decay branching in the isomers is explained and the systematic behavior of N=128 even-even nuclei is discussed. NUCLEAR STRUCTURE 208Pb(13C, α 3n γ)214Rn, 208Pb(13C, 5n γ) 216Ra, Elab=75-95 MeV. Measured α-γ coin, γ-γ(t) coin, I(θ), pulsed-beam-γ timing. Deduced level schemes, Jπ, T12, B(EL), multipolarities. Shell model calculations, Ge(Li) and Si detectors, enriched target.

  18. Description of work for 216-U-Pond cone penetrometer demonstration

    International Nuclear Information System (INIS)

    Kelty, G.G.

    1993-01-01

    This description of work details the Proposed field activities associated with Cone Penetrometer (CPT) work at the 216-U-10 Pond (U-10 Pond) in the 200 West Area and will serve as a field guide for those performing the work. The U-10 Pond was constructed in 1944 to receive low-level liquid effluent from the various chemical reprocessing facilities within the 200 West Area. The U-10 Pond covered 30 acres and received approximately 4.3 x 10 10 gal of contaminated liquid. Sampling conducted in 1980 indicated that the most significant radionuclides were 90 Sr, 137 Cs, plutonium, and uranium (DOE-RL 1993). The pond was deactivated and stabilized in 1985 with clean fill dirt. The thickness of the stabilization cover is variable across the former pond and ranges between 2 ft near the pond margins and delta area to 8 feet in the deepest section of the pond. The purpose of this work is to establish the extent of contamination beneath the U-10 pond

  19. H i Absorption in the Steep-Spectrum Superluminal Quasar 3C 216.

    Science.gov (United States)

    Pihlström; Vermeulen; Taylor; Conway

    1999-11-01

    The search for H i absorption in strong compact steep-spectrum sources is a natural way to probe the neutral gas contents in young radio sources. In turn, this may provide information about the evolution of powerful radio sources. The recently improved capabilities of the Westerbork Synthesis Radio Telescope have made it possible to detect a 0.31% (19 mJy) deep neutral atomic hydrogen absorption line associated with the steep-spectrum superluminal quasar 3C 216. The redshift (z=0.67) of the source shifts the frequency of the 21 cm line down to the ultra-high-frequency (UHF) band (850 MHz). The exact location of the H i-absorbing gas remains to be determined by spectral line VLBI observations at 850 MHz. We cannot exclude that the gas might be extended on galactic scales, but we think it is more likely to be located in the central kiloparsec. Constraints from the lack of X-ray absorption probably rule out obscuration of the core region, and we argue that the most plausible site for the H i absorption is in the jet-cloud interaction observed in this source.

  20. Evaluation report on CCTF Core-II reflood test C2-16 (Run 76)

    International Nuclear Information System (INIS)

    Iguchi, Tadashi; Akimoto, Hajime; Okubo, Tsutomu; Hojo, Tsuneyuki; Murao, Yoshio; Sugimoto, Jun.

    1987-03-01

    This report presents the result of the upper plenum injection (UPI) test C2-16 (Run 76), which was conducted on October 23, 1984, with the Cylindrical Core Test Facility (CCTF) at Japan Atomic Energy Research Institute (JAERI). The CCTF is a 1/21.4 scale model of a 1,100 MWe PWR with four loop active components to provide information on the system and core thermo-hydrodynamics during reflood. The objectives of the test are to investigate the reflood phenomena with single failure UPI condition and to investigate the effect of the asymmetry of UPI on the reflood phenomena. The test was performed with an asymmetric UPI condition at the injection rate simulating single failure of LPCI pumps. It was observed that, (1) a UPI test simulating no LPCI pump failure gave the slightly lower peak clad temperature than a UPI test simulating single LPCI pump failure, indicating that single LPCI pump failure assumption is conserrative for UPI condition, and (2) an asymmetric UPI lead to a higher core water accumulation and then a higher heat transfer coefficient, resultantly a lower peak clad temperature than a symmetric UPI, indicating that asymmetric UPI does not lead to a poorer core cooling than symmetric UPI. (author)

  1. Results of RCRA groundwater quality assessment at the 216-B-3 Pond Facility

    International Nuclear Information System (INIS)

    Barnett, D.B.; Teel, S.S.

    1997-06-01

    This document describes a groundwater quality assessment of the 216-B-3 pond system, a Resources Conservation and Recovery act of 1976 (RCRA) waste facility. In 1990, sampling and chemical analysis of groundwater underlying the facility indicated that the contamination indicator parameters, total organic halogens (TOX), and total organic carbon (TOC) had exceeded established limits in two wells. This discovery placed the facility into RCRA groundwater assessment status and subsequently led to a more detailed hydrochemical analysis of groundwater underlying the facility. Comprehensive chemical analyses of groundwater samples from 1994 through 1996 revealed one compound, tris (2-chloroethyl) phosphate (TRIS2CH), that may have contributed to elevated TOX concentrations. No compound was identified as a contributor to TOC. Detailed evaluations of TOX, TOC, and TRIS2CH and comparison of occurrences of these parameters led to conclusions that (1) with few exceptions, these constituents occur at low concentrations below or near limits of quantitation; (2) it is problematic whether the low concentrations of TRIS2CH represent a contaminant originating from the facility or if it is a product of well construction; and (3) given the low and diminishing concentration of TOX, TOC, and TRIS2CH, no further investigation into the occurrent of these constituents is justified. Continued groundwater monitoring should include an immediate recalculation of background critical means of upgradient/downgradient comparisons and a return to seminannual groundwater monitoring under a RCRA indicator parameter evaluation program

  2. Numerical study on effect of boundary layer trips on aerodynamic performance of E216 airfoil

    Directory of Open Access Journals (Sweden)

    B.K. Sreejith

    2018-02-01

    Full Text Available Simulation is carried out to find the performance of airfoil E216 using Transition γ-Reθ model at Reynolds number of 100,000. Flow behaviour and effect of angle of attack (AOA on laminar separation bubble (LSB formation are examined. The results are validated with wind tunnel experimental results. LSB formation is clearly spotted in the velocity vector plot and coefficient of pressure distribution over airfoil. LSB moved upstream towards the leading edge with increase in AOA. Effect of boundary layer trip on LSB formation over the airfoil and performance of airfoil are studied. Two different trip locations, 17% of chord and 10% of chord from leading edge, and different trip heights (0.3 mm, 0.5 mm, 0.7 mm, 1 mm are investigated in this study. Results showed that boundary layer trip could eliminate LSB partially or completely and improve aerodynamic performance of the airfoil. Maximum improvement in drag by 15.48% and lift to drag ratio by 21.62% are obtained at angle of attack of 60. In all the cases, improvement in performance is observed only up to trip height of 0.5 mm.

  3. Borehole data package for the 216-S-10 pond and ditch well 299-W26-13

    International Nuclear Information System (INIS)

    Horton, D.G.; Williams, B.A.; Cearlock, C.S.

    2000-01-01

    One new Resource Conservation and Recovery Act (RCRA) groundwater monitoring well was installed at the 216-S-10 pond and ditch during November and December 1999 in fulfillment of Tri-Party Agreement (Ecology 1996) milestone M-24-42. The well is 299-W26-13 and is located at the northeast comer to the 216-S-10 pond, southwest of 200 West Area. The well is a new downgradient well in the monitoring network. A figure shows the locations of all wells in the 216-S-10 pond and ditch monitoring network. The new well was constructed to the specifications and requirements described in Washington Administrative Code (WAC) 173-160 and WAC 173-303, the groundwater monitoring plan for the 216-S-10 pond and ditch (Airhart et al. 1990), and the description of work for well drilling and installation. During drilling and construction of well 299-W26-13, sampling and analysis activities were done to support remedial action, closure decisions at treatment, storage and disposal facilities, and to confirm preliminary site conceptual models developed in the 200-CS-1 Work Plan (DOE/RL 1999). This document compiles information on the drilling and construction, well development, pump installation, and sediment and groundwater testing applicable to well 299-W26-13. Appendix A contains the Well Summary Sheet (as-built diagram), the Well Construction Summary Report, and the geologist's log. Appendix B contains results of field and laboratory determinations of physical and chemical properties of sediment samples. Appendix C contains borehole geophysical logs. Additional documentation concerning well construction is on file with Bechtel Hanford, Inc., Richland, Washington

  4. 216-A-29 Ditch supplemental information to the Hanford Facility Contingency Plan (DOE/RL-93-75)

    International Nuclear Information System (INIS)

    Ingle, S.J.

    1996-05-01

    This document is a unit-specific contingency plan for the 216-A-29 Ditch and is intended to be used as a supplement to DOE/RL-93-75, Hanford Facility Contingency Plan (DOE-RL 1993). This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of the Washington Administrative Code, Chapter 173- 303 for certain Resource Conservation and Recovery Act of 1976 waste management units. The 216-A-29 Ditch is a surface impoundment that received nonregulated process and cooling water and other dangerous wastes primarily from operations of the Plutonium/Uranium Extraction Plant. Active between 1955 and 1991, the ditch has been physically isolated and will be closed. Because it is no longer receiving discharges, waste management activities are no longer required at the unit. The ditch does not present a significant hazard to adjacent units, personnel, or the environment. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the 216-A-29 Ditch

  5. 216-U-12 Crib supplemental information to the Hanford Facility Contingency Plan (DOE/RL-93-75)

    International Nuclear Information System (INIS)

    Ingle, S.J.

    1996-05-01

    This document is a unit-specific contingency plan for the 216-U-12 Crib and is intended to be used as a supplement to DOE/RL-93-75, Hanford Facility Contingency Plan (DOE-RL 1993). This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of the Washington Administrative Code, Chapter 173- 303 for certain Resource Conservation and Recovery Act of 1976 waste management units. The 216-U-12 Crib is a landfill that received waste from the 291-U-1 Stack, 244-WR Vault, 244-U via tank C-5, and the UO 3 Plant. The crib pipeline was cut and permanently capped in 1988, and the crib has been backfilled. The unit will be closed under final facility standards. Waste management activities are no longer required at the unit. The crib does not present a significant hazard to adjacent units, personnel, or the environment. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the 216-U-12 Crib

  6. 216-A-36B Crib supplemental information to the Hanford Facility Contingency Plan (DOE/RL-93-75)

    International Nuclear Information System (INIS)

    Ingle, S.J.

    1996-05-01

    This document is a unit-specific contingency plan for the 216-A-36B Crib and is intended to be used as a supplement to DOE/RL-93-75, Hanford Facility Contingency Plan (DOE-RL 1993). This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of the Washington Administrative Code, Chapter 173- 303 for certain Resource Conservation and Recovery Act of 1976 waste management units. The 216-A-36B Crib is a landfill that received ammonia scrubber waste from the 202-A Building (Plutonium/Uranium Extraction Plant) between 1966 and 1972. In 1982, the unit was reactivated to receive additional waste from Plutonium/Uranium Extraction operations. Discharges ceased in 1987, and the crib will be closed under final facility standards. Because the crib is not receiving discharges, waste management activities are no longer required. The crib does not present a significant hazard to adjacent units, personnel, or the environment. There is little likelihood that any incidents presenting hazards to public health or the environment would occur at the 216-A-36B Crib

  7. The predicted impacts to the groundwater and Columbia River from ammoniated water discharges to the 216-A-36B crib

    International Nuclear Information System (INIS)

    Buelt, J.L.; Conbere, W.; Freshley, M.D.; Hicks, R.J.; Kuhn, W.L.; Lamar, D.A.; Serne, R.J.; Smoot, J.L.

    1988-03-01

    Impact from past and potential future discharges of ammoniated water to the 216-A-36B crib have on groundwater and river concentrations of hazardous chemical constitutents are studied. Until August 1987, the 216-A-36B crib, located in the 200-East Area of the Hanford Site, accepted ammoniated water discharges. Although this study addresses known hazardous chemical constituents associated with such discharges, the primary concern is the discharge of NH 4 OH because of its microbiological conversion to NO 2 /sup /minus// and NO 3 /sup /minus//. As a result of fuel decladding operations, material balance calculations indicate that NH 4 OH has been discharged to the 216-A-36B crib in amounts that exceed reportable quantities under the Comprehensive Environmental Response, Compensation and Liability Act of 1980. Although flow to the crib is relatively constant, the estimated NH 4 OH discharge varies from negligible to a maximum of 10,000 g-molesh. Because these discharges are intermittent, the concentration delivered to the groundwater is a function of soil sorption, microbiological conversion rates of NH 4 + to NO 2 /sup /minus// and NO 3 /sup /minus//, and groundwater dispersion. This report provides results based on the assumptions of maximum, nominal, and discountinued NH 4 OH discharges to the crib. Consequently, the results show maximum and realistic estimates of NH 4 + , NO 2 /sup /minus// and NO 3 /sup /minus// concentrations in the groundwater

  8. Complications following blunt and penetrating injuries in 216 victims of chest trauma requiring tube thoracostomy.

    Science.gov (United States)

    Helling, T S; Gyles, N R; Eisenstein, C L; Soracco, C A

    1989-10-01

    Tube thoracostomy (TT) is required in the treatment of many blunt and penetrating injuries of the chest. In addition to complications from the injuries, TT may contribute to morbidity by introducing microorganisms into the pleural space or by incomplete lung expansion and evacuation of pleural blood. We have attempted to assess the impact of TT following penetrating and blunt thoracic trauma by examining a consecutive series of 216 patients seen at two urban trauma centers with such injuries who required TT over a 30-month period. Ninety-four patients suffered blunt chest trauma; 122 patients were victims of penetrating wounds. Patients with blunt injuries had longer ventilator requirements (12.6 +/- 14 days vs. 3.7 +/- 7.1 days, p = 0.003), longer intensive care stays (12.2 +/- 12.5 days vs. 4.1 +/- 7.5 days, p = 0.001), and longer periods of TT, (6.5 +/- 4.9 days vs. 5.2 +/- 4.5 days, p = 0.018). Empyema occurred in six patients (3%). Residual hemothorax was found in 39 patients (18%), seven of whom required decortication. Recurrent pneumothorax developed in 51 patients (24%) and ten required repeat TT. Complications occurred in 78 patients (36%). Patients with blunt trauma experienced more complications (44%) than those with penetrating wounds (30%) (p = 0.04). However, only seven of 13 patients developing empyema or requiring decortication had blunt trauma. Despite longer requirements for mechanical ventilation, intensive care, and intubation, victims of blunt trauma seemed to have effective drainage of their pleural space by TT without increased risk of infectious complications.

  9. 5 CFR 591.216 - How does OPM combine survey data for the DC area and for COLA areas with multiple survey areas?

    Science.gov (United States)

    2010-01-01

    ... Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.216 How does OPM...

  10. Decommissioning of a RCRA Treatment, Storage, and Disposal Facility: A case study of the 216-A-29 ditch at the Hanford Site

    International Nuclear Information System (INIS)

    Smith, D.L.; Hayward, W.M.

    1991-09-01

    The 216-A-29 ditch is located in the central portion of the Hanford Site with Operable Unit 200-PO-5. The ditch is classified under the Resource Conservation and Recovery Act of 1976 as a Treatment, Storage, and Disposal (TSD) Facility and as such, is to be removed from service in support of the Hanford Federal Facility Agreement and Consent Order Tri-Party Agreement (Ecology et al. 1989) Milestone M-17-10, which states ''cease all liquid discharges to hazardous land disposal units unless such units have been clean closed in accordance with the Resource Conservation and Recovery Act of 1976''. The 216-A-29 ditch is one stream feeding the 216-B-3 Pond system, and its removal from service was necessary to support the closure strategy for the 216-B-3 Pond system. Interim stabilization of the 216-A-29 ditch is the first step required to comply with the Tri-Party Agreement (Ecology et al. 1989) and the eventual decommissioning of the entire B Pond system. Interim stabilization was required to maintain the 216-A-29 ditch in a stable configuration until closure actions have been determined and initiated. 4 refs., 3 figs

  11. Astatine-211 labelled proteins and their stability in vivo

    International Nuclear Information System (INIS)

    Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun

    1989-01-01

    211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs

  12. Plant Growth-Promoting Endophyte Serratia marcescens AL2-16 Enhances the Growth of Achyranthes aspera L., a Medicinal Plant

    Directory of Open Access Journals (Sweden)

    Khaidem Aruna Devi

    2016-10-01

    Full Text Available An endophytic bacterium, AL2-16, was isolated from Achyranthes aspera L. It was characterized and identified as Serratia sp. AL2-16 and was experimented for the presence of plant growth-promoting properties. AL2-16 produced siderophore in iron-deficient conditions. The quantitative estimation of siderophore production unit of AL2-16 was maximum after 48 hours of incubation (83.488% in the presence of 1 μM of ferric chloride. The fructose followed by glucose and sucrose were proved to be the best carbon sources resulting in appreciable amount of siderophore production, i.e. 77.223%, 73.584%, and 65.363% respectively. AL2-16 also has the ability to produce indole acetic acid in medium supplemented with l-tryptophan. The highest amount of indole acetic acid, in the presence of 1.0% l-tryptophan, was 123.2 μg/mL after 144 hours. This isolate solubilized inorganic phosphate and also gave positive result for ammonia production. Colonization and pot trial experiments were conducted on A. aspera L. plant. The population of AL2-16 increased from 16.2 × 106 to 11.2 × 108 colony forming unit/g between 3rd and 5th days after inoculation. It significantly (p ≤ 0.05 increased shoot length by 95.52%, fresh shoot weight by 602.38%, fresh root weight by 438%, and area of leaves by 127.2% when inoculated with AL2-16, as compared with uninoculated control.

  13. IRC +10 216 in 3D: morphology of a TP-AGB star envelope

    Science.gov (United States)

    Guélin, M.; Patel, N. A.; Bremer, M.; Cernicharo, J.; Castro-Carrizo, A.; Pety, J.; Fonfría, J. P.; Agúndez, M.; Santander-García, M.; Quintana-Lacaci, G.; Velilla Prieto, L.; Blundell, R.; Thaddeus, P.

    2018-02-01

    During their late pulsating phase, AGB stars expel most of their mass in the form of massive dusty envelopes, an event that largely controls the composition of interstellar matter. The envelopes, however, are distant and opaque to visible and NIR radiation: their structure remains poorly known and the mass-loss process poorly understood. Millimeter-wave interferometry, which combines the advantages of longer wavelength, high angular resolution and very high spectral resolution is the optimal investigative tool for this purpose. Mm waves pass through dust with almost no attenuation. Their spectrum is rich in molecular lines and hosts the fundamental lines of the ubiquitous CO molecule, allowing a tomographic reconstruction of the envelope structure. The circumstellar envelope IRC +10 216 and its central star, the C-rich TP-AGB star closest to the Sun, are the best objects for such an investigation. Two years ago, we reported the first detailed study of the CO(2-1) line emission in that envelope, made with the IRAM 30-m telescope. It revealed a series of dense gas shells, expanding at a uniform radial velocity. The limited resolution of the telescope (HPBW 11″) did not allow us to resolve the shell structure. We now report much higher angular resolution observations of CO(2-1), CO(1-0), CN(2-1) and C4H(24-23) made with the SMA, PdB and ALMA interferometers (with synthesized half-power beamwidths of 3″, 1″ and 0.3″, respectively). Although the envelope appears much more intricate at high resolution than with an 11″ beam, its prevailing structure remains a pattern of thin, nearly concentric shells. The average separation between the brightest CO shells is 16″ in the outer envelope, where it appears remarkably constant. Closer to the star (system with a period of 700 yr and a near face-on elliptical orbit. The companion fly-by triggers enhanced episodes of mass loss near periastron. The densification of the shell pattern observed in the central part of the

  14. Vadose Zone Contaminant Fate and Transport Analysis for the 216-B-26 Trench

    Energy Technology Data Exchange (ETDEWEB)

    Ward, Andy L.; Gee, Glendon W.; Zhang, Z. F.; Keller, Jason M.

    2004-10-14

    The BC Cribs and Trenches, part of the 200 TW 1 OU waste sites, received about 30 Mgal of scavenged tank waste, with possibly the largest inventory of 99Tc ever disposed to the soil at Hanford and site remediation is being accelerated. The purpose of this work was to develop a conceptual model for contaminant fate and transport at the 216-B-26 Trench site to support identification and development and evaluation of remediation alternatives. Large concentrations of 99Tc high above the water table implicated stratigraphy in the control of the downward migration. The current conceptual model accounts for small-scale stratigraphy; site-specific changes soil properties; tilted layers; and lateral spreading. It assumes the layers are spatially continuous causing water and solutes to move laterally across the boundary if conditions permit. Water influx at the surface is assumed to be steady. Model parameters were generated with pedotransfer functions; these were coupled high resolution neutron moisture logs that provided information on the underlying heterogeneity on a scale of 3 inches. Two approaches were used to evaluate the impact of remedial options on transport. In the first, a 1-D convolution solution to the convective-dispersive equation was used, assuming steady flow. This model was used to predict future movement of the existing plume using the mean and depth dependent moisture content. In the second approach, the STOMP model was used to first predict the current plume distribution followed by its future migration. Redistribution of the 99Tc plume was simulated for the no-action alternative and on-site capping. Hypothetical caps limiting recharge to 1.0, 0.5, and 0.1 mm yr-1 were considered and assumed not to degrade in the long term. Results show that arrival time of the MCLs, the peak arrival time, and the arrival time of the center of mass increased with decreasing recharge rate. The 1-D convolution model is easy to apply and can easily accommodate initial

  15. 40 CFR 265 interim status indicator-evaluation ground-water monitoring plan for the 216-B-63 trench

    International Nuclear Information System (INIS)

    Bjornstad, B.N.; Dudziak, S.

    1989-03-01

    This document outlines a ground-water monitoring plan for the 216-B-63 trench located in the northeast corner of the 200-East Area on the Hanford Site in southeastern Washington State. It has been determined that hazardous materials (corrosives) were disposed of to the trench during past operations. Installation of an interim-status ground-water monitoring system is required to determine whether hazardous chemicals are leaching to the ground water from beneath the trench. This document summarizes the existing data that are available from near the 216-B-63 trench and presents a plan to determine the extent of ground-water contamination, if any, derived from the trench. The plan calls for the installation of four new monitoring wells located near the west end of the trench. These wells will be used to monitor ground-water levels and water quality immediately adjacent to the trench. Two existing RCRA monitoring wells, which are located near the trench and hydraulically upgradient of it, will be used as background wells. 46 refs., 15 figs., 12 tabs

  16. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2013. Scientific Opinion on Flavouring Group Evaluation 216, Revision 1 (FGE.216Rev1). Consideration of genotoxic potential for α,β-unsaturated 2-Phenyl -2-Alkenals from Subgroup 3.3 of FGE.19

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of five flavouring substances from subgroup 3.3 of FGE.19. In the Flavouring Group Evaluation 216 (FGE.216) additional genotoxicity...... of animals treated with 2-phenylcrotonaldehyde. Moreover, since the substance was genotoxic only without metabolic activation, it appears necessary to prove the absence of genotoxic effect locally in the gastro intestinal system using the Comet assay....

  17. The related transcriptional enhancer factor-1 isoform, TEAD4(216, can repress vascular endothelial growth factor expression in mammalian cells.

    Directory of Open Access Journals (Sweden)

    Binoy Appukuttan

    Full Text Available Increased cellular production of vascular endothelial growth factor (VEGF is responsible for the development and progression of multiple cancers and other neovascular conditions, and therapies targeting post-translational VEGF products are used in the treatment of these diseases. Development of methods to control and modify the transcription of the VEGF gene is an alternative approach that may have therapeutic potential. We have previously shown that isoforms of the transcriptional enhancer factor 1-related (TEAD4 protein can enhance the production of VEGF. In this study we describe a new TEAD4 isoform, TEAD4(216, which represses VEGF promoter activity. The TEAD4(216 isoform inhibits human VEGF promoter activity and does not require the presence of the hypoxia responsive element (HRE, which is the sequence critical to hypoxia inducible factor (HIF-mediated effects. The TEAD4(216 protein is localized to the cytoplasm, whereas the enhancer isoforms are found within the nucleus. The TEAD4(216 isoform can competitively repress the stimulatory activity of the TEAD4(434 and TEAD4(148 enhancers. Synthesis of the native VEGF(165 protein and cellular proliferation is suppressed by the TEAD4(216 isoform. Mutational analysis indicates that nuclear or cytoplasmic localization of any isoform determines whether it acts as an enhancer or repressor, respectively. The TEAD4(216 isoform appears to inhibit VEGF production independently of the HRE required activity by HIF, suggesting that this alternatively spliced isoform of TEAD4 may provide a novel approach to treat VEGF-dependent diseases.

  18. Controlling liquid pool depth in VAR of a 21.6 cm diameter ingot of Alloy 718

    Science.gov (United States)

    Lopez, Felipe; Beaman, Joseph; Williamson, Rodney; Taleff, Eric; Watt, Trevor

    It is believed that the final microstructure in vacuum arc remelted (VAR) ingots is strongly influenced by the molten metal pool profile. Thus, if the pool profile was properly controlled during the melt then defect-free microstructures would be obtained. The recent development of a reduced-order model of VAR solidification allowed the design of a pool depth controller to accomplish this task. The controller used a linear quadratic regulator and a Kalman filter to stabilize the melt pool solidification front under the effect of uncertain process dynamics and noisy measurements. Basic Axisymmetric Remelting (BAR), a high-fidelity VAR ingot model, was used in real time to provide pool depth measurements that were incorporated in the control loop. The controller was tested at Los Alamos National Laboratory in a 21.6 diameter Alloy 718 ingot. Details of the controller design will be presented, along with comparisons to experimentally-measured pool depths.

  19. Multi-Frequency Monitoring of the Flat Spectrum Radio Quasar PKS 1222+216 in 2008–2015

    Directory of Open Access Journals (Sweden)

    Ivan Troitskiy

    2016-11-01

    Full Text Available We analyze the broadband activity of the flat spectrum radio quasar PKS 1222+216 from 2008 to 2015 using multi-frequency monitoring which involves γ-ray data from the Fermi Large Area Telescope, total intensity and linear polarization observations from different optical telescopes in R band, and imaging of the inner jet structure with the Very Long Baseline Array (VLBA at 43 GHz. During the observations, the source showed several dramatic flares at γ rays and optical bands, with the rising branch of a γ-ray flare accompanied by a rapid rotation of the polarization position angle (EVPA, a fast increase of the degree of polarization in the optical band, brightening of the VLBI core, and appearance of a new superluminal component in the parsec-scale jet. The rapid variability of the optical linear polarization may be explained by a strong turbulence in the jet plasma. We find a correlation between the γ rays, optical R band, and 43 GHz variability on a long-term scale (months and years, and a good general alignment between EVPAs in R band and at 43 GHz, while the correlation between short-term variations (days and weeks is weaker. Synchronous activity across the bands supports the idea that the emission regions responsible for the γ-ray and optical flares are co-spatial and located in the vicinity of the mm-wave core of the parsec-scale jet. However, these connections do not completely explain the challenging behaviour of PKS 1222+216, since there are some γ-ray flares which are not accompanied by jet events, and vice versa. We need a continuation of multi-frequency monitoring along with high resolution imaging of the parsec-scale jet to understand in detail the origin of high energy emission in blazars.

  20. 48 CFR 52.216-29 - Time-and-Materials/Labor-Hour Proposal Requirements-Non-Commercial Item Acquisition With Adequate...

    Science.gov (United States)

    2010-10-01

    ...-Hour Proposal Requirements-Non-Commercial Item Acquisition With Adequate Price Competition. 52.216-29... Proposal Requirements—Non-Commercial Item Acquisition With Adequate Price Competition (FEB 2007) (a) The... Time-and-Materials/Labor-Hour Proposal Requirements—Non-Commercial Item Acquisition With Adequate Price...

  1. 48 CFR 252.216-7002 - Alternate A, Time-and-Materials/Labor-Hour Proposal Requirements-Non-Commercial Item Acquisition...

    Science.gov (United States)

    2010-10-01

    ...-Materials/Labor-Hour Proposal Requirements-Non-Commercial Item Acquisition With Adequate Price Competition... Requirements—Non-Commercial Item Acquisition With Adequate Price Competition. As prescribed in 216.601(e...-and-Materials/Labor-Hour Proposal Requirements—Non-Commercial Item Acquisition With Adequate Price...

  2. One Day Every 216 Years, Three Days Each Decan. Rebirth Cycle of Pythagoras, Phoenix, Hazon Gabriel, and Christian Dogma of Resurrection Can Be Explained by the Metonic Cycle

    Science.gov (United States)

    Rothwangl, S.

    2009-08-01

    This article explains how the Metonic cycle is at the base of the period of 216 years Pythagoras believed in being reborn after that period. It shows how this period calendrically is related to other mythological worldviews such as the Phoenix myth, the Hebrean Hazon Gabriel, and the Christian dogma of resurrection on the third day.

  3. 7 CFR 1.216 - Appearance as a witness or production of documents on behalf of a party other than the United...

    Science.gov (United States)

    2010-01-01

    ... Witnesses in Judicial or Administrative Proceedings § 1.216 Appearance as a witness or production of... employee of USDA served with a valid summons, subpoena, or other compulsory process demanding his or her... States in a judicial or administrative proceeding in which the United States is a party, shall promptly...

  4. Gpn3 is polyubiquitinated on lysine 216 and degraded by the proteasome in the cell nucleus in a Gpn1-inhibitable manner.

    Science.gov (United States)

    Méndez-Hernández, Lucía E; Robledo-Rivera, Angelica Y; Macías-Silva, Marina; Calera, Mónica R; Sánchez-Olea, Roberto

    2017-11-01

    Gpn1 associates with Gpn3, and both are required for RNA polymerase II nuclear targeting. Global studies have identified by mass spectrometry that human Gpn3 is ubiquitinated on lysines 189 and 216. Our goals here were to determine the type, physiological importance, and regulation of Gpn3 ubiquitination. After inhibiting the proteasome with MG132, Gpn3-Flag was polyubiquitinated on K216, but not K189, in HEK293T cells. Gpn3-Flag exhibited nucleo-cytoplasmic shuttling, but polyubiquitination and proteasomal degradation of Gpn3-Flag occurred only in the cell nucleus. Polyubiquitination-deficient Gpn3-Flag K216R displayed a longer half-life than Gpn3-Flag in two cell lines. Interestingly, Gpn1-EYFP inhibited Gpn3-Flag polyubiquitination in a dose-dependent manner. In conclusion, Gpn1-inhibitable, nuclear polyubiquitination on lysine 216 regulates the half-life of Gpn3 by tagging it for proteasomal degradation. © 2017 Federation of European Biochemical Societies.

  5. Testing of a uranium downhole logging system to measure in-situ plutonium concentrations in sediments. [216-Z-1A crib

    Energy Technology Data Exchange (ETDEWEB)

    Kasper, R.B.; Kay, M.A.; Bruns, L.E.; Stokes, J.A.; Steinman, D.K.; Adams, J.

    1980-11-01

    A prototype urainium borehole logging system, developed for uranium exploration, was modified for Pu assay and testing at the site. It uses the delayed fission neutron (DFN) method. It was tested in a retired Pu facility, the 216-Z-1A Crib. General agreement between laboratory determined Pu concentrations in sediment samples and neutron flux measurements was found for the relative distribution with depth.

  6. Phase II study of oral platinum drug JM216 as first-line treatment in patients with small-cell long cancer

    NARCIS (Netherlands)

    Fokkema, E; Groen, HJM; Uges, DRA; Weil, C; Smith, IE

    1999-01-01

    Purpose: This multicenter phase II trial wets performed to determine tumor efficacy and tolerance of the oral platinum drug JM216 in patients with small-cell lung cancer (SCLC). Patients and Methods: patients with SCLC limited disease unfit for intensive chemotherapy or those with extensive disease

  7. Influence of intermartensitic transitions on transport properties of Ni$_{2.16}Mn_{0.84}$Ga alloy

    CERN Document Server

    Khovailo, V V; Wedel, C; Takagi, T; Abe, T; Sugiyama, K

    2004-01-01

    Magnetic, transport, and x-ray diffraction measurements of ferromagnetic shape memory alloy Ni$_{2.16}$Mn$_{0.84}$Ga revealed that this alloy undergoes an intermartensitic transition upon cooling, whereas no such a transition is observed upon subsequent heating. The difference in the modulation of the martensite forming upon cooling from the high-temperature austenitic state [5-layered (5M) martensite], and the martensite forming upon the intermartensitic transition [7-layered (7M) martensite] strongly affects the magnetic and transport properties of the alloy and results in a large thermal hysteresis of the resistivity $\\rho$ and magnetization $M$. The intermartensitic transition has an especially marked influence on the transport properties, as is evident from a large difference in the resistivity of the 5M and 7M martensite, $(\\rho_{\\mathrm{5M}} - \\rho_{\\mathrm{7M}})/\\rho _{\\mathrm{5M}} \\approx 15%$, which is larger than the jump of resistivity at the martensitic transition from the cubic austenitic phase ...

  8. Advanced Hodgkin's lymphoma: results in 216 patients treated with ABVD in Brazil Linfoma de Hodgkin em estádio avançado: resultados do tratamento em 216 pacientes tratados com ABVD no Brasil

    Directory of Open Access Journals (Sweden)

    Luciana Britto

    2010-01-01

    Full Text Available The outcome of Hodgkin's lymphoma (HL has markedly improved over the last few decades, placing HL among the human cancers with highest cure rates. However, data about treatment outcomes in developing countries are scarce. From 1996 to 2005, 370 consecutive patients with HL treated in three public institutions in Rio de Janeiro were identified. A total of 216 patients who presented with advanced stage (IIB-IV HL were selected for the present analysis. Patients with advanced disease were treated with ABVD, complemented or not by radiation therapy. The median follow-up time of survivors was 6.3 years (1-11.8. Fifteen patients died during first-line treatment. The complete remission rate was 80%. The 5-year progression-free survival (PFS and the 5-year overall survival (OS probabilities were 69% and 83%, respectively. The 5-year PFS in low-risk and high-risk patients were 81% and 62% (p=0.003, respectively. The 5-year OS in low-risk and high-risk International Prognostic Score patients were 89% and 78% (p=0.02, respectively. The present study provides a representative estimate of current treatment results for advanced HL in public institutions in an urban area in Brazil. It is clear that full treatment can be given to most patients, although those with very low socio-economic status might require special attention and support. Since Brazil is a large country, with substantial interregional heterogeneity, a nationwide registry of HL patients is currently being implemented.Os resultados do tratamento do linfoma de Hodgkin (LH melhoraram substancialmente ao longo das últimas décadas e tornaram o LH uma das neoplasias humanas com maior chance de cura. Entretanto, os dados sobre tratamento em países em desenvolvimento são escassos. Entre 1996 e 2005, 370 pacientes consecutivos com LH tratados em três instituições públicas no Rio de Janeiro foram identificados. Destes, 216 em estádio avançado (IIB-IV foram selecionados para esta análise. Os

  9. Regulation of UGT2B Expression and Activity by miR-216b-5p in Liver Cancer Cell Lines

    OpenAIRE

    Dluzen, Douglas F.; Sutliff, Aimee K.; Chen, Gang; Watson, Christy J. W.; Ishmael, Faoud T.; Lazarus, Philip

    2016-01-01

    The UDP-glucuronosyltransferase (UGT) 2B enzymes are important in the detoxification of a variety of endogenous and exogenous compounds, including many hormones, drugs, and carcinogens. Identifying novel mechanisms governing their expression is important in understanding patient-specific response to drugs and cancer risk factors. In silico prediction algorithm programs were used to screen for microRNAs (miRNAs) as potential regulators of UGT2B enzymes, with miR-216b-5p identified as a potenti...

  10. An Investigation of Comet Hale-Bopp at 21.6 and 27.2 AU from the Sun

    Science.gov (United States)

    Kramer, Emily A.; Fernandez, Y. R.; Kelley, M. S.; Woodney, L. M.; Lisse, C. M.

    2010-05-01

    Comet Hale-Bopp offered us an unprecedented opportunity to observe a large, bright comet in great detail. Since its 1997 perihelion, continued observations have let us observe how its activity has changed over time. Here we present 2005 and 2008 Spitzer Space Telescope observations of Hale-Bopp that show coma and tail, which is uncommon given its heliocentric distance -- 21.6 AU in 2005 and 27.2 AU in 2008. We have images at 24 µm (obtained with MIPS, the Multiband Imaging Photometer for Spitzer) that show thermal emission from the dust, and we are using dynamical models [1,2] to explain the dust morphology and constrain the dust's properties. Preliminary work suggests that the motion of the dust cannot be solely due to the effects of gravity and radiation pressure, which generally are the dominant forces. We investigate the role of other possible driving forces such as the so-called rocket force [3]. Our science goals are to: understand the comet's activity mechanism, constrain the age of the dust, find the size of the grains, and compare properties of the dust we see now to those of the dust seen in the 1990s. Our overarching goal is to use Hale-Bopp and other distant, active comets to understand cometary activity and the structure of cometary nuclei, which is related to icy planetesimal formation and evolution. We acknowledge support from the NSF, NASA and the Spitzer Science Center for this work. References: [1] Kelley, M.S., et al. 2008, Icarus 193, 572, [2] Lisse, C.M., et al. 1998, ApJ 496, 971, [3] Reach, W.T., et al. 2009, Icarus 203, 571.

  11. Eclampsia a 5 years retrospective review of 216 cases managed in two teaching hospitals in Addis Ababa.

    Science.gov (United States)

    Abate, Misganaw; Lakew, Zufan

    2006-01-01

    to measure the magnitude of eclampsia and its maternal and perinatal outcome. A 5 years retrospective descriptive study was conducted on 216 eclamptic cases diagnosed, admitted and managed from October 1994 to September 1999 in the two teaching hospitals of Addis Ababa; namely Tikur Anbessa and St Paul's Hospitals. There were 257 mothers with eclampsia treated in the given period and 35741 deliveries making the incidence of eclampsia 7.1/1000 deliveries. Eighty-four women (38.9%) had any antenatal care, 157 (72.7%) were nulli-parous and 69 (31.8%) were aged below 20. Convulsion occurred ante-partum in 133 (61.6%), intrapartum in 49 (22.7%) and postpartum in 34 (15.7%) mothers. The most frequently sited symptoms before convulsion include headache in 83.8%, visual disturbance in 41.6% and epigastric pain in 38.4% of the cases. Ninety nine (45.8%) women were delivered by cesarean section making the cesarean section rate among eclamptic mothers significantly higher than the rate among the general population, which was 16.6% at the same period. (P = 0.0001). The multiple pregnancy rate was 5.7%, which was significantly higher than the rate among the general population of 1.5% at the same time. Seventy-four mothers had repeated convulsion after admission to the hospitals and initiation of the standard treatment. Twenty-eight mothers with eclampsia died making the case fatality rate 13%. Seven mothers (3.2%) died before delivery. Forty-four Stillbirths and twenty-five early neonatal deaths occurred making the perinatal mortality rate 312.2/1000 deliveries. Eclampsia is a common complication still associated with high level of maternal and perinatal mortality as well as morbidity. ANC coverage should be strengthened to detect preclampsia, and prevent eclampsia. Management in the hospital should be optimized to prevent recurrent convulsions and complications after admission.

  12. Regular in situ measurements of HDO/H216O in the northern and southern hemispherical upper troposphere reveal tropospheric transport processes.

    Science.gov (United States)

    Christner, Emanuel; Dyroff, Christoph; Sanati, Shahrokh; Brenninkmeijer, Carl; Zahn, Andreas

    2013-04-01

    Atmospheric water in form of water vapor and clouds is an enormously crucial trace species. It is responsible for ~70 % of the natural greenhouse effect (Schmidt et al., JGR, 2010), carries huge amounts of latent heat, and is the major source of OH in the troposphere. The isotopic composition of water vapor is an elegant tracer for a better understanding and quantification of the extremely complex and variable hydrological cycle in Earth's atmosphere (evaporation, cloud condensation, rainout, re-evaporation, snow), which in turn is a prerequisite to improve climate modeling and predictions. In this context, water-isotopologues (here the isotope ratio HDO/H216O) can be used to study the atmospheric transport of water and in-cloud processes. As H216O and HDO differ in vapor pressure and molecular diffusion, fractionation occurs during condensation and rainout events. For that reason the ratio HDO/H216O preserves information about the transport and condensation history of an air mass. The tunable diode-laser absorption spectrometer ISOWAT was developed for airborne measurements of the water-isotopologue concentrations of H216O and HDO, probing fundamental rovibrational water-absorption lines at around 2.66 μm. Since April 2010 the spectrometer is regularly operated aboard the CARIBIC passenger aircraft (Civil Aircraft for the Regular Investigation of the atmosphere Based on an Instrument Container - Lufthansa, Airbus 340-600), which measures ~100 trace gases and aerosol components in the UTLS (9-12 km altitude) on four long-distance flights per month. During several flights across the equator (Africa) or close to the equator (Venezuela and Malaysia) an increase of HDO/H216O from the subtropics towards the tropics was measured (by more than 100 permil) at an altitude of ~12 km. This isotopic gradient can partly be attributed to differences in humidity. In addition there is a humidity independent latitudinal gradient (by more than 50 permil), revealing the strong

  13. Agreement between diagnoses reached by clinical examination and available reference standards: a prospective study of 216 patients with lumbopelvic pain

    Directory of Open Access Journals (Sweden)

    Tropp Hans

    2005-06-01

    Full Text Available Abstract Background The tissue origin of low back pain (LBP or referred lower extremity symptoms (LES may be identified in about 70% of cases using advanced imaging, discography and facet or sacroiliac joint blocks. These techniques are invasive and availability varies. A clinical examination is non-invasive and widely available but its validity is questioned. Diagnostic studies usually examine single tests in relation to single reference standards, yet in clinical practice, clinicians use multiple tests and select from a range of possible diagnoses. There is a need for studies that evaluate the diagnostic performance of clinical diagnoses against available reference standards. Methods We compared blinded clinical diagnoses with diagnoses based on available reference standards for known causes of LBP or LES such as discography, facet, sacroiliac or hip joint blocks, epidurals injections, advanced imaging studies or any combination of these tests. A prospective, blinded validity design was employed. Physiotherapists examined consecutive patients with chronic lumbopelvic pain and/or referred LES scheduled to receive the reference standard examinations. When diagnoses were in complete agreement regardless of complexity, "exact" agreement was recorded. When the clinical diagnosis was included within the reference standard diagnoses, "clinical agreement" was recorded. The proportional chance criterion (PCC statistic was used to estimate agreement on multiple diagnostic possibilities because it accounts for the prevalence of individual categories in the sample. The kappa statistic was used to estimate agreement on six pathoanatomic diagnoses. Results In a sample of chronic LBP patients (n = 216 with high levels of disability and distress, 67% received a patho-anatomic diagnosis based on available reference standards, and 10% had more than one tissue origin of pain identified. For 27 diagnostic categories and combinations, chance clinical agreement

  14. The effect of internal and external stress on two-way shape-memory behaviour in Co49Ni21.6Ga29.4 single crystals

    International Nuclear Information System (INIS)

    Liu, G D; Dai, X F; Luo, H Z; Liu, H Y; Meng, F B; Li, Y; Yu, X; Chen, J L; Wu, G H

    2011-01-01

    The effect of the internal stress on the two-way shape memory in Co 49 Ni 21.6 Ga 29.4 single crystals has been investigated. We found that the internal stress generated natively by the solidifying process works as a tensile force along the growth direction. Applying different compressive pre-stresses along the [0 0 1] direction, the shape-memory strain can be continuously changed from +1.0% to -2.3%. In the [1 1 0] direction, the strain monotonically increases from -2.0% to -4.0% due to a strong detwinning produced by the consistent effect of the external and internal stresses.

  15. 200-BP-11 operable unit and 216-B-3 main pond work/closure plan, Hanford Site, Richland, Washington. Volume 1: Field investigation and sampling strategy

    International Nuclear Information System (INIS)

    1994-09-01

    This document coordinates a Resource Conservation and Recovery Act (RCRA) past-practice work plan for the 200-BP-11 Operable Unit and a RCRA closure/postclosure plan for the 216-B-3 Main Pond and 216-B-3-3 Ditch [treatment, storage, and/or disposal (TSD) unit]. Both RCRA TSD and past-practice waste management units are contained within the 200-BP-11 Operable Unit. The 200-BP-11 Operable Unit is a source operable unit located on the east side of the B Plant Source Aggregate Area in the 200 East Area of the Hanford Site. The operable unit lies just east of the 200 East Area perimeter fence and encompass approximately 476 hectares (1,175 acres). Source operable units include waste management units that are potential sources of radioactive and/or hazardous substance contamination. Source waste management units are categorized in the Hanford Federal Facility Agreement and Consent Order as either RCRA TSD, RCRA past-practice, or Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) past-practice. As listed below and in the Tri-Party Agreement, the 200-BP-11 Operable Unit contains five RCRA past-practice and five RCRA TSD waste management units. Additionally, for RCRA TSD permitting purposes, the RCRA TSD waste management units are subdivided into two RCRA TSD units

  16. Examining the nature of very-high-energy gamma-ray emission from the AGN PKS 1222+216 and 3C 279

    Science.gov (United States)

    Price, Sharleen; Brill, Ari; Mukherjee, Reshmi; VERITAS

    2018-01-01

    Blazars are a type of active galactic nuclei (AGN) that emit jets of ionized matter which move towards the Earth at relativistic speeds. In this research we carried out a study of two objects, 3C 279 and PKS 1222+216, which belong to the subset of blazars known as FSRQs (flat spectrum radio quasars), the most powerful TeV-detected sources at gamma-ray energies with bolometric luminosities exceeding 1048 erg/s. The high-energy emission of quasars peaks in the MeV-GeV band, making these sources very rarely detectable in the TeV energy range. In fact, only six FSRQs have ever been detected in this range by very-high-energy gamma-ray telescopes. We will present results from observing campaigns on 3C 279 in 2014 and 2016, when the object was detected in high flux states by Fermi-LAT. Observations include simultaneous coverage with the Fermi-LAT satellite and the VERITAS ground-based array spanning four decades in energy from 100 MeV to 1 TeV. We will also report VERITAS observations of PKS 1222+216 between 2008 and 2017. The detection/non-detection of TeV emission during flaring episodes at MeV energies will further contribute to our understanding of particle acceleration and gamma-ray emission mechanisms in blazar jets.

  17. Characterization of Vadose Zone Sediment: Borehole C3103 Located in the 216-B-7A Crib Near the B Tank Farm

    Energy Technology Data Exchange (ETDEWEB)

    Lindenmeier, Clark W.; Serne, R JEFFREY.; Bjornstad, Bruce N.; Last, George V.; Lanigan, David C.; Lindberg, Michael J.; Clayton, Ray E.; Legore, Virginia L.; Kutnyakov, Igor V.; Baum, Steven R.; Geiszler, Keith N.; Valenta, Michelle M.; Vickerman, Tanya S.

    2002-12-01

    This report summarizes data collected from samples in borehole C3103. Borehole C3103 was completed to further characterize the nature and extent of vadose zone contaminants supplied by intentional liquid discharges into the crib 216-B7A/7B between 1954 and 1967. These cribs received dilute waste streams from the bismuth phosphate fuel reprocessing program in the 1950's and decontamination waste in the 1960's. Elevated concentrations of several constituents were primarily measured at different depth intervals. The primary radionuclides present in this borehole are cesium-137 and uranium near the top of the borehole. Chemical characteristics attributed to wastewater-soil interaction at different locations within this zone are elevated pH, sodium, fluoride, carbonate nitrate, and sulphate

  18. Line Intensity Measurements in 14N 216O and Their Treatment Using the Effective Dipole Moment Approach . I. The 4300- to 5200-cm -1 Region

    Science.gov (United States)

    Daumont, L.; Auwera, J. Vander; Teffo, J.-L.; Perevalov, V. I.; Tashkun, S. A.

    2001-08-01

    This work continues a series of publications devoted to the application of the effective operator approach to the vibrational-rotational treatment of linear triatomic molecules, aiming at the analysis and prediction of their infrared spectra. In that frame work, we have started a large-scale work aiming at the global description of line intensities of cold and hot bands of 14N216O in its ground electronic state in the spectral range above 3600 cm-1. In 14N216O, vibrational interacting levels group in polyads as a result of the relation 2ω1≈4ω2≈ω3 existing between the harmonic frequencies. The polyads are identified by the so-called polyad number P=2V1+V2+4V3. The work described in the present paper concerns bands associated with transitions corresponding to ΔP=7, 8, and 9. The absorption spectra of N2O at room temperature have been recorded at a resolution of 0.007 cm-1 in the range from 4300 to 5200 cm-1 using a Bruker IFS120HR Fourier transform spectrometer. Sample pressure/absorption path length products ranging from 7 to 1753 mbar × m have been used. More than 3000 absolute line intensities have been measured in 66 different bands belonging to the ΔP=7, 8, and 9 series. Dicke narrowing has been observed in the high-pressure spectra. Using wavefunctions previously determined from a global fit of an effective Hamiltonian to about 18,000 line positions (S. A. Tashkun, V. I. Perevalov, and J.-L. Teffo to be published), the experimental intensities measured in this work and by R. A. Toth (J. Mol. Spectrosc.197, 158-187 (1999)) were fitted to 47 parameters of a corresponding effective dipole moment, with residuals very close to the experimental uncertainty. Exa mples are given showing that the modeling reproduces intensities of perturbed lines well.

  19. Kinetic alteration of a human dihydrodiol/3alpha-hydroxysteroid dehydrogenase isoenzyme, AKR1C4, by replacement of histidine-216 with tyrosine or phenylalanine.

    Science.gov (United States)

    Ohta, T; Ishikura, S; Shintani, S; Usami, N; Hara, A

    2000-01-01

    Human dihydrodiol dehydrogenase with 3alpha-hydroxysteroid dehydrogenase activity exists in four forms (AKR1C1-1C4) that belong to the aldo-keto reductase (AKR) family. Recent crystallographic studies on the other proteins in this family have indicated a role for a tyrosine residue (corresponding to position 216 in these isoenzymes) in stacking the nicotinamide ring of the coenzyme. This tyrosine residue is conserved in most AKR family members including AKR1C1-1C3, but is replaced with histidine in AKR1C4 and phenylalanine in some AKR members. In the present study we prepared mutant enzymes of AKR1C4 in which His-216 was replaced with tyrosine or phenylalanine. The two mutations decreased 3-fold the K(m) for NADP(+) and differently influenced the K(m) and k(cat) for substrates depending on their structures. The kinetic constants for bile acids with a 12alpha-hydroxy group were decreased 1.5-7-fold and those for the other substrates were increased 1.3-9-fold. The mutation also yielded different changes in sensitivity to competitive inhibitors such as hexoestrol analogues, 17beta-oestradiol, phenolphthalein and flufenamic acid and 3,5,3', 5'-tetraiodothyropropionic acid analogues. Furthermore, the mutation decreased the stimulatory effects of the enzyme activity by sulphobromophthalein, clofibric acid and thyroxine, which increased the K(m) for the coenzyme and substrate of the mutant enzymes more highly than those of the wild-type enzyme. These results indicate the importance of this histidine residue in creating the cavity of the substrate-binding site of AKR1C4 through the orientation of the nicotinamide ring of the coenzyme, as well as its involvement in the conformational change by binding non-essential activators. PMID:11104674

  20. Overexpression of CDC25B, CDC25C and phospho-CDC25C (Ser216 in vulvar squamous cell carcinomas are associated with malignant features and aggressive cancer phenotypes

    Directory of Open Access Journals (Sweden)

    Flørenes Vivi

    2010-05-01

    Full Text Available Abstract Background CDC25 phosphatases are important regulators of the cell cycle. Their abnormal expression detected in a number of tumors implies that their dysregulation is involved in malignant transformation. However, the role of CDC25s in vulvar cancer is still unknown. To shed light on their roles in the pathogenesis and to clarify their prognostic values, expression of CDC25A, CDC25B and CDC25C in a large series of vulvar squamous cell carcinomas were examined. Methods Expression of CDC25A, CDC25B, CDC25C and phosphorylated (phospho-CDC25C (Ser216 were examined in 300 vulvar carcinomas using immunohistochemistry. Western blot analysis was utilized to demonstrate CDC25s expression in vulvar cancer cell lines. Kinase and phosphatase assays were performed to exclude cross reactivity among CDC25s isoform antibodies. Results High nuclear CDC25A and CDC25B expression were observed in 51% and 16% of the vulvar carcinomas, respectively, whereas high cytoplasmic CDC25C expression was seen in 63% of the cases. In cytoplasm, nucleus and cytoplasm/nucleus high phospho-CDC25C (Ser216 expression was identified in 50%, 70% and 77% of the carcinomas, respectively. High expression of CDC25s correlated significantly with malignant features, including poor differentiation and infiltration of vessel for CDC25B, high FIGO stage, presence of lymph node metastases, large tumor diameter, poor differentiation for CDC25C and high FIGO stage, large tumor diameter, deep invasion and poor differentiation for phospho-CDC25C (Ser216. In univariate analysis, high expression of phospho-CDC25C (Ser216 was correlated with poor disease-specific survival (p = 0.04. However, such an association was annulled in multivariate analysis. Conclusions Our results suggest that CDC25C and phospho-CDC25C (Ser216 play a crucial role and CDC25B a minor role in the pathogenesis and/or progression of vulvar carcinomas. CDC25B, CDC25C and phospho-CDC25C (Ser216 were associated with

  1. Overexpression of CDC25B, CDC25C and phospho-CDC25C (Ser216) in vulvar squamous cell carcinomas are associated with malignant features and aggressive cancer phenotypes

    International Nuclear Information System (INIS)

    Wang, Zhihui; Trope, Claes G; Flørenes, Vivi Ann; Suo, Zhenhe; Nesland, Jahn M; Holm, Ruth

    2010-01-01

    CDC25 phosphatases are important regulators of the cell cycle. Their abnormal expression detected in a number of tumors implies that their dysregulation is involved in malignant transformation. However, the role of CDC25s in vulvar cancer is still unknown. To shed light on their roles in the pathogenesis and to clarify their prognostic values, expression of CDC25A, CDC25B and CDC25C in a large series of vulvar squamous cell carcinomas were examined. Expression of CDC25A, CDC25B, CDC25C and phosphorylated (phospho)-CDC25C (Ser216) were examined in 300 vulvar carcinomas using immunohistochemistry. Western blot analysis was utilized to demonstrate CDC25s expression in vulvar cancer cell lines. Kinase and phosphatase assays were performed to exclude cross reactivity among CDC25s isoform antibodies. High nuclear CDC25A and CDC25B expression were observed in 51% and 16% of the vulvar carcinomas, respectively, whereas high cytoplasmic CDC25C expression was seen in 63% of the cases. In cytoplasm, nucleus and cytoplasm/nucleus high phospho-CDC25C (Ser216) expression was identified in 50%, 70% and 77% of the carcinomas, respectively. High expression of CDC25s correlated significantly with malignant features, including poor differentiation and infiltration of vessel for CDC25B, high FIGO stage, presence of lymph node metastases, large tumor diameter, poor differentiation for CDC25C and high FIGO stage, large tumor diameter, deep invasion and poor differentiation for phospho-CDC25C (Ser216). In univariate analysis, high expression of phospho-CDC25C (Ser216) was correlated with poor disease-specific survival (p = 0.04). However, such an association was annulled in multivariate analysis. Our results suggest that CDC25C and phospho-CDC25C (Ser216) play a crucial role and CDC25B a minor role in the pathogenesis and/or progression of vulvar carcinomas. CDC25B, CDC25C and phospho-CDC25C (Ser216) were associated with malignant features and aggressive cancer phenotypes. However, the

  2. Tropospheric water vapour isotopologue data (H216O, H218O, and HD16O) as obtained from NDACC/FTIR solar absorption spectra

    Science.gov (United States)

    Barthlott, Sabine; Schneider, Matthias; Hase, Frank; Blumenstock, Thomas; Kiel, Matthäus; Dubravica, Darko; García, Omaira E.; Sepúlveda, Eliezer; Mengistu Tsidu, Gizaw; Takele Kenea, Samuel; Grutter, Michel; Plaza-Medina, Eddy F.; Stremme, Wolfgang; Strong, Kim; Weaver, Dan; Palm, Mathias; Warneke, Thorsten; Notholt, Justus; Mahieu, Emmanuel; Servais, Christian; Jones, Nicholas; Griffith, David W. T.; Smale, Dan; Robinson, John

    2017-01-01

    We report on the ground-based FTIR (Fourier transform infrared) tropospheric water vapour isotopologue remote sensing data that have been recently made available via the database of NDACC (Network for the Detection of Atmospheric Composition Change; MUSICA/" target="_blank">ftp://ftp.cpc.ncep.noaa.gov/ndacc/MUSICA/) and via doi:10.5281/zenodo.48902. Currently, data are available for 12 globally distributed stations. They have been centrally retrieved and quality-filtered in the framework of the MUSICA project (MUlti-platform remote Sensing of Isotopologues for investigating the Cycle of Atmospheric water). We explain particularities of retrieving the water vapour isotopologue state (vertical distribution of H216O, H218O, and HD16O) and reveal the need for a new metadata template for archiving FTIR isotopologue data. We describe the format of different data components and give recommendations for correct data usage. Data are provided as two data types. The first type is best-suited for tropospheric water vapour distribution studies disregarding different isotopologues (comparison with radiosonde data, analyses of water vapour variability and trends, etc.). The second type is needed for analysing moisture pathways by means of H2O, δD-pair distributions.

  3. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  4. Reaction of aromatic diazonium salts with carrier-free radioiodine and astatine, evidence for complex formation

    International Nuclear Information System (INIS)

    Meyer, G.J.; Roessler, K.; Stoecklin, G.

    1979-01-01

    Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects

  5. Astatine-211-labeled biotin conjugates resistant to biotinidase for use in pretargeted radioimmunotherapy

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.

    1998-01-01

    We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At

  6. Microdosimetry of astatine-211 and comparison with that of iodine-125

    International Nuclear Information System (INIS)

    Unak, T.

    2001-01-01

    211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)

  7. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-211 Isolation

    International Nuclear Information System (INIS)

    Wilbur, Daniel Scott

    2016-01-01

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  8. The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer

    International Nuclear Information System (INIS)

    Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine

    2008-01-01

    We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)

  9. Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)

    2016-08-15

    Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.

  10. Targeted radionuclide therapy with astatine-211: Oxidative dehalogenation of astatobenzoate conjugates.

    Science.gov (United States)

    Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles

    2017-05-31

    211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.

  11. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  12. Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene

    International Nuclear Information System (INIS)

    Kolachkovski, A.; Khalkin, V.A.

    1976-01-01

    Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh

  13. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy

    International Nuclear Information System (INIS)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-01-01

    Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.

  14. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy.

    Science.gov (United States)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-11-01

    Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.

  15. Perfusion pattern and time of vascularisation with CEUS increase accuracy in differentiating between benign and malignant tumours in 216 musculoskeletal soft tissue masses

    Energy Technology Data Exchange (ETDEWEB)

    De Marchi, Armanda, E-mail: armanda.demarchi@tiscali.it [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Prever, Elena Brach del, E-mail: elena.brach@unito.it [Department of OrthopaedicOncology and ReconstructiveSurgery, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Cavallo, Franco, E-mail: franco.cavallo@unito.it [Department of Public health and Paediatrics, University of Turin, Via Santena 5-bis, 10126 Torino (Italy); Pozza, Simona, E-mail: simona.pozza@tin.it [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Linari, Alessandra, E-mail: linaralessandra@libero.it [Department of Pathology, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, Regina Margherita Hospital, Piazza Polonia, 10126 Torino (Italy); Lombardo, Paolo, E-mail: pao.lombardo82@gmail.com [Department of DiagnosticImaging and Radiotherapy of the University of Turin, Azienda Ospedaliero-Universitaria Città della Salute e della Scienza di Torino, Via Genova 3, 10126 Torino (Italy); Comandone, Alessandro, E-mail: alessandro.comandone@gradenigo.it [Department of Oncology, Gradenigo Hospital, Corso Regina Margherita, 8/10.10153 Torino (Italy); Piana, Raimondo, E-mail: raimondo.piana@libero.it [Department of OrthopaedicOncology and ReconstructiveSurgery, Azienda Ospedaliero Universitaria Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy); Faletti, Carlo [Department of Imaging, Azienda Ospedaliera Città della Salute e della Scienza, CTO Hospital, Via Zuretti 29, 10126 Torino (Italy)

    2015-01-15

    Introduction: Musculoskeletal Soft Tissue Tumours (STT) are frequent heterogeneous lesions. Guidelines consider a mass larger than 5 cm and deep with respect to the deep fascia potentially malignant. Contrast Enhanced Ultrasound (CEUS) can detect both vascularity and tumour neoangiogenesis. We hypothesised that perfusion patterns and vascularisation time could improve the accuracy of CEUS in discriminating malignant tumours from benign lesions. Materials and methods: 216 STT were studied: 40% benign lesions, 60% malignant tumours, 56% in the lower limbs. Seven CEUS perfusion patterns and three types of vascularisation (arterial-venous uptake, absence of uptake) were applied. Accuracy was evaluated by comparing imaging with the histological diagnosis. Univariate and multivariate analysis, Chi-square test and t-test for independent variables were applied; significance was set at p < 0.05 level, 95% computed CI. Results: CEUS pattern 6 (inhomogeneous perfusion), arterial uptake and location in the lower limb were associated with high risk of malignancy. CEUS pattern has PPV 77%, rapidity of vascularisation PPV 69%; location in the limbs is the most sensitive indicator, but NPV 52%, PPV 65%. The combination of CEUS-pattern and vascularisation has 74% PPV, 60% NPV, 70% sensitivity. No correlation with size and location in relation to the deep fascia was found. Conclusion: US with CEUS qualitative analysis could be an accurate technique to identify potentially malignant STT, for which second line imaging and biopsy are indicated in Referral Centers. Intense inhomogeneous enhancement with avascular areas and rapid vascularisation time could be useful in discriminating benign from malignant SST, overall when the lower limbs are involved.

  16. Produção de brotos de soja utilizando a cultivar BRS 216: caracterização físico-química e teste de aceitabilidade Production of soybean sprouts from the cultivar BRS 216: physical and chemical characterization and acceptability test

    Directory of Open Access Journals (Sweden)

    Marcelo Alvares de Oliveira

    2013-03-01

    Full Text Available O presente trabalho teve por objetivo avaliar os parâmetros físico-químicos e os processos para a produção de brotos de soja a partir de sementes da cultivar BRS 216, bem como sua composição química e aceitabilidade. Foram avaliados o comprimento e o peso dos brotos viáveis, a composição centesimal e os teores de isoflavonas e de inibidor de tripsina. O desenho experimental foi ao acaso com três repetições e os tratamentos foram avaliados num esquema fatorial 3 × 3: três frequências de irrigação (a cada quatro, oito e 12 horas e três períodos de crescimento (cinco, seis e sete dias. O teste de aceitabilidade dos brotos de soja foi realizado utilizando-se a escala hedônica estruturada de nove pontos, avaliando-se cor, aparência, odor, textura, sabor e avaliação global, além da intenção de compra. A frequência de irrigação com intervalos de quatro horas e o período de sete dias de crescimento foram ideais para produção dos brotos de soja, favorecendo maior produtividade, teores mais elevados de proteínas e menores teores de inibidor de tripsina. O índice de aceitabilidade dos brotos de soja foi superior a 70 em todas as características avaliadas, com exceção do odor.The aim of the present study was to evaluate the physical and chemical parameters and process for the production of soybean sprouts from the BRS 216 cultivar, as well as determining their chemical composition and acceptability. The length and weight of viable sprouts, proximate composition, and the isoflavone and trypsin inhibitor contents were evaluated. The experimental design was completely randomized with three replications, and the treatments were evaluated using a 3 × 3 factorial design: three irrigation frequencies (four, eight and 12 hours and three growth periods (five, six and seven days. The soybean sprout acceptability was determined using a nine point structured hedonic scale, evaluating colour, appearance, aroma, texture, flavour

  17. Wind Tunnel Tests of Ailerons at Various Speeds I : Ailerons of 0.20 Airfoil Chord and True Contour with 0.35 Aileron-chord Extreme Blunt Nose Balance on the NACA 66,2-216 Airfoil

    Science.gov (United States)

    Letko, W; Denaci, H. G.; Freed, C

    1943-01-01

    Hinge-moment, lift, and pressure-distribution measurements were made in the two-dimensional test section of the NACA stability tunnel on a blunt-nose balance-type aileron on an NACA 66,2-216 airfoil at speeds up to 360 miles per hour corresponding to a Mach number of 0.475. The tests were made primarily to determine the effect of speed on the action of this type of aileron. The balance-nose radii of the aileron were varied from 0 to 0.02 of the airfoil chord and the gap width was varied from 0.0005 to 0.0107 of the airfoil chord. Tests were also made with the gap sealed.

  18. The Big-Wheel TGC-1 being moved against the Barrel Muon Spectrometer. The 216 trigger chambers are supported by a thin structure of 22 m diameter and 0.4 m thickness, weighting 44 tons and supported on two rails.

    CERN Multimedia

    Claudia Marcelloni

    2006-01-01

    The Big-Wheel TGC-1 being moved against the Barrel Muon Spectrometer. The 216 trigger chambers are supported by a thin structure of 22 m diameter and 0.4 m thickness, weighting 44 tons and supported on two rails.

  19. 211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds

    OpenAIRE

    Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,

    2016-01-01

    International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...

  20. Preparation and biological evaluation of an astatine-211 labeled biotin conjugate: Biotinyl-3-[211At]astatoanilide

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.

    1997-01-01

    Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers

  1. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  2. THE FIRST Hi-GAL OBSERVATIONS OF THE OUTER GALAXY: A LOOK AT STAR FORMATION IN THE THIRD GALACTIC QUADRANT IN THE LONGITUDE RANGE 216. Degree-Sign 5 {approx}< l {approx}< 225. Degree-Sign 5

    Energy Technology Data Exchange (ETDEWEB)

    Elia, D.; Molinari, S.; Schisano, E.; Pestalozzi, M.; Benedettini, M.; Di Giorgio, A. M.; Pezzuto, S.; Rygl, K. L. J. [Istituto di Astrofisica e Planetologia Spaziali-INAF, Via Fosso del Cavaliere 100, I-00133 Roma (Italy); Fukui, Y.; Hayakawa, T.; Yamamoto, H. [Department of Physics, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8602 (Japan); Olmi, L. [Osservatorio Astrofisico di Arcetri-INAF, Largo E. Fermi 5, I-50125 Firenze (Italy); Veneziani, M. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Schneider, N.; Piazzo, L. [IRFU/SAp CEA/DSM, Laboratoire AIM CNRS, Universit Paris Diderot, F-91191 Gif-sur-Yvette (France); Ikhenaode, D. [DIET-Dipartimento di Ingegneria dell' Informazione, Elettronica e Telecomunicazioni, Universita di Roma La Sapienza, via Eudossina 18, I-00184 Roma (Italy); Mizuno, A. [Solar-Terrestrial Environment Laboratory, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8601 (Japan); Onishi, T. [Department of Physical Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan); Polychroni, D. [Department of Astrophysics, Astronomy and Mechanics, Faculty of Physics, University of Athens, Panepistimiopolis, 15784 Zografos, Athens (Greece); Maruccia, Y., E-mail: davide.elia@iaps.inaf.it [Dipartimento di Matematica e Fisica, Universita del Salento, CP 193, I-73100 Lecce (Italy)

    2013-07-20

    We present the first Herschel PACS and SPIRE photometric observations in a portion of the outer Galaxy (216. Degree-Sign 5 {approx}< l {approx}< 225. Degree-Sign 5 and -2 Degree-Sign {approx}< b {approx}< 0 Degree-Sign ) as a part of the Hi-GAL survey. The maps between 70 and 500 {mu}m, the derived column density and temperature maps, and the compact source catalog are presented. NANTEN CO(1-0) line observations are used to derive cloud kinematics and distances so that we can estimate distance-dependent physical parameters of the compact sources (cores and clumps) having a reliable spectral energy distribution that we separate into 255 proto-stellar and 688 starless sources. Both typologies are found in association with all the distance components observed in the field, up to {approx}5.8 kpc, testifying to the presence of star formation beyond the Perseus arm at these longitudes. Selecting the starless gravitationally bound sources, we identify 590 pre-stellar candidates. Several sources of both proto- and pre-stellar nature are found to exceed the minimum requirement for being compatible with massive star formation based on the mass-radius relation. For the pre-stellar sources belonging to the Local arm (d {approx}< 1.5 kpc) we study the mass function whose high-mass end shows a power law N(log M){proportional_to}M {sup -1.0{+-}0.2}. Finally, we use a luminosity versus mass diagram to infer the evolutionary status of the sources, finding that most of the proto-stellar sources are in the early accretion phase (with some cases compatible with a Class I stage), while for pre-stellar sources, in general, accretion has not yet started.

  3. 50 CFR 216.274 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... lookouts can be counted among required lookouts as long as supervisors monitor their progress and... submerged objects). This does not forbid personnel being trained as lookouts from being counted as those... to detect any vocalizing marine mammals (particularly sperm whales) in the vicinity of the exercise...

  4. 23 CFR 646.216 - General procedures.

    Science.gov (United States)

    2010-04-01

    ... the project site or specifically purchased and delivered to the company for use on the project may be... restoring the company's service by adustments of existing facilities away from the project site, in lieu of... protective services during performance of the work, the type of protective services and the method of...

  5. Publications | Page 216 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Born into the Digital Age in the south of Africa: the reconfiguration of the "digital citizen" (restricted access). In the South African context, being a "digital native" is not about age but about experience, and does not apply to a generation but to an elite. At the centre of the digital divide is the issue of access to technology.

  6. 50 CFR 216.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... identify, evaluate, or resolve conservation problems. (2) Research that is not on marine mammals, but that... following: The collection of dead animals, or parts thereof; the restraint or detention of a marine mammal... and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION...

  7. 216 ORGANISATIONA L CHANGE MANAGEMENT AND WORKERS ...

    African Journals Online (AJOL)

    touches deeply at the very heart of the organisational structures and processes. Such a change ... machinery and obsolescence of skills and abilities of workers. However .... This is based on the principle of extinction; behaviour will stop ...

  8. 12 CFR 216.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... the company, as the Board determines. (h) Customer means a consumer who has a customer relationship with you. (i)(1) Customer relationship means a continuing relationship between a consumer and you under... you establish a continuing advisory relationship. (iv) If you hold ownership or servicing rights to an...

  9. 25 CFR 216.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS SURFACE EXPLORATION, MINING, AND RECLAMATION OF... means the superintendent or other officer of the Bureau of Indian Affairs having jurisdiction under delegated authority, over the lands involved. (b) Mining supervisor means the Regional Mining Supervisor, or...

  10. 50 CFR 216.163 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... the Safety Range either due to the animal(s) swimming out of the Safety Range or due to the Safety Range moving beyond the mammal's last verified location. (2) If a North Atlantic right whale or other... must not occur until the animal is positively resighted outside the Safety Range and at least one...

  11. 22 CFR 216.1 - Introduction.

    Science.gov (United States)

    2010-04-01

    ... significantly affecting the environment. (4) Environmental Assessment. A detailed study of the reasonably..., deterioration of the environment and the natural resource base, illiteracy as well as the lack of adequate... the factual basis for a Threshold Decision as to whether an Environmental Assessment or an...

  12. 41 CFR 101-6.216 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... providing education, health care, housing, social services, or parks and recreation; or (ii) The entire...) grants and loans of Federal funds, (2) the grant or donation of Federal property and interests in... other than a casual or transient basis), Federal property or any interest in such property without...

  13. 22 CFR 216.3 - Procedures.

    Science.gov (United States)

    2010-04-01

    ... approval of the PP or PAAD and the method of implementation will include consideration of the Environmental... shall include a separate section evaluating the economic, social and environmental risks and benefits of... Examination does not indicate a potentially unreasonable risk arising from the pesticide use, an Environmental...

  14. 50 CFR 216.23 - Native exceptions.

    Science.gov (United States)

    2010-10-01

    ..., processing, and shipping materials; (iii) A proposal for a system of bookkeeping and/or inventory segregation... subsistence practices of barter and sharing of Cook Inlet beluga parts and products. (ii) Beluga whale calves...

  15. Gender | Page 216 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La ville de Fès est devenue un modèle primé en matière de mise en oeuvre efficace des technologies de l'information et de la communication (TIC) dans les ... they found that together they could break down the barriers and develop new ways to ensure that valuable resources are both protected and equitably shared.

  16. 20 CFR 216.70 - General.

    Science.gov (United States)

    2010-04-01

    ... living employee can establish another individual's eligibility for a spouse annuity or cause an increase... child in care; (b) To establish annuity eligibility for a widow(er), or surviving divorce spouse or...

  17. 22 CFR 216.6 - Environmental assessments.

    Science.gov (United States)

    2010-04-01

    ... developed countries as well as assist in building an indigenous institutional capability to deal nationally... significance; possible conflicts between the proposed action and land use plans, policies and controls for the...

  18. 38 CFR 21.216 - Special equipment.

    Science.gov (United States)

    2010-07-01

    ... enable a veteran to mitigate or overcome the effects of disability in pursuing a rehabilitation program... specifically designed to mitigate or overcome the effects of disability. They range from eyeglasses and hearing aids to closed-circuit TV systems which amplify reading material for veterans with severe visual...

  19. 50 CFR 216.174 - Mitigation.

    Science.gov (United States)

    2010-10-01

    .../are dead), location, time of first discovery, observed behavior (if alive), and photo or video (if... and conditions. (xxx) When marine mammals have been sighted in the area, Navy vessels shall increase...

  20. 50 CFR 216.244 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ..., consistent with the safety of the ship. (xxx) The Navy shall abide by the letter of the “Stranding Response... video (if available). Based on the information provided, NMFS shall determine if, and advise the Navy.../are dead), location, time of first discovery, observed behaviors (if alive), and photo or video (if...

  1. Publications | Page 216 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Explore outputs from more than four decades of IDRC-supported research. Visit the IDRC Digital Library now. ... show that the closer the ethical distance between countries, the greater the trade. Ethics in international trade are important where purchasing, exports, marketing and sales activities are more likely to involve.

  2. 32 CFR 216.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...’ secured its access * * * We do not think that the military recruiter has received equal 'access' [when a... institution of higher education is a discrete (although not necessarily autonomous) organizational entity that...

  3. 32 CFR 216.6 - Information requirements.

    Science.gov (United States)

    2010-07-01

    ...) have been assigned Report Control Symbol DD-P&R-(AR)-2038 in accordance with DoD 8910.1-M 2 . 2 Copies... of) ABC University)] by a policy or practice of the school. Specifically, military recruiting...-recruiting information refers to a student's name, address, telephone listing, age (or year of birth), level...

  4. 22 CFR 216.4 - Private applicants.

    Science.gov (United States)

    2010-04-01

    ..., projects or activities for which financing from A.I.D. is sought by private applicants, such as PVOs and...) or (d), preliminary proposals for financing submitted by private applicants shall be accompanied by... Environmental Examination. The Threshold Decision shall be made by the Mission Director for the country to which...

  5. 40 CFR 21.6 - Exclusions.

    Science.gov (United States)

    2010-07-01

    .... Applications for statements involving financial assistance in meeting user cost or fee schedules related to... authority under the Act. (2) Cost recovery and user charges. Applications for statements involving a request... to such areas of cost. (7) Evidence of financial responsibility. Applications for statements...

  6. Publications | Page 216 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    restricted access). The Pan Asia Networking (PAN) localization project has been developing sustainable human capacity for R&D in local language computing and technological support for Asian Languages. Representatives of the project have ...

  7. 32 CFR 216.2 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... service in the Department of Homeland Security. The policies herein also affect the Departments of... and Health Review Commission, the National Commission on Libraries and Information Science, the...

  8. Near-UV and blue wavelength excitable Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} high efficiency red phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Khanna, A. [Smart Lighting Engineering Research Center, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Electrical Computer and Systems Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Dutta, P.S., E-mail: duttap@rpi.edu [Smart Lighting Engineering Research Center, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Electrical Computer and Systems Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States)

    2015-05-15

    Red phosphors with narrow emission around 615 nm (with FWHM~5–10 nm) having chemical compositions of A{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} (A=Mg, Sr) have been found to exhibit the highest luminescence amongst the molybdate–tungstate family when excited by sources in the 380–420 nm wavelength range. Thus they are most suitable for enhancing color rendering index and lowering color temperature in phosphor converted white LEDs (pc-WLEDs) with near-UV/blue LED excitation sources. The excitation band edge in the near UV/blue wavelength in the reported phosphor has been attributed to the coordination environment of the transition metal ion (Mo{sup 6+}, W{sup 6+}) and host crystal structure. Furthermore the quantum efficiency of the phosphors has been enhanced by adjusting activator concentration, suitable compositional alloying using substitutional alkaline earth metal cations and charge compensation mechanisms. - Graphical abstract: The charge transfer excitation of orthorhombic Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} is significantly higher than tetragonal CaMoO{sub 4}: Eu{sup 3+} phosphors making Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} prime candidates for fabrication of warm white phosphor-converted LEDs. - Highlights: • LED excitable Mg{sub 0.6}Ca{sub 2.16}Mo{sub 0.2}W{sub 0.8}O{sub 6}: Eu{sub 0.12}{sup 3+}/Na{sub 0.12}{sup +} phosphors were synthesized. • These phosphors are 10 times more intense than CaMoO{sub 4}: Eu{sup 3+} red phosphors. • Their intensity and efficiency were enhanced by materials optimization techniques. • Such techniques include compositional alloying, charge compensation, etc.

  9. 49 CFR 571.216a - Standard No. 216a; Roof crush resistance; Upgraded standard.

    Science.gov (United States)

    2010-10-01

    ... (SAE) Standard J826 “Devices for Use in Defining and Measuring Vehicle Seating Accommodation,” SAE J826... Automotive Engineers, Inc., 400 Commonwealth Drive, Warrendale, PA 15096. Phone: 1-724-776-4841; Web: http... J826, revised July 1995, “Devices for Use in Defining and Measuring Vehicle Seating Accommodation...

  10. Inactivation of human osteosarcoma cells in vitro by 211At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    International Nuclear Information System (INIS)

    Larsen, R.H.; Bruland, O.S.; Hoff, P.; Alstad, J.; Lindmo, T.; Rofstad, E.K.

    1994-01-01

    The potential usefulness of α-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) 211 At-TP-3 of different specific activities, (b) 211 At-labeled bovine serum albumin (BSA), (c) free 211 At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, 211 At-BSA or free 211 At. The D o 's were lower for free 211 At than for 211 At-BSA. The survival curves for 211 At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to 211 At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to 211 At-TP-3 treatment was the antigen expression. Cell inactivation after 211 At-TP-3 treatment increased substantially with increasing specific activity of the 211 At-TP-3. At high specific activities, the cytotoxic effect of 211 At-TP-3 was significantly higher than that of 211 At-BSA. In conclusion, 211 At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs

  11. High sensitivity cavity ring down spectroscopy of N_2O near 1.22 µm: (II) "1"4N_2"1"6O line intensity modeling and global fit of "1"4N_2"1"8O line positions

    International Nuclear Information System (INIS)

    Tashkun, S.A.; Perevalov, V.I.; Karlovets, E.V.; Kassi, S.; Campargue, A.

    2016-01-01

    In a recent work (Karlovets et al., 2016 [1]), we reported the measurement and rovibrational assignments of more than 3300 transitions belonging to 64 bands of five nitrous oxide isotopologues ("1"4N_2"1"6O, "1"4N"1"5N"1"6O, "1"5N"1"4N"1"6O, "1"4N_2"1"8O and "1"4N_2"1"7O) in the high sensitivity CRDS spectrum recorded in the 7915–8334 cm"−"1 spectral range. The assignments were performed by comparison with predictions of the effective Hamiltonian models developed for each isotopologue. In the present paper, the large amount of measurements from our previous work mentioned above and literature are gathered to refine the modeling of the nitrous oxide spectrum in two ways: (i) improvement of the intensity modeling for the principal isotopologue, "1"4N_2"1"6O, near 8000 cm"−"1 from a new fit of the relevant effective dipole moment parameters, (ii) global modeling of "1"4N_2"1"8O line positions from a new fit of the parameters of the global effective Hamiltonian using an exhaustive input dataset collected in the literature in the 12–8231 cm"−"1 region. The fitted set of 81 parameters allowed reproducing near 5800 measured line positions with an RMS deviation of 0.0016 cm"−"1. The dimensionless weighted standard deviation of the fit is 1.22. As an illustration of the improvement of the predictive capabilities of the obtained effective Hamiltonian, two new "1"4N_2"1"8O bands could be assigned in the CRDS spectrum in the 7915–8334 cm"−"1 spectral range. A line list at 296 K has been generated in the 0–10,700 cm"−"1 range for "1"4N_2"1"8O in natural abundance with a 10"−"3"0 cm/molecule intensity cutoff. - Highlights: • Line parameters of two new "1"4N_2"1"8O bands centered at 7966 cm"−"1 and at 8214 cm"−"1. • Refined sets of the "1"4N_2"1"6O effective dipole moment parameters for ΔP=13,14 series. • Global modeling of "1"4N_2"1"8O line positions and intensities in the 12–8231 cm"−"1 range. • 5800 observed of "1"4N_2"1"8O line positions

  12. 48 CFR 52.216-25 - Contract Definitization.

    Science.gov (United States)

    2010-10-01

    ..., including data other than certified cost or pricing data, and certified cost or pricing data, in accordance... is [insert target date for definitization of the contract and dates for submission of proposal... certified cost or pricing data]: (c) If agreement on a definitive contract to supersede this letter contract...

  13. 48 CFR 2052.216-73 - Accelerated task order procedures.

    Science.gov (United States)

    2010-10-01

    ... terms of the definitive task order and agrees to submit a cost proposal with supporting cost or pricing data. If agreement on a definitized task order is not reached by the target date mutually agreed upon...

  14. 36 CFR 223.216 - Special Forest Products definitions.

    Science.gov (United States)

    2010-07-01

    ..., Christmas trees, cones, ferns, firewood, forbs, fungi (including mushrooms), grasses, mosses, nuts, pine straw, roots, sedges, seeds, transplants, tree sap, wildflowers, fence material, mine props, posts and...

  15. 48 CFR 216.601 - Time-and-materials contracts.

    Science.gov (United States)

    2010-10-01

    ...-Hour Proposal Requirements—Non-Commercial Item Acquisition with Adequate Price Competition, with 252... contract type for non-commercial items if the price is expected to be based on adequate competition. [71 FR... of the contract or order; establishing fixed prices for portions of the requirement); and (D...

  16. 50 CFR 216.93 - Tracking and verification program.

    Science.gov (United States)

    2010-10-01

    .... purse seine fishing, processing, and marketing in the United States and abroad. Verification of tracking... the Agreement on the IDCP. (d) Tracking cannery operations. (1) Whenever a U.S. tuna canning company..., canning, sale, rejection, etc.). (4) During canning activities, non-dolphin-safe tuna may not be mixed in...

  17. Dicty_cDB: CFK216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sllmkinselhqamkp*wklsri*kprttefqslkmkl ml*iyy*mksqkvlkscalavvplmksvsrkfisvmilhsst...sllmkinselhqamkp*wklsri*kprtte fqslkmklml*iyy*mksqkvlkscalavvplmksvsrkfisvmilhsstfikrf*lyql inklmlvkml*phntf

  18. Education in Healthy Lifestyles: Curriculum Implications. Fastback 216.

    Science.gov (United States)

    Seffrin, John R.; Torabi, Mohammad R.

    The nature of a healthy lifestyle and its significance to quality of life is examined. Following a discussion on what is involved in a healthy lifestyle, major health problems are described: (1) smoking; (2) alcohol and drug abuse; (3) sexually transmitted diseases; (4) diet and obesity; (5) stress; and (6) inadequate sleep. Recommendations are…

  19. 50 CFR 216.255 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... animals sighted. (4) Conduct shipboard monitoring to reduce impacts to protected species. Trained marine..., including the time of sighting and the direction of travel, into a marine animal tracking and sighting... will report all marine animals spotted and their directions of travel to the lead scientist onboard the...

  20. Aeronautical Engineering: A Continuing Bibliography with Indexes (Supplement 216)

    Science.gov (United States)

    1987-08-01

    HELO COMPUTER-AIDED PROCESSES FOR THE GROUND TESTING PATRICK J. DONOGHUE, PREBEN JENSEN, and ROBERT M. OF AVIATION EQUIPMENT [ SISTEMA ZADACH PROEKTIRO...Exploitation of Landes The digitall map as a tactical situation display DYAI EPNE(Frencee)-Front 󈨄 campaign and complesmentairy p 423 A87-3t4117

  1. 15 CFR 280.216 - Proceeding without a hearing.

    Science.gov (United States)

    2010-01-01

    ... will be decided on the record by the administrative law judge. Proceeding without a hearing does not... supplement other documentary evidence in the record. The administrative law judge will give each party...

  2. 24 CFR 884.216 - Termination of tenancy.

    Science.gov (United States)

    2010-04-01

    ... domestic violence, dating violence, stalking, or criminal activity directly related to domestic violence, dating violence, or stalking is involved or claimed to be involved. [56 FR 7541, Feb. 22, 1991, as... of tenancy for criminal activity by a covered person is subject to 24 CFR 5.858 and 5.859, and...

  3. 18 CFR 367.2160 - Account 216, Unappropriated retained earnings.

    Science.gov (United States)

    2010-04-01

    ..., Unappropriated retained earnings. 367.2160 Section 367.2160 Conservation of Power and Water Resources FEDERAL... retained earnings. This account must include the balances, either debit or credit, of unappropriated retained earnings arising from earnings of the service company. This account must not include any amounts...

  4. 47 CFR Appendix to Part 216 - NCS Directives

    Science.gov (United States)

    2010-10-01

    ... responsive and survivable national telecommunications infrastructure to meet the NSEP telecommunications... telecommunications infrastructure and service capabilities within the framework outlined in Executive Order No. 12472... Surveillance Act (50 U.S.C. 1801, et seq. and 18 U.S.C. 2511, 2518, and 2519). e. Title 47, Code of Federal...

  5. 29 CFR 779.216 - Statutory construction of the terms.

    Science.gov (United States)

    2010-07-01

    ..., and the legislative history. In extending coverage of the Act on an “enterprise” basis, the Congress intended, by the 1961 and 1966 amendments to cover, among others, business organizations and chain store systems which may perform their related activities through complex business arrangements or business...

  6. (216-IJBCS-Article-A B Béchir)

    African Journals Online (AJOL)

    RHUMSIKI

    L'objectif de cette étude a été d'analyser les variations saisonnières des ressources .... Tableau 1: Caractéristiques climatiques des saisons selon les agro-éleveurs et éleveurs du Tchad. Type de saison en ..... pour illustrer au mieux la situation globale dans notre ... ses limites dans un environnement sahélien soumis entre ...

  7. 50 CFR 216.37 - Marine mammal parts.

    Science.gov (United States)

    2010-10-01

    ...: (1) The person transferring the part receives no remuneration of any kind for the marine mammal part... specifically authorized by the Regional Director, consistent with the requirements of paragraphs (a)(1) and (a... Regional Director of the transfer, including a description of the part, the person to whom the part was...

  8. Dicty_cDB: CHE216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TNTTTAGTTCAATTGCAAACTTTATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCT...ATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCTTAAAACTTTAGNTGCCGAAACTA

  9. 48 CFR 1352.216-76 - Placement of orders.

    Science.gov (United States)

    2010-10-01

    ... price or estimated cost or fee; (4) Delivery or performance date; (5) Place of delivery or performance (including consignee); (6) Packaging, packing, and shipping instructions, if any; (7) Accounting and...

  10. 50 CFR 216.275 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to U.S. Navy Training in the Southern... outlined in the SOCAL Range Complex Stranding Communication Plan, the Navy must notify NMFS immediately (or...

  11. 50 CFR 216.175 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to U.S. Navy Training in the Hawaii Range... Communication Plan, the Holder of the Authorization must notify NMFS immediately (or as soon as clearance...

  12. 48 CFR 1852.216-88 - Performance incentive.

    Science.gov (United States)

    2010-10-01

    ... credit the next payment voucher for the amount due, as directed by the Contracting Officer. (2) When the performance level exceeds the standard level, the Contractor may request payment of the incentive amount associated with a given level of performance, provided that such payments shall not be more frequent than...

  13. 31 CFR 31.216 - Communications with Treasury employees.

    Science.gov (United States)

    2010-07-01

    ... employee with personal or direct responsibility for that procurement. (2) Offer, give, or promise to offer... employee, except as permitted by Government-Wide Ethics Rules, 5 CFR part 2635. (3) Solicit or obtain from...

  14. 48 CFR 216.504 - Indefinite-quantity contracts.

    Science.gov (United States)

    2010-10-01

    ... SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Indefinite... intelligence or intelligence-related activities of DoD, notification shall also be provided to the Select Committee on Intelligence of the Senate and the Permanent Select Committee on Intelligence of the House of...

  15. 48 CFR 52.216-15 - Predetermined Indirect Cost Rates.

    Science.gov (United States)

    2010-10-01

    .... (c) Allowability of costs and acceptability of cost allocation methods shall be determined in...) the period for which the rates apply, and (4) the specific items treated as direct costs or any changes in the items previously agreed to be direct costs. The indirect cost rate agreement shall not...

  16. 50 CFR 216.242 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... percent of the number of takes indicated below): (i) Mysticetes: (A) North Atlantic right whale (Eubalaena...) Sperm whales (Physeter macrocephalus)—48790 (an average of 9758 annually). (B) Pygmy or dwarf sperm...

  17. 50 CFR 216.241 - Effective dates and definitions.

    Science.gov (United States)

    2010-10-01

    ... pair of any of the following marine mammals of concern: beaked whale of any species, dwarf or pygmy sperm whales, melon-headed whales, pilot whales, right whales, humpback whales, sperm whales, blue...

  18. 50 CFR 216.217 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico...

  19. 48 CFR 1852.216-80 - Task ordering procedure.

    Science.gov (United States)

    2010-10-01

    ... individual task order, accounting and appropriation data. (e) The Contractor shall provide acknowledgement of... conflict between the requirements of the task order and the Contractor's approved task plan, the task order...

  20. Page | 216 IMPLEMENTATION OF TREATIES IN NIGERIA: ISSUES ...

    African Journals Online (AJOL)

    Fr. Ikenga

    empowered by the Constitution to make laws on behalf of the federal Government. .... the Elimination of All forms of Discrimination against Women. Also ..... which Nigeria has ratified relating to labour, employment, workplace, industrial.

  1. All projects related to | Page 216 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-07-09

    As African countries move toward universal health coverage, it is clear there is a shortage of African experts with applied research skills in health financing such as fiscal space analysis, needs-based resource allocation methods, and benefit incidence analysis of the equity impact of health funding. Start Date: July 9, 2012.

  2. 48 CFR 1552.216-77 - Award term incentive.

    Science.gov (United States)

    2010-10-01

    ... award term incentive periods] years. (c) Right not to grant or cancel the award term incentive. (1) The Government has the unilateral right not to grant or to cancel award term incentive periods and the associated... the award term incentive is cancelled, a unilateral modification will cite this clause as the...

  3. 7 CFR 800.216 - Activities that shall be monitored.

    Science.gov (United States)

    2010-01-01

    ... merchandising activities identified in this section shall be monitored in accordance with the instructions. (b) Grain merchandising activities. Grain merchandising activities subject to monitoring for compliance with...) Recordkeeping activities. Elevator and merchandising recordkeeping activities subject to monitoring for...

  4. NOAA Administrative Order 216-115: Strengthening NOAA's Research and

    Science.gov (United States)

    Advisory Committee Directives Management System NOAA Administrative Orders NOAA Circulars NOAA Delegations support NOAA in addressing critical science challenges, particularly those requiring integrated, holistic Quality Act (2001), the Office of Management and Budget (OMB) Circular A-11 (OMB, 2009a), the Open

  5. 50 CFR 216.72 - Restrictions on taking.

    Science.gov (United States)

    2010-10-01

    ... discussion of the number of seals expected to be taken annually over the next 3 years to satisfy the subsistence requirements of each island. This discussion will include an assessment of factors and conditions...) St. Paul Island—Seals may only be harvested from the following haulout areas: Zapadni, English Bay...

  6. 27 CFR 9.216 - Upper Mississippi River Valley.

    Science.gov (United States)

    2010-04-01

    ...), east of St. Paul at Oakbury in Washington County. From the beginning point, proceed east on Interstate... Winnebago County to U.S. Highway 20 at Cherry Valley; then (6) Proceed west on U.S. Highway 20 to Illinois...), south of St. Paul; then (15) Follow Interstate Highway 494 (beltway) northeast into Washington County...

  7. 34 CFR 682.216 - Teacher loan forgiveness program.

    Science.gov (United States)

    2010-07-01

    ... secondary school as a highly qualified mathematics or science teacher, or at an eligible educational service agency as a highly qualified teacher of mathematics or science to secondary school students; or (ii) At... in reading, writing, mathematics, and other areas of the elementary school curriculum, as certified...

  8. 47 CFR 216.2 - Publication of Directives.

    Science.gov (United States)

    2010-10-01

    ... Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL NATIONAL COMMUNICATIONS... internal administrative purposes, that publication of the current directives is worthwhile. The appendix to... of the hyphenated letters indicates the subject category: “1” for “Organization, Membership and...

  9. 48 CFR 552.216-72 - Placement of Orders.

    Science.gov (United States)

    2010-10-01

    ...] (b) Orders may be placed through Electronic Data Interchange (EDI) or mailed in paper form. EDI... Data Interchange (EDI) format. (c) If the Contractor agrees, General Services Administration's Federal Acquisition Service (FAS) will place all orders by EDI using computer-to-computer EDI. If computer-to-computer...

  10. 48 CFR 552.216-73 - Ordering Information.

    Science.gov (United States)

    2010-10-01

    ... transmission or □ computer-to-computer Electronic Data Interchange (EDI). (b) An offeror electing to receive computer-to-computer EDI is requested to indicate below the name, address, and telephone number of the representative to be contacted regarding establishment of an EDI interface. (c) An offeror electing to receive...

  11. 48 CFR 52.216-7 - Allowable Cost and Payment.

    Science.gov (United States)

    2010-10-01

    ... written understanding setting forth the final indirect cost rates. The understanding shall specify (i) the... special terms and the applicable rates. The understanding shall not change any monetary ceiling, contract... not subject to the interest penalty provisions of the Prompt Payment Act. Interim payments made prior...

  12. 48 CFR 352.216-70 - Additional cost principles.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Additional cost principles... Additional cost principles. As prescribed in 316.307(j), the Contracting Officer shall insert the following clause: Additional Cost Principles (January 2006) (a) Bid and proposal (B & P) costs. (1) B & P costs are...

  13. 12 CFR Appendix A to Part 216 - Model Privacy Form

    Science.gov (United States)

    2010-01-01

    ... market to me.” (4) Nonaffiliate opt-out. If the financial institution shares personal information... market to me.” or “□ Do not use my personal information to market to me.” A financial institution that... personal information with other financial institutions to jointly market to me.” (h) Barcodes. A financial...

  14. 25 CFR 216.7 - Approval of mining plan.

    Science.gov (United States)

    2010-04-01

    ... quantity of water to be used and pollutants that are expected to enter any receiving waters; (5) A design for the necessary impoundment, treatment or control of all runoff water and drainage from workings so as to reduce soil erosion and sedimentation and to prevent the pollution of receiving waters; (6) A...

  15. 50 CFR 216.245 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... to categorize in any way, the observed behavior of the animals (such as animal closing to bow ride... explosive detonations. The Navy shall provide NMFS with species or description of the animal(s), the condition of the animal(s) (including carcass condition if the animal is dead), location, time of first...

  16. Paolo Sortino, Elisabeth, Torino, Einaudi, 2011, pp. 216.

    African Journals Online (AJOL)

    User

    arte e della storia hanno il loro teatro di elezione, è facile pronosticare al mito di Partenope, affascinante e ingombrante, attraente e irritante, un lungo futuro. Franco Arato. (Università di Torino). Paolo Sortino, Elisabeth, Torino, Einaudi, 2011, ...

  17. 40 CFR 421.216 - Pretreatment standards for new sources.

    Science.gov (United States)

    2010-07-01

    ....171 Selenium 0.380 0.171 Molybdenum [Reserved] [Reserved]. Ammonia (as N) 61.720 27.130 Fluoride 16.210 9.214 (b) Roaster SO2 scrubber. PSNS for the Primary Molybdenum and Rhenium Subcategory Pollutant....377 0.621 Molybdenum [Reserved] [Reserved]. Ammonia (as N) 223.800 98.390 Fluoride 58.770 33.410 (c...

  18. 7 CFR 1709.216 - Evaluation criteria and weights.

    Science.gov (United States)

    2010-01-01

    ... announcement. (a) Program Design. Reviewers will consider the financial viability of the applicant's revolving... applications that are less detailed. (b) Assessment of needs. Reviewers will award more points to programs that... less severe physical and economic challenges. (c) Program evaluation and performance measures...

  19. Dicty_cDB: SFK216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available anslated Amino Acid sequence *lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqa mgdwqrklsdy*HSTNAF... Frame A: *lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqa mgdwqrklsdy*HSTNAFGFWVIPNNIADRGFIFDKS

  20. 48 CFR 652.216-71 - Price Adjustment.

    Science.gov (United States)

    2010-10-01

    ...) The contract price may be increased or decreased in actual costs of direct service labor which result...] Government. Direct service labor costs include only the costs of wages and direct benefits (such as social... number] of this contract. Price adjustments will include only changes in direct service labor costs...

  1. 8 CFR 216.3 - Termination of conditional resident status.

    Science.gov (United States)

    2010-01-01

    ..., whichever is applicable, are true, or it becomes known to the government that an alien entrepreneur who was... applicable, are true, or that an alien entrepreneur who was admitted pursuant to section 203(b)(5) of the Act... immigration laws or an alien entrepreneur obtained permanent resident status through a commercial enterprise...

  2. On employing H216O, H217O, H218O, and D216O lines as frequency standards in the 15-170 cm-1 window

    International Nuclear Information System (INIS)

    Furtenbacher, Tibor; Csaszar, Attila G.

    2008-01-01

    The protocol MARVEL, standing for measured active rotational-vibrational energy levels, is used to study high-accuracy measurements of rotational lines of four isotopologues of water, H 2 16 O, H 2 17 O, H 2 18 O, and D 2 16 O, obtained by spectroscopy in the far-infrared (FIR) region of 15-170 cm -1 by Matsushima et al. [Matsushima F, Odashima H, Iwasaki T, Tsunekawa S, Takagi K. Frequency measurement of pure rotational transitions of H 2 O from 0.5 to 5 THz. J Mol Struct 1995; 352/353, 371-8; Matsushima F, Nagase H, Nakauchi T, Odashima H, Takagi K. Frequency measurement of pure rotational transitions of H 2 17 O and H 2 18 O from 0.5 to 5 THz. J Mol Spectrosc 1999;193: 217-23; Matsushima F, Matsunaga M, Qian GY, Ohtaki Y, Wang RL, Takagi K. Frequency measurement of pure rotational transitions of D 2 O from 0.5 to 5 THz. J Mol Spectrosc 2001;206: 41-6; Matsushima F, Tomatsu N, Nagai T, Moriwaki Y, Takagi K. Frequency measurement of pure rotational transitions in the v 2 =1 state of H 2 O. J Mol Spectrosc 2006;235: 190-5]. MARVEL validates the high accuracy of most of the measured line positions. It results in a considerable number of energy levels with an average internal uncertainty of only 40 kHz (2σ). It also supports serious inaccuracy problems when Watson-type A-reduced Hamiltonians are used for predicting the highly accurate rotational measurements for water. Finally, MARVEL suggests a large number of para-water levels, for example 41 for H 2 16 O, which are candidates for becoming frequency standards in the FIR region of 15-170 cm -1 (the 0.5-5 THz window) when an accuracy of about 0.1 MHz is deemed to be sufficient

  3. 31 CFR 535.216 - Prohibition against prosecution of certain claims.

    Science.gov (United States)

    2010-07-01

    ... action, measure or process shall be taken after the effective date of this section in any judicial... result of popular movements in the course of the Islamic Revolution in Iran which were not an act of the...

  4. 216-Day report for Tank 241-C-111, cores 58 and 59

    International Nuclear Information System (INIS)

    Rice, A.D.

    1994-01-01

    Three core samples from tank C-111, and a field blank, were received by the 222-S laboratories. Cores 58, 59, and the field blank were analyzed in accordance with plans. A hot cell blank was analyzed at the direction of the hot cell chemist. No sample results exceeded the notification limits. Core 60 was not analyzed

  5. 32 CFR Appendix B to Part 216 - ROTC Sample Letter of Inquiry

    Science.gov (United States)

    2010-07-01

    ... Dr. Smith: I understand that ABC University has [refused a request from a Military Department to... available solely for student financial assistance, related administrative costs, or costs associated with... that regard, I request, within the next 30 days, a written statement of the institution with respect to...

  6. 2-16 Thermonuclear Reaction Rates in rp Process of sd

    Institute of Scientific and Technical Information of China (English)

    Lam; Yihua[1; Nadezda; A.; Smirnova[2; W.A.; Richter[3

    2014-01-01

    Recently, we have constructed a new set of isospin non-conserving (INC) shell-model Hamiltonians as a combinationof isospin conserving (IC) Hamiltonian, Coulomb interaction and effective isospin-symmetry breaking forcesof nuclear origin[1]. The advantage is that Coulomb effects are taken into account with great care, thus the new ap-Fig. 1 (color online) The comparison of resonant rates of23Al(p;)24Si calculated by IC and INC Hamiltonians. TheINC Hamiltonians of OB+USD, OB+USDA, OB+USDBwere constructed in Ref. [5]; whereas (cd-USD), (cd-USDA),(cd-USDB) are INC Hamiltonians in Ref. [1]. USD, USDA,USDB are IC Hamiltonians in Ref. [6].proach allows one to describe more accurately and topredict unknown nuclear level schemes and decay modes.Since the approximate isospin-symmetry becomes broken,a realistic amount of isospin-mixing in nuclearstates is thus introduced. Among numerous applicationsto the structure of proton-rich nuclei, we usedthe new Hamiltonian to calculate resonant reaction andnon-resonant reaction (direct capture) rates of radiativeproton-capture reactions important for astrophysical rpprocess.

  7. Yeast Interacting Proteins Database: YNL189W, YHR216W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available g, expression is repressed by nutrient limitation Rows with this prey as prey (1) Rows with this prey as bai...osynthesis, expression is induced by mycophenolic acid resulting in resistance to the drug, expression is repressed by nutrient limit...ation Rows with this prey as prey Rows with this prey as

  8. 12 CFR 216.4 - Initial privacy notice to consumers required.

    Science.gov (United States)

    2010-01-01

    ... individual who becomes your customer, not later than when you establish a customer relationship, except as... relationship with the consumer. (c) When you establish a customer relationship—(1) General rule. You establish a customer relationship when you and the consumer enter into a continuing relationship. (2) Special...

  9. 12 CFR 216.5 - Annual privacy notice to customers required.

    Science.gov (United States)

    2010-01-01

    ... annually during the continuation of the customer relationship. Annually means at least once in any period... annual notice to that customer by December 31 of year 2. (b)(1) Termination of customer relationship. You... customer concerning that relationship or you sell the credit card receivables without retaining servicing...

  10. 50 CFR 216.45 - General Authorization for Level B harassment for scientific research.

    Science.gov (United States)

    2010-10-01

    ... aspects of the proposed research; (ii) The species or stocks of marine mammals (common and scientific names) that are the subject of the scientific research and any other species or stock of marine mammals... this section. Annual reports must include: (i) A summary of research activities conducted; (ii...

  11. 50 CFR 216.108 - Requirements for monitoring and reporting under incidental harassment authorizations for Arctic...

    Science.gov (United States)

    2010-10-01

    ... location, and the time. (d) Where the proposed activity may affect the availability of a species or stock of marine mammal for taking for subsistence purposes, proposed monitoring plans or other research... an incidental harassment authorization for Arctic waters must submit reports to the Assistant...

  12. High accuracy line positions of the ν1 fundamental band of 14N216O

    Science.gov (United States)

    AlSaif, Bidoor; Lamperti, Marco; Gatti, Davide; Laporta, Paolo; Fermann, Martin; Farooq, Aamir; Lyulin, Oleg; Campargue, Alain; Marangoni, Marco

    2018-05-01

    The ν1 fundamental band of N2O is examined by a novel spectrometer that relies on the frequency locking of an external-cavity quantum cascade laser around 7.8 μm to a near-infrared Tm:based frequency comb at 1.9 μm. Due to the large tunability, nearly 70 lines in the 1240-1310 cm-1 range of the ν1 band of N2O, from P(40) to R(31), are for the first time measured with an absolute frequency calibration and an uncertainty from 62 to 180 kHz, depending on the line. Accurate values of the spectroscopic constants of the upper state are derived from a fit of the line centers (rms ≈ 4.8 × 10-6 cm-1 or 144 kHz). The ν1 transitions presently measured in a Doppler regime validate high accuracy predictions based on sub-Doppler measurements of the ν3 and ν3-ν1 transitions.

  13. 12 CFR 216.7 - Form of opt out notice to consumers; opt out methods.

    Science.gov (United States)

    2010-01-01

    ... each of your consumers that accurately explains the right to opt out under that section. The notice... your consumer to a nonaffiliated third party; (ii) That the consumer has the right to opt out of that disclosure; and (iii) A reasonable means by which the consumer may exercise the opt out right. (2) Examples...

  14. 20 CFR 216.23 - Work which does not affect eligibility.

    Science.gov (United States)

    2010-04-01

    ... business, trade or profession as an independent contractor, rather than as an employee. An individual is... correspondence, by required attendance at meetings, or by other methods. (3) Integration into the employer's business. Integration of an individual's services into the business operations of an employer generally...

  15. 50 CFR 216.22 - Taking by State or local government officials.

    Science.gov (United States)

    2010-10-01

    ...) Identification and curation. The Regional Director will assign a single unique number to each carcass, and the... person if: (i) The person transferring the marine mammal specimen does not receive remuneration for the... person within the United States unless the Regional Director of the appropriate Regional Office of the...

  16. 48 CFR 1852.216-76 - Award Fee for service contracts.

    Science.gov (United States)

    2010-10-01

    ... payments exceed the final evaluation score, the Contractor will either credit the next payment voucher for... [insert payment office] will make payment based on [Insert method of authorizing award fee payment, e.g... fee has been paid, the Contracting Officer may direct the withholding of further payment of award fee...

  17. 48 CFR 1852.216-77 - Award fee for end item contracts.

    Science.gov (United States)

    2010-10-01

    ... either credit the next payment voucher for the amount of such overpayment or refund the difference to the... Contracting Officer. (2) Interim award fee payments will be made to the Contractor based on each interim evaluation. The amount of the interim award fee payment is limited to the lesser of the interim evaluation...

  18. Corrosion and hydrogen permeation of A216 Grade WCA steel in hydrothermal magnesium-containing brines

    International Nuclear Information System (INIS)

    Haberman, J.H.; Frydrych, D.J.; Westerman, R.E.

    1988-03-01

    Corrosion rates determined at 1 month in 150/degree/C brine increased with magnesium concentration. The structure of the corrosion product, as determined by x-ray diffraction, depended upon the magnesium concentration. In brines with less than 10,000 ppM magnesium, the primary corrosion product had a spinel structure characteristic of magnetite or magnesioferrite. In brines containing magnesium concentrations greater than 20,000 ppM, the primary corrosion product had the amakinite structure characteristic of a complex iron-magnesium hydroxide. The high corrosion rates observed in brines containing high magnesium concentrations suggest that the corrosion products having the amakinite structure is less protective than corrosion products having the spinel structure. Corrosion rates in high-magnesium (inclusion) brine determined over a 6-month test duration were essentially constant. Hydrogen permeation rates observed in exposing mild steel to high-Mg/sup 2/plus// brine at 150/degree/C could be potentially damaging to a mild steel waste package container. The rate of hydrogen permeation was proportional to the brine flow rate in the autoclave. Thiourea additions to the brine increased the hydrogen permeation rate; sulfate and bromide ion additions did not. The maximum gaseous hydrogen pressure attainable is not known (based on 3Fe /plus/ 4H 2 O /plus/ Fe(sub 3)O /plus/ 4H 2 , would be /approximately/900 atmospheres), and the dependence of permeation rate on temperature is not known. 8 refs., 13 figs., 3 tabs

  19. 20 CFR 216.62 - Who is eligible for an annuity as a surviving divorced spouse.

    Science.gov (United States)

    2010-04-01

    ...) Is not entitled to an old-age benefit under the Social Security Act that is equal to or higher than... (or age 50 if he or she is a disabled surviving divorced spouse), such marriage shall be deemed not to...

  20. 48 CFR 3452.216-71 - Negotiated overhead rates-fixed.

    Science.gov (United States)

    2010-10-01

    ... acceptability of cost allocation methods shall be determined in accordance with part 31 of the Federal... different period, for which the rates apply, and (4) the specific items treated as direct costs or any changes in the items previously agreed to be direct costs. (e) Pending establishment of fixed overhead...

  1. 76 FR 50811 - Seventeenth Meeting: EUROCAE WG-72: RTCA Special Committee 216: Aeronautical Systems Security...

    Science.gov (United States)

    2011-08-16

    .... Agenda Tuesday, September 6th (Pre-Meeting Events) 9 a.m. to 12 p.m. Optional--DHS National Cybersecurity... cooperation. 11:15 a.m.-12 p.m., DHS Briefing on the Cybersecurity Control System Security (CSSP) Program. 1 p...). [[Page 50812

  2. Hyperspectral Imagery for the Main Eight Hawaiian Islands:Oahu (216-0611-272217)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  3. 32 CFR Appendix A of Part 216 - Military Recruiting Sample Letter of Inquiry

    Science.gov (United States)

    2010-07-01

    ... University, Anywhere, USA 12345-9876. Dear Dr. Doe: I understand that military recruiting personnel [have... University)] by a policy or practice of the school. Specifically, military recruiting personnel have reported... 32 National Defense 2 2010-07-01 2010-07-01 false Military Recruiting Sample Letter of Inquiry A...

  4. 10 CFR 1021.216 - Procurement, financial assistance, and joint ventures.

    Science.gov (United States)

    2010-01-01

    ... competitive solicitations, unless the action is categorically excluded from preparation of an EA or EIS under...-source joint ventures, unless the action is categorically excluded from preparation of an EA or EIS under... reasoned decision. (g) The environmental critique will focus on environmental issues that are pertinent to...

  5. 48 CFR 216.505-70 - Orders under multiple award contracts.

    Science.gov (United States)

    2010-10-01

    ... under each order as one of the factors in the selection decision; and (4) The contracting officer should... statute expressly authorizes or requires that the purchase be made from a specified source; or (2) One of... the intent to make the purchase, including a description of the supplies to be delivered or the...

  6. 76 FR 22162 - Sixteenth Meeting: EUROCAE WG-72: RTCA Special Committee 216: Aeronautical Systems Security...

    Science.gov (United States)

    2011-04-20

    ... meeting held January 18-21, 2011. Report on the PMC/ICC Action on TOR. RTCA Specific Publication Progress... Advisory Committee. [FR Doc. 2011-9489 Filed 4-19-11; 8:45 am] BILLING CODE 4910-13-P ...

  7. 20 CFR 702.216 - Effect of failure to give notice.

    Science.gov (United States)

    2010-04-01

    ... supervisor was aware of the injury and/or in the case of a hearing loss, where the employer has furnished to the employee an audiogram and report which indicates a loss of hearing. Failure to give notice shall...'S AND HARBOR WORKERS' COMPENSATION ACT AND RELATED STATUTES ADMINISTRATION AND PROCEDURE Claims...

  8. 48 CFR 552.216-70 - Economic Price Adjustment-FSS Multiple Award Schedule Contracts.

    Science.gov (United States)

    2010-10-01

    ... ___* percent of the original contract unit price. The Government reserves the right to raise this ceiling where... price increase. (e) The Government reserves the right to exercise one of the following options: (1... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Economic Price Adjustment...

  9. 48 CFR 552.216-71 - Economic Price Adjustment-Special Order Program Contracts.

    Science.gov (United States)

    2010-10-01

    ... updated index, the Contractor shall have waived its right to an upward price adjustment for the balance of... Contractors shall have waived its right to an upward price adjustment for that option period. Alternatively... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Economic Price Adjustment...

  10. 48 CFR 52.216-17 - Incentive Price Revision-Successive Targets.

    Science.gov (United States)

    2010-10-01

    ... incurred plus an estimate of costs to complete performance, in the format of table 15-2, FAR 15.408 (or in... percents] of the total initial target cost. (3) If the total firm target cost plus the total firm target... is less than the total firm target cost, the adjustment is the total firm target profit, plus...

  11. 50 CFR 226.216 - Critical habitat for elkhorn (Acropora palmata) and staghorn (A. cervicornis) corals.

    Science.gov (United States)

    2010-10-01

    ... of the Atlantic Ocean offshore of Palm Beach, Broward, Miami-Dade, and Monroe counties, Florida, and three specific areas of the Atlantic Ocean and Caribbean Sea offshore of the U.S. Territories of Puerto Rico and the U.S. Virgin Islands. The boundaries of each specific critical habitat area are described...

  12. 48 CFR 452.216-71 - Base Fee and Award Fee Proposal.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Base Fee and Award Fee... Base Fee and Award Fee Proposal. As prescribed in 416.470, insert the following provision: Base Fee and Award Proposal (FEB 1988) For the purpose of this solicitation, offerors shall propose a base fee of...

  13. 49 CFR 216.11 - Special notice for repairs-railroad freight car.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Special notice for repairs-railroad freight car...—railroad freight car. (a) When an FRA Motive Power and Equipment Inspector or a State Equipment Inspector determines that a railroad freight car is not in conformity with the requirements of the FRA Freight Car...

  14. 48 CFR 1352.216-71 - Level of effort (cost-plus-fixed-fee, term contract).

    Science.gov (United States)

    2010-10-01

    ... Optionperiod II Optionperiod III xxxxxxxxxx xxxx xxxx xxxx xxxx xxxxxxxxxx xxxx xxxx xxxx xxxx Total Direct Labor xxxx xxxx xxxx xxxx (c) The hours specified above are provided as estimates only. If the actual...

  15. 12 CFR 216.6 - Information to be included in privacy notices.

    Science.gov (United States)

    2010-01-01

    ... customers that you disclose and the categories of affiliates and nonaffiliated third parties to whom you disclose nonpublic personal information about your former customers, other than those parties to whom you... applicable; and (ii) State whether the third party is: (A) A service provider that performs marketing...

  16. Guaviare: Reencontrando Espacios e Identidades (pág. 216-223

    Directory of Open Access Journals (Sweden)

    Cristian Alexis Gil Ruiz

    2010-07-01

    Full Text Available La riqueza colombiana está en las selvas, claro, la faunística y florística que enluce a nuestro querido país, a continuación les mostraré rasgos de esa riqueza encontrada en el departamento del Guaviare, más exactamente en la vereda cerro azul, en un sitio llamado Cerro pinturas y que es un patrimonio cultural y arqueológico del departamento, espacios como hay en muchos escenarios de Colombia , que es un país hermoso, con varios sitios que no se han visitado, y que son dignos de ver, es triste que como estudiantes, como docentes en formación y más que todo, como colombianos, nos estemos perdiendo estas oportunidades. Además de ello debe entenderse al docente como un sujeto no sólo educativo, también es un sujeto con vocación social, política y cultural y que sea como sea, es un ciudadano y nunca dejara de serlo, así que como docentes es nuestro deber apropiarnos de sitios como éste y educar para que sean admirados, protegidos y sobre todo respetados.

  17. 40 CFR 89.903 - Application of section 216(10) of the Act.

    Science.gov (United States)

    2010-07-01

    ... system) that is not used in a motor vehicle is deemed a nonroad engine if it meets the definition in... obtained by writing to the following address: Chief, Selective Enforcement Auditing Section, Engine...

  18. 29 CFR 780.216 - Nursery activities generally and Christmas tree production.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Nursery activities generally and Christmas tree production... Nursery activities generally and Christmas tree production. (a) The employees of a nursery who are engaged... horticultural commodities such as the following are employed in agriculture: (1) Planting seedlings in a nursery...

  19. 20 CFR 216.32 - Who is eligible for a disability annuity.

    Science.gov (United States)

    2010-04-01

    .... The Railroad Retirement Act provides two types of disability annuities for employees who have been... part 220 of this chapter, is eligible for a disability annuity if he or she: (1) Has not attained... part 220 of this chapter, is eligible for a disability annuity if he or she: (1) Is under retirement...

  20. 20 CFR 216.24 - Relinquishment of rights to return to work.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relinquishment of rights to return to work... of rights to return to work. (a) What return to work rights must be given up. Before an individual... work for any railroad employer. (b) When right to return to work is ended. An individual's right to...

  1. 26 CFR 1.216-2 - Treatment as property subject to depreciation.

    Science.gov (United States)

    2010-04-01

    ... paragraph shall be the fair market value of such depreciable real property on the date of the conversion if the fair market value is less than the adjusted basis of such property in the hands of the cooperative housing corporation provided in section 1011 without taking into account any adjustment for depreciation...

  2. 50 CFR 216.150 - Specified activity and specified geographical region.

    Science.gov (United States)

    2010-10-01

    ... species: northern elephant seals (Mirounga angustirostris), harbor seals (Phoca vitulina), and California... with the launching of a total of 40 Coyote (or similar sized and smaller) missiles per year from San...

  3. 20 CFR 10.216 - How is the pay rate for COP calculated?

    Science.gov (United States)

    2010-04-01

    ... for COP purposes is equal to the employee's regular “weekly” pay (the average of the weekly pay over... occurred during the 45-day period are to be reflected in the weekly pay determination. (b) The weekly pay... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How is the pay rate for COP calculated? 10...

  4. 7 CFR 2.16 - Under Secretary for Farm and Foreign Agricultural Services.

    Science.gov (United States)

    2010-01-01

    ... habitat incentives. (xxxii) Implement the authority in section 1241 of the Food Security Act of 1985 (16 U... 1985 (7 U.S.C. 1736o). (xxxii) Serve as Department adviser on policies, organizational arrangements...

  5. People and things. CERN Courier, July-August 1980, v. 21(6)

    International Nuclear Information System (INIS)

    Anon.

    1981-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Over the last several years a new 'language', MULTI, has made a major hit at Fermilab. MULTI is a program that can flexibly handle interactive on-line computing from widely differing experimental CAMAC configurations. By now twothirds of the running experiments at Fermilab are using the system. It is literally true that an on-line system can be put into practical operation over a weekend. The demands of particle accelerator builders frequently stretch modern technology to the full. Recently a new possibility has emerged, using the technique of non-evaporable 'getters' - NEG. Getters are substances capable of absorbing gas molecules, so setting up a pumping action; The workshop for electron-proton physics at the proposed HERA machine will take place at the University of Wuppertal (Federal Republic of Germany) on 2-3 October. There will be reviews on the physics potential of electron-proton collisions, on the different electron-proton collider projects, on detectors and on polarization.One of CERN's annual sporting high lights is the 3.9 km relay race around the Meyrin site. This year some 40 runners lined up at the start

  6. Weapons and Tactics Instructor Course 2-16 Sleep and Performance Study

    Science.gov (United States)

    2017-03-01

    Cohort Study MEQ Morningness-Eveningness Questionnaire MOS Military Occupational Specialty MRI Magnetic Resonance Images NATOPS Naval Air... pharmacologic strategies such as “deferral of routine non-flying duties, flexible scheduling, and use of frequent naps” (Brown & Baker, 2000, p. 8) as...well as detailed information on several pharmacological interventions to aid aviators in either falling asleep or staying awake. Approved

  7. 18 CFR 380.16 - Environmental reports for section 216 Federal Power Act Permits.

    Science.gov (United States)

    2010-04-01

    .... (3) Discuss design and operational measures to avoid or reduce risk. (4) Discuss contingency plans... sufficient detail to provide a full understanding of the project including: (i) Plans (overhead view); (ii) Elevations (front view); (iii) Profiles (side view); and (iv) Sections. (2) The applicant may submit...

  8. Inverse modeling of test SB4-VM2/216.7 at Wellenberg

    International Nuclear Information System (INIS)

    Finsterle, S.

    1994-03-01

    Pressure and flow rate data from a water sampling test, which also produced gas, at the Wellenberg site are analyzed using inverse modeling techniques. Two conceptual models are developed and used for parameter estimation. The first model assumes that the gas observed at the surface is dissolved in the pore water under natural pressure and temperature conditions and comes out of solution due to the pressure reduction during pumping. The second model considers a mobile gas phase originally present in the formation. While both models are able to explain the observed pressure response as well as the gas seen at the surface, large uncertainties in the data and in the model assumptions inhibit the determination of two-phase flow parameters. The analysis indicates, however, that the formation has a very low permeability and that formation head is far below hydrostatic

  9. 14 CFR 21.6 - Manufacture of new aircraft, aircraft engines, and propellers.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Manufacture of new aircraft, aircraft... Manufacture of new aircraft, aircraft engines, and propellers. (a) Except as specified in paragraphs (b) and (c) of this section, no person may manufacture a new aircraft, aircraft engine, or propeller based on...

  10. Topographic Map of Quadrangle 3768 and 3668, Imam-Saheb (215), Rustaq (216), Baghlan (221), and Taloqan (222) Quadrangles, Afghanistan

    Science.gov (United States)

    Bohannon, Robert G.

    2006-01-01

    This map was produced from several larger digital datasets. Topography was derived from Shuttle Radar Topography Mission (SRTM) 85-meter digital data. Gaps in the original dataset were filled with data digitized from contours on 1:200,000-scale Soviet General Staff Sheets (1978-1997). Contours were generated by cubic convolution averaged over four pixels using TNTmips surface-modeling capabilities. Minor artifacts resulting from the auto-contouring technique are present. Streams were auto-generated from the SRTM data in TNTmips as flow paths. Flow paths were limited in number by their Horton value on a quadrangle-by-quadrangle basis. Peak elevations were averaged over an area measuring 85 m by 85 m (represented by one pixel), and they are slightly lower than the highest corresponding point on the ground. Cultural data were extracted from files downloaded from the Afghanistan Information Management Service (AIMS) Web site (http://www.aims.org.af). The AIMS files were originally derived from maps produced by the Afghanistan Geodesy and Cartography Head Office (AGCHO). Because cultural features were not derived from the SRTM base, they do not match it precisely. Province boundaries are not exactly located. This map is part of a series that includes a geologic map, a topographic map, a Landsat natural-color-image map, and a Landsat false-color-image map for the USGS/AGS (Afghan Geological Survey) quadrangles covering Afghanistan. The maps for any given quadrangle have the same open-file report (OFR) number but a different letter suffix, namely, -A, -B, -C, and -D for the geologic, topographic, Landsat natural-color, and Landsat false-color maps, respectively. The OFR numbers range in sequence from 1092 to 1123. The present map series is to be followed by a second series, in which the geology is reinterpreted on the basis of analysis of remote-sensing data, limited fieldwork, and library research. The second series is to be produced by the USGS in cooperation with the AGS and AGCHO.

  11. P2-16: Dual-Bound Model and the Role of Time Bound in Perceptual Decision Making

    Directory of Open Access Journals (Sweden)

    Daeseob Lim

    2012-10-01

    Full Text Available The diffusion model (DM encapsulates the dynamics of perceptual decision within a ‘diffusion field’ that is defined by a basis with sensory-evidence (SE and time vectors. At the core of the DM, it assumes that a decision is not made until an evidence particle drifts in the diffusion field and eventually hits one of the two pre-fixed bounds defined in the SE axis. This assumption dictates when and which choice is made by referring to when and which bound will be hit by the evidence particle. What if urgency pressures the decision system to make a choice even when the evidence particle has yet hit the SE bound? Previous modeling attempts at coping with time pressure, despite differences in detail, all manipulated the coordinate of SE bounds. Here, we offer a novel solution by adopting another bound on the time axis. This ‘dual-bound’ model (DBM posits that decisions can also be made when the evidence particle hits a time bound, which is determined on a trial-by-trial basis by a ‘perceived time interval’ – how long the system can stay in the ‘diffusion’ field. The classic single-bound model (SBM exhibited systematic errors in predicting both the reaction time distributions and the time-varying bias in choice. Those errors were not corrected by previously proposed variants of the SBM until the time bound was introduced. The validity of the DBM was further supported by the strong across-individual correlation between observed precision of interval timing and the predicted trial-by-trial variability of the time bound.

  12. SU-E-J-216: A Sequence Independent Approach for Quantification of MR Image Deformations From Brachytherapy Applicators

    Energy Technology Data Exchange (ETDEWEB)

    Wieringen, N van; Heerden, L van; Gurney-Champion, O; Kesteren, Z van; Houweling, A; Pieters, B; Bel, A [Academic Medical Center, Amsterdam (Netherlands)

    2015-06-15

    Purpose: MRI is increasingly used as a single imaging modality for brachytherapy treatment planning. The presence of a brachytherapy applicator may cause distortions in the images, especially at higher field strengths. Our aim is to develop a procedure to quantify these distortions theoretically for any MR-sequence and to verify the estimated deformations for clinical sequences. Methods: Image distortions due to perturbation of the B0-field are proportional to the ratio of the induced frequency shift and the read-out bandwidth of the applied sequence. By reconstructing a frequency-shift map from the phase data from a multi-echo sequence, distortions can be calculated for any MR-sequence. Verification of this method for estimating distortions was performed by acquiring images with opposing read-out directions and consequently opposing distortions. The applicator shift can be determined by rigidly matching these images. Clinically, T2W-TSE-images are used for this purpose. For pre-clinical tests, EPI-sequences with narrow read-out bandwidth (19.5–47.5Hz), consequently large distortions, were added to the set of clinical MRsequences. To quantify deformations of the Utrecht Interstitial CT/MR applicator (Elekta Brachytherapy) on a Philips Ingenia 3T MRI, pre-clinical tests were performed in a phantom with the applicator in water, followed by clinical validation. Results: Deformations observed in the narrow bandwidth EPI-images were well predicted using the frequency-shift, the latter giving an overestimation up to 30%/up to 1 voxel. For clinically applied MR-sequences distortions were well below the voxel size. In patient setup distortions determined from the frequency-shift map were at sub-voxel level (<0.7mm). Using T2W-images larger distortions were found (1–2mm). This discrepancy was caused by patient movement between/during acquisition of the T2W-images with opposing read-out directions. Conclusion: Phantom experiments demonstrated the feasibility of a clinical procedure for quantification of MR-image distortions for any MR-sequence. In a clinical set-up the distortions from a Utrecht interstitial CT/MR applicator are sub-voxel level. This work was partially funded by Elekta Brachytherpy.

  13. Shield fabrication development of ITER primary wall modules by powder HIP. ITER task T216-Subtask 3E1

    International Nuclear Information System (INIS)

    Lind, A.

    1997-12-01

    A research and development program for the blanket shield in the International Thermonuclear Experimental Reactor (ITER) has been implemented to provide input for the design and manufacture of full scale production components. It comprises fabrication and testing of mock-ups and prototype modules. The design, materials, manufacture, examination, testing and inspection of the mock-ups representing future full scale production modules. This work applies to the development of a shield block fabrication method by Hot Isostatic Pressing (HIP) starting from a gas atomised powder and pre-fabricated cooling tube galleries. The size of the block is 1250 x 650 x 250 mm and the weight is about 1400 kg. Examination and testing of the block was performed to determine properties, achieved fabrication tolerances, and quality of bonding. It is concluded that the today's powder HIP route gives a 316 LN IG material with mechanical properties which fulfills the ITER material specification requirements and a fully dense block which is easy to examine with ultrasonic methods. The joints between tubes and matrix are excellent. In order to achieve and maintain accuracy in positioning of the tubes during fabrication improvements of the standard fabrication route have been identified, such as the positioning of tubes during welding, the powder particle distribution and the powder filling procedure. Modification of the actual HIP cycle may also be required

  14. SU-F-T-216: Evaluating Dosimetry Accuracy of a Treatment Planning System On Small Proton Fields

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, M; Xiao, Z; Zou, J; Chen, T; Yue, N [Rutgers University, New Brunswick, NJ (United States)

    2016-06-15

    Purpose: This study is aiming to identify the smallest field size for which a treatment planning system (TPS) can accurately calculate the relative dose distribution. The finding would be used as a guideline to choose the smallest proton field for clinical treatment. Methods: Mevion S250™ double scattering proton delivery system and Eclipse™ TPS (Varian) with pencil beam convolution (PBC) dose algorithm were used in this study. Square sized fields of 1 cm, 2 cm, 3 cm, 4 cm, 5 cm, and 10 cm were planned on a cubical water phantom with iso-center placed at 10 cm depth. All beams used the same proton beam option: range 15 cm and modulation 10 cm. Dose in water was calculated without any compensator. Gafchromic™ EBT3 film and diode detectors were used to measure the central axis dose distribution and lateral dose profiles at 5 cm, 10 cm, and 14 cm depth. Results: The preliminary film measurement shows good agreement between Eclipse calculated lateral dose profiles for all tested field sizes. The differences on full width half maximum were ≤ 1 mm while the differences on the penumbras were between 1 mm and 2 mm between Eclipse and film. For the depth dose, Eclipse results matched well with film measurements for field sizes down to 2 cm{sup 2}. With smaller field size of 1 cm{sup 2}, Eclipse was able to predict the decreasing of SOBP due to the lack of lateral charged particle equilibrium in depth. However, it did not match the film measurement. Diode measurement results will be available at the time of presentation. Conclusion: The PBC dose algorithm in Eclipse can accurately calculate relative dose distribution in double scattered proton system for field size down to 2 cm{sup 2}.

  15. 50 CFR 216.24 - Taking and related acts incidental to commercial fishing operations by tuna purse seine vessels...

    Science.gov (United States)

    2010-10-01

    ... including the use of the high intensity lighting system. In the event a sundown set occurs where the seine... International Review Panel, prosecution by the United States is not recommended. Any such recommendation will be...

  16. 20 CFR 216.63 - Who is eligible for an annuity as a remarried widow(er).

    Science.gov (United States)

    2010-04-01

    ...: (i) After having attained age 60 (after age 50 if disabled); or (ii) Before age 60 but the marriage terminated; (2) Is not entitled to an old-age benefit under the Social Security Act that is equal to or...

  17. Oahu Hyperspectral Imagery 2000 (216-0611-332211) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  18. Shield fabrication development of ITER primary wall modules by powder HIP. ITER task T216-Subtask 3E1

    Energy Technology Data Exchange (ETDEWEB)

    Lind, A

    1997-12-01

    A research and development program for the blanket shield in the International Thermonuclear Experimental Reactor (ITER) has been implemented to provide input for the design and manufacture of full scale production components. It comprises fabrication and testing of mock-ups and prototype modules. The design, materials, manufacture, examination, testing and inspection of the mock-ups representing future full scale production modules. This work applies to the development of a shield block fabrication method by Hot Isostatic Pressing (HIP) starting from a gas atomised powder and pre-fabricated cooling tube galleries. The size of the block is 1250 x 650 x 250 mm and the weight is about 1400 kg. Examination and testing of the block was performed to determine properties, achieved fabrication tolerances, and quality of bonding. It is concluded that the today`s powder HIP route gives a 316 LN IG material with mechanical properties which fulfills the ITER material specification requirements and a fully dense block which is easy to examine with ultrasonic methods. The joints between tubes and matrix are excellent. In order to achieve and maintain accuracy in positioning of the tubes during fabrication improvements of the standard fabrication route have been identified, such as the positioning of tubes during welding, the powder particle distribution and the powder filling procedure. Modification of the actual HIP cycle may also be required

  19. Oahu Hyperspectral Imagery 2000 (216-0611-272217) - Visual Interpretation from Remote Sensing Imagery Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort between the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment,...

  20. Session 21.6: Preserving Dark Skies and Protecting Against Light Pollution in a World Heritage Framework

    Science.gov (United States)

    Smith, Malcolm G.

    2016-10-01

    This session opened with a crucial explanation by Michel Cotte of how astronomers first need to understand how to apply UNESCO World Heritage Criteria if they want to motivate their government(s) to make the case to UNESCO for World Heritage recognition. UNESCO World Heritage cannot be obtained just to protect dark skies. Much more detail of this and the other presentations in this session, along with many images, can be found at the session website: http://www.noao.edu/education/IAUGA2015FM21. The next speaker, John Hearnshaw, described the Aoraki Mackenzie International Dark Sky Reserve and the work it carries out . This was followed by a wide-ranging summary (by Dan Duriscoe and Nate Ament) of the U.S. National Park Service (NPS) Night Skies Program. The abstract of Cipriano's Marin's paper, ``Developing Starlight connections with UNESCO sites through the Biosphere Smart" was shown in his absence. The final presentation (by Arkadiusz Berlicki, S. Kolomanksi and T. Mrozek) discussed the bi-national Izera Dark Sky Park.

  1. 30 CFR 77.216-2 - Water, sediment, or slurry impoundments and impounding structures; minimum plan requirements...

    Science.gov (United States)

    2010-07-01

    ... SAFETY AND HEALTH MANDATORY SAFETY STANDARDS, SURFACE COAL MINES AND SURFACE WORK AREAS OF UNDERGROUND... instrumentation. (9) Graphs showing area-capacity curves. (10) A statement of the runoff attributable to the probable maximum precipitation of 6-hour duration and the calculations used in determining such runoff. (11...

  2. 8 CFR 216.5 - Waiver of requirement to file joint petition to remove conditions by alien spouse.

    Science.gov (United States)

    2010-01-01

    ... result in physical or mental injury. Psychological or sexual abuse or exploitation, including rape, molestation, incest (if the victim is a minor) or forced prostitution shall be considered acts of violence...

  3. 21 CFR 216.24 - Drug products withdrawn or removed from the market for reasons of safety or effectiveness.

    Science.gov (United States)

    2010-04-01

    .... Bromfenac sodium: All drug products containing bromfenac sodium. Butamben: All parenteral drug products...). Dexfenfluramine hydrochloride: All drug products containing dexfenfluramine hydrochloride. Diamthazole... dihydrostreptomycin sulfate. Dipyrone: All drug products containing dipyrone. Encainide hydrochloride: All drug...

  4. 30 CFR 285.216 - What information will MMS publish in the Proposed Sale Notice and Final Sale Notice?

    Science.gov (United States)

    2010-07-01

    ... or applications and how the criteria will be used in decision-making for awarding a lease. (f) Award... for leasing. (b) Proposed and final lease provisions and conditions, including, but not limited to: (1...) Minimum bid; (3) Deposit amount; (4) The place and time for filing bids and the place, date, and hour for...

  5. 77 FR 29683 - Outer Continental Shelf (OCS) Consolidated Central Gulf of Mexico Planning Area Sale; 216/222

    Science.gov (United States)

    2012-05-18

    ... than 400 meters of water depth completed to a drilling depth of 20,000 feet TVD SS or deeper may... are specified as (1) less than 400 meters and (2) 400 meters or more. Successful Bidders: BOEM... summarized in the following table: [[Page 29686

  6. 8 CFR 216.4 - Joint petition to remove conditional basis of lawful permanent resident status for alien spouse.

    Science.gov (United States)

    2010-01-01

    ... of the marriage through annulment, divorce, or the death of the petitioning spouse, or if the... concurrently with the parent, the death of the parent, or other reasons may file a separate Petition to Remove... provided with written notification of the termination and the reasons therefor, and a notice to appear...

  7. 8 CFR 216.6 - Petition by entrepreneur to remove conditional basis of lawful permanent resident status.

    Science.gov (United States)

    2010-01-01

    ... investment requirement of the statute and continuously maintained his or her capital investment over the two... has, in good faith, substantially met the capital investment requirement of the statute and continuously maintained his or her capital investment over the two years of conditional residence. (iv) The...

  8. FTS improvements and connection with a long White cell. Application: H216O intensity measurements around 1200 cm-1

    International Nuclear Information System (INIS)

    Regalia, L.; Oudot, C.; Thomas, X.; Von der Heyden, P.; Decatoire, D.

    2010-01-01

    Acquisition electronics, data software and optics of the Fourier transform spectrometer of the Groupe de Spectrometrie Moleculaire et Atmospherique laboratory have been optimized over the past 5 years. Among the improvements brought on to this system is the optical fitting of 50-m White cell. This cell can be used to achieve absorption path lengths as long as 2 km. This new setup allows us to perform spectroscopic analysis of very small absorption lines.

  9. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  10. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  11. Negative Ion Source Development and Photodetachment Studies at ISOLDE

    CERN Document Server

    AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian

    Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...

  12. An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels

    Science.gov (United States)

    1991-12-01

    d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are

  13. Workshop on selected aspects of radiochemistry

    International Nuclear Information System (INIS)

    1991-11-01

    The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de

  14. Development and therapeutic application of internally emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    Adelstein, S.J.; Bloomer, W.D.

    1980-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds

  15. Single-molecule spectroscopy reveals that individual low-light LH2 complexes from Rhodopseudomonas palustris 2.1.6. have a heterogeneous polypeptide composition.

    Science.gov (United States)

    Brotosudarmo, Tatas H P; Kunz, Ralf; Böhm, Paul; Gardiner, Alastair T; Moulisová, Vladimíra; Cogdell, Richard J; Köhler, Jürgen

    2009-09-02

    Rhodopseudomonas palustris belongs to the group of purple bacteria that have the ability to produce LH2 complexes with unusual absorption spectra when they are grown at low-light intensity. This ability is often related to the presence of multiple genes encoding the antenna apoproteins. Here we report, for the first time to our knowledge, direct evidence that individual low-light LH2 complexes have a heterogeneous alphabeta-apoprotein composition that modulates the site energies of Bchl a molecules, producing absorption bands at 800, 820, and 850 nm. The arrangement of the Bchl a molecules in the "tightly coupled ring" can be modeled by nine alphabeta-Bchls dimers, such that the Bchls bound to six alphabeta-pairs have B820-like site energies and the remaining Bchl a molecules have B850-like site energies. Furthermore, the experimental data can only be satisfactorily modeled when these six alphabeta-pairs with B820 Bchl a molecules are distributed such that the symmetry of the assembly is reduced to C(3). It is also clear from the measured single-molecule spectra that the energies of the electronically excited states in the mixed B820/850 ring are mainly influenced by diagonal disorder.

  16. Airborne in situ vertical profiling of HDO / H216O in the subtropical troposphere during the MUSICA remote sensing validation campaign

    Science.gov (United States)

    Dyroff, C.; Sanati, S.; Christner, E.; Zahn, A.; Balzer, M.; Bouquet, H.; McManus, J. B.; Gonzalez-Ramos, Y.; Schneider, M.

    2015-05-01

    Vertical profiles of water vapor (H2O) and its isotope ratio D / H expressed as δD(H2O) were measured in situ by the ISOWAT II diode-laser spectrometer during the MUlti-platform remote Sensing of Isotopologues for investigating the Cycle of Atmospheric water (MUSICA) airborne campaign. We present recent modifications of the instrument design. The instrument calibration on the ground as well as in flight is described. Based on the calibration measurements, the humidity-dependent uncertainty of our airborne data is determined. For the majority of the airborne data we achieved an accuracy (uncertainty of the mean) of Δ(δD) ≈10‰. Vertical profiles between 150 and ~7000 m were obtained during 7 days in July and August 2013 over the subtropical North Atlantic Ocean near Tenerife. The flights were coordinated with ground-based (Network for the Detection of Atmospheric Composition Change, NDACC) and space-based (Infrared Atmospheric Sounding Interferometer, IASI) FTIR remote sensing measurements of δD(H2O) as a means to validate the remote sensing humidity and δD(H2O) data products. The results of the validation are presented in detail in a separate paper (Schneider et al., 2014). The profiles were obtained with a high vertical resolution of around 3 m. By analyzing humidity and δD(H2O) correlations we were able to identify different layers of air masses with specific isotopic signatures. The results are discussed.

  17. IUPAC critical evaluation of the rotational–vibrational spectra of water vapor, Part III: Energy levels and transition wavenumbers for H216O

    International Nuclear Information System (INIS)

    Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Császár, Attila G.; Daumont, Ludovic; Gamache, Robert R.; Hodges, Joseph T.; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Vandaele, Ann Carine; Zobov, Nikolai F.; Al Derzi, Afaf R.; Fábri, Csaba; Fazliev, Alexander Z.; Furtenbacher, Tibor

    2013-01-01

    This is the third of a series of articles reporting critically evaluated rotational–vibrational line positions, transition intensities, and energy levels, with associated critically reviewed labels and uncertainties, for all the main isotopologues of water. This paper presents experimental line positions, experimental-quality energy levels, and validated labels for rotational–vibrational transitions of the most abundant isotopologue of water, H 2 16 O. The latest version of the MARVEL (Measured Active Rotational–Vibrational Energy Levels) line-inversion procedure is used to determine the rovibrational energy levels of the electronic ground state of H 2 16 O from experimentally measured lines, together with their self-consistent uncertainties, for the spectral region up to the first dissociation limit. The spectroscopic network of H 2 16 O containstwo components, an ortho (o) and a para (p) one. For o-H 2 16 O and p-H 2 16 O, experimentally measured, assigned, and labeled transitions were analyzed from more than 100 sources. The measured lines come from one-photon spectra recorded at room temperature in absorption, from hot samples with temperatures up to 3000 K recorded in emission, and from multiresonance excitation spectra which sample levels up to dissociation. The total number of transitions considered is 184 667 of which 182 156 are validated: 68 027 between para states and 114 129 ortho ones. These transitions give rise to 18 486 validated energy levels, of which 10 446 and 8040 belong to o-H 2 16 O and p-H 2 16 O, respectively. The energy levels, including their labeling with approximate normal-mode and rigid-rotor quantum numbers, have been checked against ones determined from accurate variational nuclear motion computations employing exact kinetic energy operators as well as against previous compilations of energy levels. The extensive list of MARVEL lines and levels obtained are deposited in the supplementary data of this paper, as well as in a distributed information system applied to water, W@DIS, where they can easily be retrieved. -- Highlights: ► All published transitions are collected and analyzed. ► A set of validated transitions are presented. ► About 18 180 experimental energy levels for H 2 16 O are determined. ► Synthetic spectra are presented using these levels

  18. The Mycoplasma hominis P120 membrane protein contains a 216 amino acid hypervariable domain that is recognized by the human humoral immune response

    DEFF Research Database (Denmark)

    Nyvold, Charlotte Guldborg; Birkelund, Svend; Christiansen, Gunna

    1997-01-01

    In the antigenically heterogeneous species Mycoplasma hominis a monoclonal antibody, mAb 26.7D, was previously found to recognize a 120 kDa polypeptide from M. hominis 7488. This antibody did not react with the type strain PG21. The homologous gene from M. hominis PG21 was cloned and sequenced an...... response. Such a variable domain may be important in evasion of the host's immune response, and thus aid survival of the micro-organism....

  19. 5 CFR 792.216 - Are Federal employees with children who are enrolled in summer programs and part-time programs...

    Science.gov (United States)

    2010-01-01

    ... are enrolled in summer programs and part-time programs eligible for the child care subsidy program... summer programs and part-time programs eligible for the child care subsidy program? Federal employees... enrolled in daytime summer programs and part-time programs such as before and after school programs are...

  20. 47 CFR 90.259 - Assignment and use of frequencies in the bands 216-220 MHz and 1427-1432 MHz.

    Science.gov (United States)

    2010-10-01

    ... MHz band are secondary to the Wireless Medical Telemetry Service except in the locations specified in... operations are secondary to the Wireless Medical Telemetry Service in the 1429-1431.5 MHz band. (3) All... 47 Telecommunication 5 2010-10-01 2010-10-01 false Assignment and use of frequencies in the bands...

  1. Early detection of response to experimental chemotherapeutic Top216 with [18F]FLT and [18F]FDG PET in human ovary cancer xenografts in mice

    DEFF Research Database (Denmark)

    Jensen, Mette Munk; Erichsen, Kamille Dumong; Björkling, Fredrik

    2010-01-01

    3'-Deoxy-3'-[(18)F]fluorothymidine ((18)F-FLT) is a tracer used to assess cell proliferation in vivo. The aim of the study was to use (18)F-FLT positron emission tomography (PET) to study treatment responses to a new anti-cancer compound. To do so, we studied early anti-proliferative effects...

  2. Comparative study of physical growth and nutritional status of schoolchildren (1997 and 2009. DOI: 10.5007/1980-0037.2011v13n3p216

    Directory of Open Access Journals (Sweden)

    Zenite Machado

    2011-04-01

    Full Text Available Physical growth and nutritional status are excellent health indicators since they permit the establishment of growth monitoring charts, especially for schoolchildren. The objective of this study was to compare the growth profile and nutritional status of schoolchildren between two samples (1997 and 2009. The data of physical growth and nutritional status obtained for the present sample of 645 schoolchildren (270 boys and 375 girls. The children were classified according to the body mass index (BMI-for-age reference values of the WHO child growth standards. Although no significant differences in height or body weight were observed between the children studied, these variables tended to increase from the first to the second sample and in the two genders. With respect to the adequacy of BMI in boys, there was an increase in the percentage of children with low BMI-for-age, doubling of the percentage of obese children, and a reduction in the percentage of children with overweight. An increase in the number of subjects with low body weight, overweight and obesity and a decrease in the number of subjects with adequate BMI-for-age were noted among girls. In conclusion, there were no significant changes in the physical growth indicators (weight, height and BMI over the period comprising the two samples (1997 and 2009. However, height, body weight and the number of subjects with risk of obesity and obesity tended to increase, especially among girls.

  3. Multibeam collection for KN216-03: Multibeam data collected aboard Knorr from 2014-03-13 to 2014-04-01, Tromso, Norway to Woods Hole, MA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  4. Using SPSS syntax: a beginner's guide Jacqueline Collier Using SPSS syntax: a beginner's guide Sage Pages: 216 £24.99 9781412922180 1412922186 [Formula: see text].

    Science.gov (United States)

    2011-01-21

    As someone who is comfortable with analysing data in SAS using coding language, it is perplexing that I run from the use of syntax in SPSS. But, my apprehension has subsided with the Collier's guide. Syntax command can automate processes, increase reproducibility and give the user broader access to features otherwise unavailable in SPSS.

  5. Proyecto de explotación y construcción de un cebadero en sistema Intensivo para 216 terneros en Velilla de la Sierra (Soria)

    OpenAIRE

    Borjabad Arancón, Ana Isabel

    2017-01-01

    El presente documento corresponde al Trabajo Fin de Grado del alumno Ana Isabel Borjabad Arancón para la Titulación de GRADO EN INGENIERIAS AGRICOLA Y MEDIO RURAL. EL objeto del proyecto consiste en la realización de una explotación de ganado vacuno intensivo, denominado cebadero, incluyendo en dicha realización todas las construcciones necesarias así como el estudio y programa de manejo de la explotación. El promotor del proyecto es un agricultor de Velilla de la Sierra,...

  6. A program to compute three-dimensional subsonic unsteady aerodynamic characteristics using the doublet lattic method, L216 (DUBFLX). Volume 1: Engineering and usage

    Science.gov (United States)

    Richard, M.; Harrison, B. A.

    1979-01-01

    The program input presented consists of configuration geometry, aerodynamic parameters, and modal data; output includes element geometry, pressure difference distributions, integrated aerodynamic coefficients, stability derivatives, generalized aerodynamic forces, and aerodynamic influence coefficient matrices. Optionally, modal data may be input on magnetic file (tape or disk), and certain geometric and aerodynamic output may be saved for subsequent use.

  7. Yankaya Dilek, La nouvelle bourgeoisie islamique. Le modèle turc, Presses universitaires de France, coll. Proche Orient, 2013, 216 p.

    OpenAIRE

    Özatalay , Cem

    2014-01-01

    International audience; Paru en mars 2013, le livre de Dilek Yankaya intitulé La nouvelle bourgeoisie islamique. Le modèle turc apporte une contribution remarquable pour comprendre les dynamiques sociales qui sous-tendent la polarisation politique et culturelle qui marque tout autant l’histoire récente de la Turquie que les événements de Gezi. En mettant en lumière les aspirations et la conscience de classe de la bourgeoisie islamique en formation, Yankaya essaie de montrer dans son ouvrage c...

  8. Yankaya Dilek, La nouvelle bourgeoisie islamique. Le modèle turc, Presses universitaires de France, coll. Proche Orient, 2013, 216 p.

    Directory of Open Access Journals (Sweden)

    Cem Özatalay

    2014-01-01

    Full Text Available Le mouvement de protestation du parc Taksim Gezi au printemps de 2013 a vu s’affronter les deux principales associations patronales de la Turquie : le Tüsiad et le Müsiad. À la différence de Tüsiad, club de grands patrons stambouliotes et pro-occidentalistes ayant offert son soutien, souvent implicitement mais parfois explicitement, aux activistes contestataires, la Müsiad, qui représente majoritairement les chefs d’entreprise des PME, n’a jamais cessé de supporter – ou au moins de ne pas cri...

  9. Diana Elvira Soto Arango. La escuela rural en Colombia. Historias de vida de maestras. Mediados del siglo xx. Tunja: fudesa, 2014. 216 páginas.

    Directory of Open Access Journals (Sweden)

    Doris Lilia Torres

    2015-01-01

    Full Text Available Me honra presentar este libro por dos razones: la primera es personal. Porque he tenido el asunto de la identidad del mestizo como una de mis preocupaciones, a través de la cual he tratado de encontrar las voces que hablan sobre lo que somos y cómo somos. Aunque Gabriel García Márquez universalizó nuestra cultura latinoamericana, no me deja de sorprender que cuando los escritores y periodistas de la Costa Atlántica se refieren a su vida y obra, lo hacen de una manera tan personal y cercana, que se siente cómo experimentan ese realismo mágico correr por su venas. De igual manera, leer el libro La Escuela rural en Colombia. Historias de vida de maestra. Mediados del siglo xx, de la Dra. Diana Elvira Soto, hizo que las emociones surgieran y brotaran con las imágenes, símbolos, descripciones y narraciones de las educadoras que vivieron en este altiplano cundiboyacense. Pude sentir el olor de la vereda, el sonido de la quebrada, la soledad de la escuela, lo mitos de la llorona y la patasola escondidos en los rincones de los salones de clase para apaciguar los ánimos, el frío del páramo del Vijagual en Rondón y la frescura del valle de los Ocobos en Miraflores. También sentí la zozobra y el miedo por la violencia y el desplazamiento de Yacopí a Bogotá. Allí la maestra, la mujer, la líder y madre va caminando por las veredas y municipios de una tierra abandonada y asediada por la corrupción política centralista, buscando un ideal y construyendo comunidades que avanzan con la elaboración mental que da el aprendizaje de la lectura y escritura, en manos de maestras como Amparo y Andrea, que creyeron en la construcción de comunidades más justas y menos discriminadas a través de la enseñanza de las letras y el lenguaje.

  10. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  11. A simple method for labelling proteins with 211At via diazotized aromatic diamine

    International Nuclear Information System (INIS)

    Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.

    1987-01-01

    A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)

  12. The Installation Restoration Program Toxicology Guide. Volume 2

    Science.gov (United States)

    1987-05-01

    Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol

  13. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Koziorowski, J.

    1998-01-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of

  14. Charge radii and electromagnetic moments of At-211195

    Science.gov (United States)

    Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.

    2018-05-01

    Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.

  15. Escritos sobre Hitchcock: notas sobre dos libros : Chabrol Claude y Rohmer Eric, Hitchcock, Buenos Aires, Manantial, 2010, 216 p. Camille Paglia, Los pájaros. Alfred Hitchcock, Barcelona, Gedisa, 2006, 142 p.

    OpenAIRE

    Mutchinick, Melissa

    2011-01-01

    Alfred Joseph Hitchcock falleció en Los Ángeles el 29 de abril de 1980. En el tiempo transcurrido, su trayectoria no ha dejado de alimentar un amplio caudal de publicaciones y de estudios dedicados a su obra. Figura de culto, tanto entre los cinéfilos como en el imaginario colectivo, es capaz de despertar pasiones desmedidas o rechazos acérrimos, pero difícilmente indiferencia. Gran parte de este reconocimiento se debe a los críticos de Cahiers du cinéma, quienes con sus escritos reivindic...

  16. Wind-Tunnel Tests of Ailerons at Various Speeds. 1 - Ailerons of 0.20 Airfoil Chord and Tube Contour with 0.35 Aileron-Chord Extreme Blunt Nose Balance on the NACA 66,2-216 Airfoil

    Science.gov (United States)

    1943-06-01

    which includes effectelof boundary layer at the tunnel wall and of gaps at the ends of the aileron as well as the effects of any cross flow over the...the gap width cauaed a d? urease in the slope except at the highest speed tested where an increase in gap resulted in an increase in the slope. Figure 13

  17. IUPAC critical evaluation of the rotational–vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O

    International Nuclear Information System (INIS)

    Tennyson, Jonathan; Bernath, Peter F.; Brown, Linda R.; Campargue, Alain; Császár, Attila G.; Daumont, Ludovic; Gamache, Robert R.; Hodges, Joseph T.; Naumenko, Olga V.; Polyansky, Oleg L.; Rothman, Laurence S.; Vandaele, Ann Carine; Zobov, Nikolai F.; Dénes, Nóra; Fazliev, Alexander Z.

    2014-01-01

    This paper is the fourth of a series of papers reporting critically evaluated rotational–vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D 2 16 O, D 2 17 O, and D 2 18 O. The MARVEL (Measured Active Rotational–Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0–14 016, 0–7969, and 0–9108 cm −1 for D 2 16 O, D 2 17 O, and D 2 18 O, respectively. For D 2 16 O, D 2 17 O, and D 2 18 O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D 2 16 O, D 2 17 O, and D 2 18 O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm −1 , from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved. - Highlights: • All published transitions are collected and analyzed. • A set of validated rovibrational transitions are presented. • Experimental energy levels for all three D 2 O isotopologues are determined. • Synthetic spectra are presented using these validated energy levels

  18. Genetic variability and bottleneck analyses of Kanni adu goat population using microsatellite markers [Also published in The Indian Journal of Small Ruminants, 2015, 21(2): 216-22

    International Nuclear Information System (INIS)

    Jeyakumar, M.; Thiruvenkadan, R.; Saravana, R.; Periasamy, K.

    2016-01-01

    Full text: Microsatellite data on 25 loci were generated and utilized to evaluate the genetic architecture and mutation drift equilibrium of Kanni Adu goats of southern Tamil Nadu. The genetic diversity analysis of Kanni Adu goats displayed higher level of within breed variability in terms of mean number of alleles per locus (11.24±0.87) and heterozygosity values (Ho= 0.677±0.041, He=0.857±0.016). Within population inbreeding estimate (FIS=0.215±0.040) showed moderate level of inbreeding, which warrant adoption of appropriate breeding strategies under field conditions. The polymorphism information content (PIC) value ranged from 0.531 to 0.915 suggested higher polymorphism in this breed. In general, the sign, standardized differences and Wilcoxon rank tests indicated heterozygosity excess in Kanni Adu goat population in infinite alleles and two-phase model and non-significant in stepwise mutation model. Hence, the mode-shift indicator test was utilized and it indicated the absence of genetic bottleneck in the recent past in Kanni Adu goats. It suggests that any unique alleles present in this breed may not have been lost. The study indicated that Kanni adu goats exhibited substantial amount of genetic variation as reflected from the heterozygosity and number of alleles per locus. (author)

  19. Hyperspectral surface materials map of quadrangles 3668 and 3768, Baghlan (221), Taluqan (222), Imam Sahib (215), and Rustaq (216) quadrangles, Afghanistan, showing iron-bearing minerals and other materials

    Science.gov (United States)

    King, Trude V.V.; Hoefen, Todd M.; Kokaly, Raymond F.; Livo, Keith E.; Johnson, Michaela R.; Giles, Stuart A.

    2013-01-01

    This map shows the spatial distribution of selected iron-bearing minerals and other materials derived from analysis of airborne HyMap™ imaging spectrometer (hyperspectral) data of Afghanistan collected in late 2007. This map is one in a series of U.S. Geological Survey/Afghanistan Geological Survey quadrangle maps covering Afghanistan. Flown at an altitude of 50,000 feet (15,240 meters (m)), the HyMap™ imaging spectrometer measured reflected sunlight in 128 channels, covering wavelengths between 0.4 and 2.5 μm. The data were georeferenced, atmospherically corrected and converted to apparent surface reflectance, empirically adjusted using ground-based reflectance measurements, and combined into a mosaic with 23-m pixel spacing. Variations in water vapor and dust content of the atmosphere, in solar angle, and in surface elevation complicated correction; therefore, some classification differences may be present between adjacent flight lines. The reflectance spectrum of each pixel of HyMap™ imaging spectrometer data was compared to the reference materials in a spectral library of minerals, vegetation, water, and other materials. Minerals occurring abundantly at the surface and those having unique spectral features were easily detected and discriminated, while minerals having slightly different compositions but similar spectral features were less easily discriminated; thus, some map classes consist of several minerals having similar spectra, such as “Goethite and jarosite.” A designation of “Not classified” was assigned to the pixel when there was no match with reference spectra.

  20. Overexpression of CDC25B, CDC25C and phospho-CDC25C (Ser216) in vulvar squamous cell carcinomas are associated with malignant features and aggressive cancer phenotypes

    OpenAIRE

    Wang, Zhihui; Trope, Claes G; Fl?renes, Vivi Ann; Suo, Zhenhe; Nesland, Jahn M; Holm, Ruth

    2010-01-01

    Background CDC25 phosphatases are important regulators of the cell cycle. Their abnormal expression detected in a number of tumors implies that their dysregulation is involved in malignant transformation. However, the role of CDC25s in vulvar cancer is still unknown. To shed light on their roles in the pathogenesis and to clarify their prognostic values, expression of CDC25A, CDC25B and CDC25C in a large series of vulvar squamous cell carcinomas were examined. ...

  1. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    1995-07-01

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  2. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available uery: 121 QVPVNAIASSGTSEQALFTGAGERDKESISNMRTIAAAARKAGMEVTELIVPGAGHDW 178 ... QVPVNAIASSGTSEQALFTGAGERD...KESISNMRTIAAAARKAGMEVTELIVPGAGHDW Sbjct: 159 QVPVNAIASSGTSEQALFTGAGERDKESISNMRTIAAAARKAGMEVTELIVPGAGHDW 216

  3. ??????????? ??????????? ?????? ?????????????? ??????????-????????? ???????? ????????? ?????? ?? ?? ????? ?????????? ? ?????????? ????????? ??????

    OpenAIRE

    ????????, ?. ?.

    2015-01-01

    ??????? ???????????, ???????? ? ?????????? ????????? ??????????? ?????????????? ??????????-????????? ?????????? ?????? ?? ?? ???. 56 ?? ?? ????? ?????????????. ????????????????? ??????? ??? ??????????? ????????? ????????????? ??????? ??????????-???????? ???????? ?????? ? ????????????? ????????? 21,6 ? ? ????????? ?-6+2?0,85 ?, ????????? ? 1969 ?. ?? ?? ???. 56. ????????????? ?? ??????????? ?????????? ???????? ?? ?-8+2?1,5 ? ?????????? ?????????????? ????????? ?????? ?? ?????????? ...

  4. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GDP Sbjct: 1 ... LSAGPAKKSLGAKRGRAVTLTDLASEEAPPPRAMSGIGELDRVLGGGLVPASAILVGGDP 60 ... Query: 157 TTLEAEKPGLVIIDSIQTMWADNVDSAPGSVSQVRASAHEL...TTFAKRTGISVIMVGHVTK 216 ... TTLEAEKPGLVIIDSIQTMWADNVDSAPGSVSQVRASAHELTTFAKRTG...ISVIMVGHVTK Sbjct: 121 TTLEAEKPGLVIIDSIQTMWADNVDSAPGSVSQVRASAHELTTFAKRTGISVIMVGHV

  5. ORF Alignment: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available E Sbjct: 1 ... GPSSNTGAKGVLNEFKAFREQTRLAVESKNQKLIEQAKKGMMIGSKEEREKAQREDDEDE 60 ... Query: 164 LTRIVKILAADCPKTKFVR...ATSTLLEMSRAFRTNGVPCLQFYSNGNLIGNFVK 216 ... LTRIVKILAADCPKTKFVRATSTLLEMSRAFRTNGVPCLQFYSNGNLIGNFVK Sbjct: 121 LTRIVKILAADCPKTKFVRATSTLLEMSRAFRTNGVPCLQFYSNGNLIGNFVK 173

  6. ORF Alignment: NC_002505 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available oup ... O1) ... Length = 67 ... Query: 216 MSKGIQALEEDRALLMAGISHDIRTPLTRIRLATEMMSPEDSYLAESIISDTEE...CNQIIS 275 ... MSKGIQALEEDRALLMAGISHDIRTPLTRIRLATEMMSPEDSYLAESIISDTEECNQIIS Sbjct: 1 ... MSKGIQALEEDRALLMAGISHDIRTPLTRIRLATEMMSPEDSYLAESIISDTEECNQIIS 60 ...

  7. Glomerular filtration rate after alpha-radioimmunotherapy with 211At-MX35-F(ab')2: a long-term study of renal function in nude mice

    DEFF Research Database (Denmark)

    Back, T.; Haraldsson, B.; Hultborn, R

    2009-01-01

    of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...

  8. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  9. Chemical concentration of a new natural spontaneously fissionable nuclide from solutions with low salt background

    International Nuclear Information System (INIS)

    Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.

    1982-01-01

    The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes

  10. Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?

    International Nuclear Information System (INIS)

    Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.

    2011-01-01

    Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.

  11. Boiling points of the superheavy elements 117 and 118

    International Nuclear Information System (INIS)

    Takahashi, N.

    2001-01-01

    It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)

  12. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...

  13. Hot wire production of single-wall and multi-wall carbon nanotubes

    Science.gov (United States)

    Dillon, Anne C.; Mahan, Archie H.; Alleman, Jeffrey L.

    2010-10-26

    Apparatus (210) for producing a multi-wall carbon nanotube (213) may comprise a process chamber (216), a furnace (217) operatively associated with the process chamber (216), and at least one filament (218) positioned within the process chamber (216). At least one power supply (220) operatively associated with the at least one filament (218) heats the at least one filament (218) to a process temperature. A gaseous carbon precursor material (214) operatively associated with the process chamber (216) provides carbon for forming the multi-wall carbon nanotube (213). A metal catalyst material (224) operatively associated with the process (216) catalyzes the formation of the multi-wall carbon nanotube (213).

  14. Dicty_cDB: SSH838 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 630 e-177 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 8e-55 2 X85119 |X85119.1 Artificial sequences cloning... vector DNA pDXA-3H. 216 8e-55 2 X85122 |X85122.1 Artificial sequences cloning...X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 8e-55 2 X85123 |X85123.1 Artificial sequences cloning...FLAG, complete sequence. 216 8e-55 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 9

  15. Dicty_cDB: SSE603 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ector pDXA-3strep. 216 9e-54 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 9e-54 2... X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 9e-54 2 AJ510165 |AJ510165.1 Cloning ...vector pDXA-3FLAG. 216 9e-54 2 X85118 |X85118.1 Artificial sequences cloning vect...or DNA pDXA-3C. 216 9e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 9e-54 2 AF...269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 9e-54 2 X85120 |X85120.1 Artificial sequences cloning

  16. Dicty_cDB: SSE172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available trep. 216 3e-54 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3...H. 216 3e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 3e-54 2 AJ510165 |AJ510...165.1 Cloning vector pDXA-3FLAG. 216 3e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3...C. 216 3e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. ...216 3e-54 2 AF269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 3e-54 2 X85120 |X85120.1 Artificial sequences cloni

  17. Dicty_cDB: SSH692 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pDXA-3strep. 216 7e-55 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 7e-55 2 X8512...2 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 7e-55 2 AJ510165... |AJ510165.1 Cloning vector pDXA-3FLAG. 216 7e-55 2 X85118 |X85118.1 Artificial sequences cloning vector DNA... pDXA-3C. 216 7e-55 2 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 7e-55 2 AF269236...120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 8e-55 2 AJ510166 |AJ510166.1 Cloning vector pDXA-

  18. Consommation des produits lactés chez l’enfant et l’adolescent marocain de 2 à 16 ans: une étude monocentrique Consumption of milk products among Moroccan children and adolescents aged 2-16 years: a monocentric study

    Science.gov (United States)

    Berrani, Hajar; Alaoui, Asmae Mdaghri; Ettair, Said; Mouane, Nezha; Izgua, Amal Thimou

    2017-01-01

    Introduction Evaluer la consommation quotidienne des produits laitiers dans une population d’enfants marocains et déterminer les facteurs associés pouvant influencer cette consommation. Méthodes Etude prospective du 1er octobre 2013 au 31 avril 2014. Les enfants âgés entre 2 et 16 ans ont été inclus. Le recrutement a eu lieu dans la ville de Fès. Le recueil des données s’est fait à l’aide d’un questionnaire fréquentiel. Les parents et les enfants inclus ont été interrogés sur la consommation des produits laitiers et les facteurs socio-démographiques avec une évaluation anthropométrique des enfants. L’association des variables à la consommation des produits laitiers a été analysée en analyse univariée et multivariée par un modèle de régression logistique. Résultats L’enquête alimentaire avait intéressé 286 enfants dont 151 filles (52,8 %) et 131 garçons (45,8%). Les enfants âgés de 2 à 3 ans représentaient 26,4 %, ceux âgés de 4 à 7 ans 28,9 %, ceux âgés de 7 à 9 ans 18,3 % et les adolescents âgés de 10 à 16 ans 26,4 %. Les enfants consommaient en moyenne 2.5±1 produits laitiers par jour. Les enfants consommaient au moins 3 produits laitiers par jour dans 57,8% chez les enfants âgés de 2 à 3 ans, 53,6% chez les enfants âgés de 4 à 6 ans, 40% chez les enfants âgés de 7 à 9 ans et 41.2% chez les enfants âgés de 10 à 16 ans. Les facteurs associés à la consommation de trois produits laitiers minimum par jour en analyse univariée étaient le niveau d’instruction maternel analphabète p 90° percentiles p 90° percentiles p = 0.01 OR = 3.9 est et la quantité consommée des produits laitiers et négatif avec le faible niveau de scolarité maternel analphabète p = 0.008 OR = 0.1 et primaire p = 0.009 OR = 0.1. Conclusion La consommation du lait et des autres produits laitiers était inappropriée en particulier chez l’enfant âgé de 7 à 9 ans et l’adolescent de 10 à 16 ans. Le faible niveau d’éducation maternel et un indice de masse corporelle supérieur au 90° percentiles était des facteurs indépendamment associés à la consommation de moins de 3 produits laitiers par jour. La sensibilisation des parents et des enfants sur l’intérêt du lait et de ses dérivés dans l’alimentation de l’enfant est indispensable. PMID:29515743

  19. A virtual microscope for academic medical education: the pate project.

    Science.gov (United States)

    Brochhausen, Christoph; Winther, Hinrich B; Hundt, Christian; Schmitt, Volker H; Schömer, Elmar; Kirkpatrick, C James

    2015-05-11

    Whole-slide imaging (WSI) has become more prominent and continues to gain in importance in student teaching. Applications with different scope have been developed. Many of these applications have either technical or design shortcomings. To design a survey to determine student expectations of WSI applications for teaching histological and pathological diagnosis. To develop a new WSI application based on the findings of the survey. A total of 216 students were questioned about their experiences and expectations of WSI applications, as well as favorable and undesired features. The survey included 14 multiple choice and two essay questions. Based on the survey, we developed a new WSI application called Pate utilizing open source technologies. The survey sample included 216 students-62.0% (134) women and 36.1% (78) men. Out of 216 students, 4 (1.9%) did not disclose their gender. The best-known preexisting WSI applications included Mainzer Histo Maps (199/216, 92.1%), Histoweb Tübingen (16/216, 7.4%), and Histonet Ulm (8/216, 3.7%). Desired features for the students were latitude in the slides (190/216, 88.0%), histological (191/216, 88.4%) and pathological (186/216, 86.1%) annotations, points of interest (181/216, 83.8%), background information (146/216, 67.6%), and auxiliary informational texts (113/216, 52.3%). By contrast, a discussion forum was far less important (9/216, 4.2%) for the students. The survey revealed that the students appreciate a rich feature set, including WSI functionality, points of interest, auxiliary informational texts, and annotations. The development of Pate was significantly influenced by the findings of the survey. Although Pate currently has some issues with the Zoomify file format, it could be shown that Web technologies are capable of providing a high-performance WSI experience, as well as a rich feature set.

  20. Dicty_cDB: SSL190 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 Cloning vector pDXA-3strep. 216 3e-67 3 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H.... 216 3e-67 3 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 2...16 3e-67 3 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 3e-67 3 X85118 |X85118.1 Artificial sequences cloning... vector DNA pDXA-3C. 216 3e-67 3 X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 2...3e-67 3 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 3e-67 3 AJ510166 |AJ510166.1 C

  1. Dicty_cDB: SSM804 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 3e-54 2... X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 3e-54 2 AJ510165 |AJ510165.1 Cloning ...vector pDXA-3FLAG. 216 3e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 3e-54 2... X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 3e-54 2 AF...269236 |AF269236.1 Cloning vector pDXA-FLAG, complete sequence. 216 3e-54 2 X85120 |X85120.1 Artificial sequences cloning

  2. Dicty_cDB: SSJ694 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Artificial sequences cloning vector DNA pDXA-3H. 216 8e-54 2 X85122 |X85122.1 Artificial sequences cloni...216 8e-54 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 8e-54 2 X85123 |X85123.1 Artificial sequences cloni...Cloning vector pDXA-FLAG, complete sequence. 216 8e-54 2 X85120 |X85120.1 Artificial sequences cloning vecto...steine proteinase 1. 1217 0.0 1 AJ510164 |AJ510164.1 Cloning vector pDXA-3strep. 216 8e-54 2 X85119 |X85119....ng vector DNA pDXA-HY. 216 8e-54 2 AJ510165 |AJ510165.1 Cloning vector pDXA-3FLAG.

  3. Dicty_cDB: SSE437 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 64 |AJ510164.1 Cloning vector pDXA-3strep. 216 6e-54 2 X85119 |X85119.1 Artificial sequences cloning vector ...DNA pDXA-3H. 216 6e-54 2 X85122 |X85122.1 Artificial sequences cloning vector DNA pDXA-HY. 216 6e-54 2 AJ510...165 |AJ510165.1 Cloning vector pDXA-3FLAG. 216 6e-54 2 X85118 |X85118.1 Artificial sequences cloning... vector DNA pDXA-3C. 216 6e-54 2 X85123 |X85123.1 Artificial sequences cloning vector DNA...X85120.1 Artificial sequences cloning vector DNA pDXD-3H. 216 7e-54 2 AJ510166 |A

  4. What is Mine is Yours: The Art of Operational Integration

    Science.gov (United States)

    2016-05-10

    141 Dorn, Walkout, 67-68. 142 Stilwell, The Stilwell Papers, 77. 143 Max Hastings, Retribution (New York: Alfred A. Knopf, 2008), 216. 144...impose the urgency of the situation in Burma on 152 Stilwell, The Stilwell Papers, 90. 153 Hastings, Retribution , 216. 154 Dorn, Walkout, 86. 155...to the Rhine, 33. 171 Tombin, With Utmost Spirit, 385,388. 172 Hastings, Retribution , 216. 173 Davies, Dragon by the Tail, 262. 174 Bagby

  5. ORF Alignment: NC_003075 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available DNA-binding protein ... 19) ... Length = 153 ... Query: 96 ... EGCQKGARDASGRCISH...GGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGS 155 ... EGCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKA...HGGGRRCEYLGCTKGAEGS Sbjct: 1 ... EGCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGS 60 ... Query: 216 K

  6. ORF Alignment: NC_002488 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available uery: 96 ... ERKRMERRLAESEVRFNILADGLPMPVWVFDAQGGMRFVNTAYGEFFGVDLSSGTVPEWS 155 ... ERKRMERRLAESEVRFNILADGLPMPVWVFDAQGGMRFV...NTAYGEFFGVDLSSGTVPEWS Sbjct: 1 ... ERKRMERRLAESEVRFNILADGLPMPVWVFDAQGGMRFVNTAYGEFFGVDLSSGTVPEWS 60 ... Query: 216 SSPDVT 221 ... SSPDVT Sbjct: 121 SSPDVT 126

  7. Dicty_cDB: SSL359 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 2 X85119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 2e-54 2 X85122 |X85122.1 Artificial sequences cloning...4 2 X85118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 2e-54 2... X85123 |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 2e-54 2 AF269236 |AF269236.1 Cloning ...vector pDXA-FLAG, complete sequence. 216 2e-54 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pD

  8. Dicty_cDB: SSH510 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 119 |X85119.1 Artificial sequences cloning vector DNA pDXA-3H. 216 1e-54 2 X85122 |X85122.1 Artificial sequences cloning...118 |X85118.1 Artificial sequences cloning vector DNA pDXA-3C. 216 1e-54 2 X85123... |X85123.1 Artificial sequences cloning vector DNA pDXA-HC. 216 1e-54 2 AF269236 |AF269236.1 Cloning vector ...pDXA-FLAG, complete sequence. 216 1e-54 2 X85120 |X85120.1 Artificial sequences cloning vector DNA pDXD-3H.

  9. 48 CFR 5119.1005 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... SMALL BUSINESS AND SMALL DISADVANTAGED BUSINESS CONCERNS Small Business Competitiveness Demonstration... Z216. This includes both maintenance dredging and new start (new work) construction dredging. Dredging...

  10. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... fischeri ES114] ... Length = 67 ... Query: 216 MSKGIQKLEQDRALLMAGVSHDIRTPLTRIRLATEMMSPEDSYLAESMIK...DTEECNEIIG 275 ... MSKGIQKLEQDRALLMAGVSHDIRTPLTRIRLATEMMSPEDSYLAESMIKDTEEC...NEIIG Sbjct: 1 ... MSKGIQKLEQDRALLMAGVSHDIRTPLTRIRLATEMMSPEDSYLAESMIKDTEECNEIIG 60 ...

  11. 48 CFR 1816.307-70 - NASA contract clauses.

    Science.gov (United States)

    2010-10-01

    ... officer may insert a clause substantially as stated at 1852.216-87, Submission of Vouchers for Payment, in... ADMINISTRATION CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Cost-Reimbursement Contracts 1816.307-70... clause at 1852.216-75, Payment of Fixed Fee, in cost-plus-fixed-fee contracts. Modifications to the...

  12. Ataxia, Dementia, and Hypogonadotropism Caused by Disordered Ubiquitination

    DEFF Research Database (Denmark)

    Margolin, David H.; Kousi, Maria; Chan, Yee-Ming

    2013-01-01

    and a deubiquitinase, respectively, were found in three affected siblings in a consanguineous family. Additional screening identified compound heterozygous truncating mutations in RNF216 in an unrelated patient and single heterozygous deleterious mutations in four other patients. Knockdown of rnf216 or otud4...

  13. Integrated stratigraphy of the Jurassic-Cretaceous sequences of the Kurovice Quarry, Outer Western Carpathians: correlations and tectonic implications

    Czech Academy of Sciences Publication Activity Database

    Pruner, Petr; Schnabl, Petr; Čížková, Kristýna; Elbra, Tiiu; Kdýr, Šimon; Svobodová, Andrea; Reháková, D.

    2017-01-01

    Roč. 120 (2017), s. 216-216 ISSN 1017-8880. [International Symposium on the Cretaceous /10./. 21.08.2017-26.08.2017, Vienna] R&D Projects: GA ČR(CZ) GA16-09979S Institutional support: RVO:67985831 Keywords : stratigraphy * Jurassic-Cretaceous sequences * Western Carpathians Subject RIV: DB - Geology ; Mineralogy

  14. 78 FR 12799 - Notice of Intent To Grant Exclusive License

    Science.gov (United States)

    2013-02-25

    ... the invention described and claimed in U.S. Patent Application Serial No. US 13/ 534,804, Alpha-Stream... industries. The patent rights in these inventions as applicable have been assigned to the United States of... Rd, Cleveland OH 44135. Phone (216) 433-5754. Facsimile (216) 433-6790. FOR FURTHER INFORMATION...

  15. 75 FR 16876 - Proposed Data Collection Available for Public Comment and Recommendations.

    Science.gov (United States)

    2010-04-02

    ... (RRA) provides for the payment of disability annuities to qualified employees. Section 2 also provides... 20 CFR 216.21-216.23. Certain types of work may actually indicate an annuitant's recovery from disability. Regulations related to an annuitant's recovery from disability of work are prescribed in 20 CFR...

  16. 76 FR 71922 - Defense Federal Acquisition Regulation Supplement: Separation of Combined Provisions and Clauses...

    Science.gov (United States)

    2011-11-21

    ..., using any of the following methods: [cir] Regulations.gov : http://www.regulations.gov . Submit comments... Training 252.209-7003, Reserve Officer Corps and Military Recruiting on Training Corps and Military Campus. Recruiting on Campus-- Representation. 252.216-7000, Economic Price 252.216-70XX, Economic Price Adjustment...

  17. 75 FR 28074 - Advisory Committee on Reactor Safeguards

    Science.gov (United States)

    2010-05-19

    ..., 2009, (74 FR 52829-52830). Wednesday, June 9, 2010, Conference Room T2-B1, Two White Flint North... Regulatory Guide (RG) 1.216, ``Containment Structural Integrity Evaluation for Internal Pressure Loadings... representatives of the NRC staff regarding draft final RG 1.216, ``Containment Structural Integrity Evaluation for...

  18. Cosmogenic Radionuclides in Bunburra Rockhole Achondrite Fall

    Czech Academy of Sciences Publication Activity Database

    Welten, K.C.; Nishiizumi, K.; Caffee, M. W.; Meier, M.M.M.; Bland, P.A.; Spurný, Pavel

    2009-01-01

    Roč. 44, Supplement (2009), A216-A216 ISSN 1086-9379. [Annual Meeting of the Meteoritical Society /72./. Nancy, 13.06.2009-18.06.2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : Bunburra Rockhole * cosmogenic radionuclide concentrations Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.253, year: 2009

  19. 76 FR 28986 - Agency Information Collection Request. 30-Day Public Comment Request

    Science.gov (United States)

    2011-05-19

    ... through a variety of research methods for developing and testing communications involving health....50 216 Screening for General Public Focus Group 2,160 1 10/60 360 Interviews Web usability testing sessions 144 1 1.50 216 Screening for Web usability testing 2,160 1 10/60 360 Self-Administered Surveys 2...

  20. Review for the Korean Health Professionals and International Cooperation Doctors Dispatched to Peru by the Korea International Cooperation Agency (KOICA).

    Science.gov (United States)

    Kim, Bongyoung

    2015-04-01

    South Korea dispatches Korean nationals to partner developing countries as an Official Development Assistance (ODA) project through the Korea International Cooperation Agency (KOICA). In the health sector, KOICA dispatches international cooperation doctors (ICDs), nurses, physical therapists, radiologic technologists, nutritionists, medical laboratory technologists, occupational therapists, and dental hygienists. A total of 216 ICDs were dispatched over 19 times from 1995 until 2013. There were 19 areas of specialties among the ICDs. The most common specialty was internal medicine (61/216, 28.2%), the second most common specialty was general surgery (43/216, 19.9%), followed by oriental medicine (27/216, 12.5%), pediatrics (17/216, 7.9%), orthopedics (16/216, 7.4%), family medicine (16/216, 7.4%), and odontology (14/216, 6.5%). The ICDs have worked in 21 countries. KOICA dispatched the highest number of ICDs to Asia (97/216, 44.9%), followed by Africa (50/216, 23.1%), Latin America (34/216, 15.7%), the commonwealth of independent states (31/216, 14.4%), and Oceania (4/216, 1.9%). Nobody was dispatched to the Middle East. A total of 134 KOICA health professionals were dispatched to Peru from 1996 until October 1, 2014. Of these, 19.4% (26/134) were ICDs, 44.8% (60/216) were nurses, 20.1% (27/134) were physical therapists, 6.7% (9/134) were radiologic technologists, 2.2% (3/134) were nutritionists, and 6.7% (9/134) were medical laboratory. ICDs' specialties comprised internal medicine (13/26, 50%), family medicine (8/26, 30.8%), pediatrics (2/26, 7.7%), otorhinolaryngology (1/26, 3.8%), orthopedics (1/26, 3.8%), and oriental medicine (1/26, 3.8%). Most of the dispatched health professionals worked at institutions that were supported by KOICA. For this reason, the proportion of health professionals who worked at public health centers (PHCs) was the highest (58.2%, 78/134) when classified by workplace type. Other KOICA health professionals worked at hospitals