WorldWideScience

Sample records for astatine 208

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. 208 LISP

    Indian Academy of Sciences (India)

    IAS Admin

    Resonance journal of science education. March 2014 Volume 19 Number 3. GENERALARTICLES. 198 John McCarthy – Father of Artificial Intelligence. V Rajaraman. 208 LISP. Harish Karnick. 222 Elementary? Question Answering, IBM's Watson, and the Jeopardy! Challenge. Raman Chandrasekar. 242 Cloud Computing.

  12. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  13. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  14. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  15. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  16. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  17. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  18. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  19. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  20. Comment: 208 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Anopheles stephensi Anopheles stephensi Anopheles_stephensi_L.png 208.png Public Do...main CDC(Centers for Disease Control and Prevention)のimage libraryから(Public Domain) http://phil.cdc.gov/phil/home.asp bando 2010/02/15 14:45:35 2010/02/15 14:48:55 ...

  1. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  2. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  4. 24 CFR 208.108 - Requirements.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Requirements. 208.108 Section 208... MULTIFAMILY SUBSIDIZED PROJECTS § 208.108 Requirements. (a) Projects specified in § 208.104(a) that are... data requirements and in lieu of the hard copy forms. ...

  5. 22 CFR 208.920 - Civil judgment.

    Science.gov (United States)

    2010-04-01

    ... creates a civil liability for the complained of wrongful acts, or a final determination of liability under... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Civil judgment. 208.920 Section 208.920 Foreign...) Definitions § 208.920 Civil judgment. Civil judgment means the disposition of a civil action by any court of...

  6. 23 CFR 633.208 - Maintenance.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Maintenance. 633.208 Section 633.208 Highways FEDERAL... PROVISIONS Federal-Aid Contracts (Appalachian Contracts) § 633.208 Maintenance. Maintenance of all highway... responsibility of the State. The State may arrange for maintenance of such roads or portions thereof, by...

  7. 30 CFR 90.208 - Bimonthly sampling.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Bimonthly sampling. 90.208 Section 90.208... MANDATORY HEALTH STANDARDS-COAL MINERS WHO HAVE EVIDENCE OF THE DEVELOPMENT OF PNEUMOCONIOSIS Sampling Procedures § 90.208 Bimonthly sampling. (a) Each operator shall take one valid respirable dust sample for...

  8. 40 CFR 92.208 - Certification.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Certification. 92.208 Section 92.208... POLLUTION FROM LOCOMOTIVES AND LOCOMOTIVE ENGINES Certification Provisions § 92.208 Certification. (a) This... the application for certification, test reports and data acquired from a freshly manufactured...

  9. 5 CFR 179.208 - Certification.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Certification. 179.208 Section 179.208... Salary Offset § 179.208 Certification. (a) OPM salary offset coordinator shall provide a certification to... certification must be in writing and must state: (1) That the employee owes the debt; (2) The amount and basis...

  10. 40 CFR 90.208 - Certification.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Certification. 90.208 Section 90.208... EMISSIONS FROM NONROAD SPARK-IGNITION ENGINES AT OR BELOW 19 KILOWATTS Certification Averaging, Banking, and Trading Provisions § 90.208 Certification. (a) In the application for certification a manufacturer must...

  11. 40 CFR 94.208 - Certification.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Certification. 94.208 Section 94.208... EMISSIONS FROM MARINE COMPRESSION-IGNITION ENGINES Certification Provisions § 94.208 Certification. (a) If, after a review of the application for certification, test reports and data acquired from an engine or...

  12. 46 CFR 153.208 - Ballast equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Ballast equipment. 153.208 Section 153.208 Shipping... BULK LIQUID, LIQUEFIED GAS, OR COMPRESSED GAS HAZARDOUS MATERIALS Design and Equipment General Vessel Requirements § 153.208 Ballast equipment. (a) Except for the arrangement described in paragraph (b) of this...

  13. 37 CFR 2.208 - Deposit accounts.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Deposit accounts. 2.208 Section 2.208 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Fees and Payment of Money in Trademark Cases § 2.208 Deposit...

  14. 7 CFR 1400.208 - Family members.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Family members. 1400.208 Section 1400.208 Agriculture... SUBSEQUENT CROP, PROGRAM, OR FISCAL YEARS Payment Eligibility § 1400.208 Family members. (a) Notwithstanding... persons, a majority of whom are family members, an adult family member who makes a significant...

  15. 31 CFR 208.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Definitions. 208.2 Section 208.2 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS § 208.2...

  16. 31 CFR 208.4 - Waivers.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Waivers. 208.4 Section 208.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS § 208.4...

  17. 7 CFR 330.208 - Courtesy permits.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Courtesy permits. 330.208 Section 330.208 Agriculture... PRODUCTS; GARBAGE Movement of Plant Pests § 330.208 Courtesy permits. The Deputy Administrator may issue... subject to regulation under the Plant Protection Actor any other act, as a courtesy to facilitate movement...

  18. 8 CFR 208.19 - Decisions.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Decisions. 208.19 Section 208.19 Aliens and... communicated in writing to the applicant. Pursuant to § 208.9(d), an applicant must appear in person to receive... communicating denial of asylum or referral of the application shall state the basis for denial or referral and...

  19. 24 CFR 208.112 - Cost.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cost. 208.112 Section 208.112... MULTIFAMILY SUBSIDIZED PROJECTS § 208.112 Cost. (a) The costs of the electronic transmission of the correctly... cost of contracting for those services, or the cost of centralizing the electronic transmission...

  20. Compton scattering on $^{208}$Pb

    CERN Document Server

    Alberico, W M

    1982-01-01

    The authors briefly review the formalism of the nuclear Compton scattering in the frame of the low-energy theorems (LET). They treat the resonant terms of the amplitude, having collective intermediate nuclear states, as a superposition of Lorentz lines with energy, width and strength fixed by the photo-absorption experiments. The gauge terms are evaluated starting from a simple, but realistic, nuclear Hamiltonian. Dynamical nucleon-nucleon correlations are consistently taken into account, beyond those imposed by the Pauli principle. The comparison of the theoretical predictions with the data of elastic diffusion of photons from /sup 208/Pb shows that LET are insufficient to account for the experiment.

  1. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  2. Dicty_cDB: CHP208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP208 (Link to dictyBase) - - - Contig-U16405-1 CHP208P (Link to Original site) CHP...208F 593 CHP208Z 657 CHP208P 1230 - - Show CHP208 Library CH (Link to library) Clone ID CHP...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHP2-A/CHP208Q.Seq.d/ Representative seq. ID CHP...208P (Link to Original site) Representative DNA sequence >CHP208 (CHP208Q) /CSM/CH/CHP2-A/CHP...i*nq*fqkfqplkiklkkvf*q*fvvivlqixsmqa*qfhqk lflfhvi*nvvyhqmkylmiviqvklilqivilivyhaipvqv*kihqeyyxsyltqhhf nimsqlkklnyxhhqtlvkxmlklnhp

  3. Dicty_cDB: SLF208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF208 (Link to dictyBase) - - - Contig-U16475-1 SLF208P (Link to Original site) SLF...208F 224 SLF208Z 594 SLF208P 818 - - Show SLF208 Library SL (Link to library) Clone ID SLF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLF2-A/SLF208Q.Seq.d/ Representative seq. ID SLF...208P (Link to Original site) Representative DNA sequence >SLF208 (SLF208Q) /CSM/SL/SLF2-A/SLF2...Amino Acid sequence ILLYLLNITTAQKPVSINIKIFDQLPLYNDNFGSQSRAATIKSMVATSLNTTFKTPSLGS ATSSLPSPQLFQYW--- ---GCNATQ

  4. Dicty_cDB: CHR208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR208 (Link to dictyBase) - - - Contig-U16403-1 - (Link to Original site) - - CHR...208Z 421 - - - - Show CHR208 Library CH (Link to library) Clone ID CHR208 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHR2-A/CHR208Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHR208 (CHR208Q) /CSM/CH/CHR2-A/CHR208Q.Seq.d/ XXXXXXXXXXTTTTTAG...q Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CHR208 (CHR

  5. 44 CFR 208.43 - Rehabilitation.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Rehabilitation. 208.43... Agreements § 208.43 Rehabilitation. DHS will reimburse costs incurred to return System equipment and... Activation. (3) Personnel costs associated with equipment cache rehabilitation. DHS will reimburse costs...

  6. 40 CFR 91.208 - Certification.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Certification. 91.208 Section 91.208... Certification. (a) In the application for certification a manufacturer must: (1) Submit a statement that the engines for which certification is requested will not, to the best of the manufacturer's belief, cause the...

  7. 31 CFR 208.9 - Compliance.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Compliance. 208.9 Section 208.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT... Compliance. (a) Treasury will monitor agencies' compliance with this part. Treasury may require agencies to...

  8. 31 CFR 800.208 - Critical infrastructure.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Critical infrastructure. 800.208 Section 800.208 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS...

  9. 44 CFR 208.25 - Obsolete equipment.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Obsolete equipment. 208.25... Cooperative Agreements § 208.25 Obsolete equipment. (a) The Assistant Administrator will periodically identify obsolete items on the Equipment Cache List and provide such information to Sponsoring Agencies. (b) Neither...

  10. 40 CFR 86.208-94 - Dynamometer.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Dynamometer. 86.208-94 Section 86.208-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  11. 48 CFR 1552.208-70 - Printing.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Printing. 1552.208-70... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 1552.208-70 Printing. As prescribed in 1508.870, insert the following clause: Printing (DEC 2005) (a) Definitions...

  12. 48 CFR 952.208-70 - Printing.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Printing. 952.208-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.208-70 Printing. As prescribed in 908.802, insert the following clause: Printing (APR 1984) The Contractor shall not engage in, nor...

  13. 31 CFR 208.7 - Agency responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Agency responsibilities. 208.7 Section 208.7 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  14. 31 CFR 208.8 - Recipient responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Recipient responsibilities. 208.8 Section 208.8 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  15. 44 CFR 208.41 - Administrative allowance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Administrative allowance. 208... Cooperative Agreements § 208.41 Administrative allowance. (a) The administrative allowance is intended to... administrative allowance will be equal to the following: (1) If total allowable costs are less than $100,000, 3...

  16. SEARCH FOR COLOR VAN-DER-WAALS FORCE IN PB-208+PB-208 MOTT SCATTERING

    NARCIS (Netherlands)

    VILLARI, ACC; MITTIG, W; LEPINESZILY, A; FILHO, RL; AUGER, G; BIANCHI, L; BEUNARD, R; CASANDJIAN, JM; CIFFRE, JL; CUNSOLO, A; FOTI, A; GAUDARD, L; LIMA, CL; PLAGNOL, E; SCHUTZ, Y; SIEMSSEN, RH; WIELECZKO, JP

    1993-01-01

    In a high precision experiment, Mott scattering of the Pb-208 + Pb-208 system was measured at E(lab) = 873.40 MeV and 1129.74 MeV with kinematic coincidences for angle pairs around theta(lab) = 30-degrees, 60-degrees and theta(lab) = 45-degrees, 45-degrees. The observed Mott oscillations exhibit an

  17. 48 CFR 871.208 - Rehabilitation facilities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Rehabilitation facilities... DEPARTMENT SUPPLEMENTARY REGULATIONS LOAN GUARANTY AND VOCATIONAL REHABILITATION AND EMPLOYMENT PROGRAMS Vocational Rehabilitation and Employment Service 871.208 Rehabilitation facilities. Charges by rehabilitation...

  18. 48 CFR 3452.208-70 - Printing.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Printing. 3452.208-70... Printing. As prescribed in 3408.870, insert the following clause in all solicitations and contracts other than purchase orders: Printing (AUG 1987) Unless otherwise specified in this contract, the contractor...

  19. 5 CFR 430.208 - Rating performance.

    Science.gov (United States)

    2010-01-01

    ... MANAGEMENT Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees § 430.208 Rating performance. (a) As soon as practicable after the end of the appraisal period, a written, or... period(s) without an actual evaluation of the employee's performance during the subsequent appraisal...

  20. 27 CFR 46.208 - Unmerchantable articles.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Unmerchantable articles... Tubes Held for Sale on April 1, 2009 Inventories § 46.208 Unmerchantable articles. Articles that the.... However, the dealer must segregate any such unmerchantable articles and include them in a separate section...

  1. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  2. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  3. 50 CFR 665.208 - Protected species conservation.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Protected species conservation. 665.208 Section 665.208 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND... Fisheries § 665.208 Protected species conservation. The Regional Administrator may change the size of the...

  4. 23 CFR 450.208 - Coordination of planning process activities.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Coordination of planning process activities. 450.208 Section 450.208 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION PLANNING AND RESEARCH PLANNING ASSISTANCE AND STANDARDS Statewide Transportation Planning and Programming § 450.208...

  5. 49 CFR 195.208 - Welding of supports and braces.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Welding of supports and braces. 195.208 Section 195.208 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS... HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.208 Welding of supports and braces. Supports or braces may...

  6. 7 CFR 3565.208 - Maximum loan term.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Maximum loan term. 3565.208 Section 3565.208... AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Loan Requirements § 3565.208 Maximum loan term. (a) Statutory term limit. The lender may set the term of the loan, but in no instance may the term of a...

  7. 31 CFR 208.1 - Scope and application.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Scope and application. 208.1 Section 208.1 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY DISBURSEMENTS § 208.1...

  8. 44 CFR 208.26 - Accountability for use of funds.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Accountability for use of funds. 208.26 Section 208.26 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... Preparedness Cooperative Agreements § 208.26 Accountability for use of funds. The Sponsoring Agency is...

  9. 9 CFR 93.208 - Articles accompanying poultry.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Articles accompanying poultry. 93.208 Section 93.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Poultry § 93.208 Articles accompanying poultry. No...

  10. 29 CFR 20.8 - Disclosure to credit reporting agencies.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Disclosure to credit reporting agencies. 20.8 Section 20.8 Labor Office of the Secretary of Labor FEDERAL CLAIMS COLLECTION Disclosure of Information to Credit Reporting Agencies § 20.8 Disclosure to credit reporting agencies. (a) In accordance with guidelines...

  11. Observation of Direct Photons in Central 158 A GeV $^{208}Pb+^{208}Pb$ Collisions

    CERN Document Server

    Aggarwal, M.M.; Ahammed, Z.; Angelis, A.L.S.; Antonenko, V.; Arefiev, V.; Astakhov, V.; Avdeitchikov, V.; Awes, T.C.; Baba, P.V.K.S.; Badyal, S.K.; Barlag, C.; Bathe, S.; Batiounia, B.; Bernier, T.; Bhalla, K.B.; Bhatia, V.S.; Blume, C.; Bock, R.; Bohne, E.-M.; Borocz, Z.; Bucher, D.; Buijs, A.; Busching, H.; Carlen, L.; Chalyshev, V.; Chattopadhyay, S.; Cherbatchev, R.; Chujo, T.; Claussen, A.; Das, A.C.; Decowski, M.P.; Delagrange, H.; Djordjadze, V.; Donni, P.; Doubovik, I.; Dutt, S.; Dutta Majumdar, M.R.; El Chenawi, K.; Eliseev, S.; Enosawa, K.; Foka, P.; Fokin, S.; Ganti, M.S.; Garpman, S.; Gavrishchuk, O.; Geurts, F.J.M.; Ghosh, T.K.; Glasow, R.; Gupta, S.K.; Guskov, B.; Gustafsson, H.A.; Gutbrod, H.H.; Higuchi, R.; Hrivnacova, I.; Ippolitov, M.; Kalechofsky, H.; Kamermans, R.; Kampert, K.-H.; Karadjev, K.; Karpio, K.; Kato, S.; Kees, S.; Klein-Bosing, C.; Knoche, S.; Kolb, B.W.; Kosarev, I.; Koutcheryaev, I.; Krumpel, T.; Kugler, A.; Kulinich, P.; Kurata, M.; Kurita, K.; Kuzmin, N.; Langbein, I.; Lebedev, A.; Lee, Y.Y.; Lohner, H.; Luquin, L.; Mahapatra, D.P.; Manko, V.; Martin, M.; Martinez, G.; Maximov, A.; Mgebrichvili, G.; Miake, Y.; Mir, Md.F.; Mishra, G.C.; Miyamoto, Y.; Mohanty, B.; Mora, M.-J.; Morrison, D.; Mukhopadhyay, D.S.; Naef, H.; Nandi, B.K.; Nayak, S.K.; Nayak, T.K.; Neumaier, S.; Nianine, A.; Nikitine, V.; Nikolaev, S.; Nilsson, P.; Nishimura, S.; Nomokonov, P.; Nystrand, J.; Obenshain, F.E.; Oskarsson, A.; Otterlund, I.; Pachr, M.; Pavliouk, S.; Peitzmann, T.; Petracek, V.; Pinganaud, W.; Plasil, F.; Poblotzki, U.v.; Purschke, M.L.; Rak, J.; Raniwala, R.; Raniwala, S.; Ramamurthy, V.S.; Rao, N.K.; Retiere, F.; Reygers, K.; Roland, G.; Rosselet, L.; Roufanov, I.; Roy, C.; Rubio, J.M.; Sako, H.; Sambyal, S.S.; Santo, R.; Sato, S.; Schlagheck, H.; Schmidt, H.-R.; Schutz, Y.; Shabratova, G.; Shah, T.H.; Sibiriak, I.; Siemiarczuk, T.; Silvermyr, D.; Sinha, B.C.; Slavine, N.; Soderstrom, K.; Solomey, N.; Sood, G.; Sorensen, S.P.; Stankus, P.; Stefanek, G.; Steinberg, P.; Stenlund, E.; Stuken, D.; Sumbera, M.; Svensson, T.; Trivedi, M.D.; Tsvetkov, A.; Tykarski, L.; Urbahn, J.; Pijll, E.C.v.d.; Eijndhoven, N.v.; Nieuwenhuizen, G.J.v.; Vinogradov, A.; Viyogi, Y.P.; Vodopianov, A.; Voros, S.; Wyslouch, B.; Yagi, K.; Yokota, Y.; Young, G.R.

    2000-01-01

    A measurement of direct photon production in 208Pb + 208Pb collisions at 158 A GeV has been carried out in the CERN WA98 experiment. The invariant yield of direct photons in central collisions is extracted as a function of transverse momentum in the interval 0.5 1.5 GeV/c. The results constitute the first observation of direct photons in ultrarelativistic heavy-ion collisions which could be significant for diagnosis of quark gluon plasma formation.

  12. Direct Photon Production in 158 A GeV $^{208}Pb+^{208}Pb$ collisions

    CERN Document Server

    Aggarwal, M M; Ahammed, Z; Angelis, Aris L S; Antonenko, V G; Arefev, V; Astakhov, V A; Avdeichikov, V; Awes, T C; Baba, P V K S; Badyal, S K; Barlag, C; Bathe, S; Batyunya, B; Bernier, T; Bhalla, K B; Bhatia, V S; Blume, C; Bock, R; Bohne, E M; Böröcz, Z K; Bucher, D; Buijs, A; Büsching, H; Carlén, L; Chalyshev, V; Chattopadhyay, S; Cherbachev, R; Chujo, T; Claussen, A; Das, A C; Decowski, M P; Delagrange, H; Dzhordzhadze, V; Dönni, P; Dubovik, I; Dutt, S K; Dutta-Majumdar, M R; El-Chenawi, K F; Eliseev, S; Enosawa, K; Foka, P Y; Fokin, S L; Ganti, M S; Garpman, S I A; Gavrishchuk, O P; Geurts, F J M; Ghosh, T K; Glasow, R; Sen-Gupta, S K; Guskov, B; Gustafsson, Hans Åke; Gutbrod, H H; Higuchi, R; Hrivnacova, I; Ippolitov, M S; Kalechofsky, H; Kamermans, R; Kampert, K H; Karadzhev, K; Karpio, K; Kato, S; Kees, S; Klein-Bösing, C; Knoche, S; Kolb, B W; Kosarev, I G; Kucheryaev, I; Krümpel, T; Kugler, A; Kulinich, P A; Kurata, M; Kurita, K; Kuzmin, N A; Langbein, I; Lebedev, A; Lee, Y Y; Löhner, H; Luquin, Lionel; Mahapatra, D P; Man'ko, V I; Martin, M; Martínez, G; Maksimov, A; Mgebrishvili, G; Miake, Y; Mir, M F; Mishra, G C; Miyamoto, Y; Mohanty, B; Morrison, D; Mukhopadhyay, D S; Naef, H; Nandi, B K; Nayak, S K; Nayak, T K; Neumaier, S; Nyanin, A; Nikitin, V A; Nikolaev, S; Nilsson, P O; Nishimura, S; Nomokonov, V P; Nystrand, J; Obenshain, F E; Oskarsson, A; Otterlund, I; Pachr, M; Pavlyuk, S; Peitzmann, Thomas; Petracek, V; Pinganaud, W; Plasil, F; Poblotzki, U v; Purschke, M L; Rak, J; Raniwala, R; Raniwala, S; Ramamurthy, V S; Rao, N K; Retière, F; Reygers, K; Roland, G; Rosselet, L; Rufanov, I A; Roy, C; Rubio, J M; Sako, H; Sambyal, S S; Santo, R; Sato, S; Schlagheck, H; Schmidt, H R; Schutz, Y; Shabratova, G; Shah, T H; Sibiryak, Yu; Siemiarczuk, T; Silvermyr, D; Sinha, B C; Slavin, N V; Söderström, K; Solomey, Nickolas; Sood, G; Srensen, S P; Stankus, P; Stefanek, G; Steinberg, P; Stenlund, E; Stüken, D; Sumbera, M; Svensson, T; Trivedi, M D; Tsvetkov, A A; Tykarski, L; Urbahn, J; Van den Pijll, E C; van Eijndhoven, N; van Nieuwenhuizen, G J; Vinogradov, A; Viyogi, Y P; Vodopyanov, A S; Vörös, S; Wysouch, B; Yagi, K; Yokota, Y; Young, G R

    2001-01-01

    A measurement of direct photon production in 208Pb + 208Pb collisions at 158 A GeV has been carried out in the CERN WA98 experiment. The invariant yield or upper limit of direct photons as a function of transverse momentum in the interval 0.5 1.5 GeV/c in central collisions. The results are compared to proton-induced results and to theoretical predictions. Implications for the dynamics of high-energy heavy-ion collisions are discussed.

  13. 12 CFR 208.51 - Real estate lending standards.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Real estate lending standards. 208.51 Section... MEMBERSHIP OF STATE BANKING INSTITUTIONS IN THE FEDERAL RESERVE SYSTEM (REGULATION H) Real Estate Lending and Appraisal Standards § 208.51 Real estate lending standards. (a) Adoption of written policies. Each state...

  14. 7 CFR 205.208-205.235 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false [Reserved] 205.208-205.235 Section 205.208-205.235 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM...

  15. 48 CFR 208.404 - Use of Federal Supply Schedules.

    Science.gov (United States)

    2010-10-01

    ... furnish the ordering office sufficient information to permit the determinations required by part 225 and... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Use of Federal Supply Schedules. 208.404 Section 208.404 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS...

  16. 48 CFR 5152.208-9001 - Industrial preparedness planning.

    Science.gov (United States)

    2010-10-01

    ... planning. 5152.208-9001 Section 5152.208-9001 Federal Acquisition Regulations System DEPARTMENT OF THE ARMY... (other than Canada) will not be considered as a source of supply for critical components. Mandatory... TEST and finalize prime and subcontractor planning with the Armed Services Production Planning Officer...

  17. 31 CFR 208.10 - Reservation of rights.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Reservation of rights. 208.10 Section 208.10 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  18. 31 CFR 208.3 - Payment by electronic funds transfer.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Payment by electronic funds transfer. 208.3 Section 208.3 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  19. 31 CFR 208.11 - Accounts for disaster victims.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Accounts for disaster victims. 208.11 Section 208.11 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  20. 31 CFR 208.5 - Availability of the ETA SM.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Availability of the ETA SM. 208.5 Section 208.5 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  1. 31 CFR 208.6 - General account requirements.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false General account requirements. 208.6 Section 208.6 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF FEDERAL AGENCY...

  2. 5 CFR 734.208 - Participation in fundraising.

    Science.gov (United States)

    2010-01-01

    ... REGULATIONS (CONTINUED) POLITICAL ACTIVITIES OF FEDERAL EMPLOYEES Permitted Activities § 734.208 Participation in fundraising. (a) An employee may make a political contribution to a political party, political... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Participation in fundraising. 734.208...

  3. 48 CFR 208.7304 - Refined precious metals.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Refined precious metals... Government-Owned Precious Metals 208.7304 Refined precious metals. See PGI 208.7304 for a list of refined precious metals managed by DSCP. ...

  4. 12 CFR 208.6 - Establishment and maintenance of branches.

    Science.gov (United States)

    2010-01-01

    ... management. The financial history and condition of the applying bank and the general character of its management; (2) Capital. The adequacy of the bank's capital in accordance with § 208.4, and its future... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Establishment and maintenance of branches. 208...

  5. Dicty_cDB: VSC208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSC208 (Link to dictyBase) - - - Contig-U16468-1 VSC208E (Link to Original site)...- - - - - - VSC208E 188 Show VSC208 Library VS (Link to library) Clone ID VSC208 (Link to dictyBase)...BB170002B10H04 Bee Brain Normalized/Subtracted Library, BB17 Apis mellifera cDNA clone BB170002B10H04...|BI511643.1 BB160006B10B07 Bee Brain Normalized Library, BB16 Apis mellifera cDNA clone BB160006B10B07...|BI515784.1 BB160020B10A04 Bee Brain Normalized Library, BB16 Apis mellifera cDNA clone BB160020B10A04

  6. $\\Delta^{++}$ production in 158 A GeV $^{208}Pb+^{208}Pb$ interactions at the CERN SPS

    CERN Document Server

    Aggarwal, M M; Ahammed, Z; Angelis, Aris L S; Antonenko, V G; Arefev, V; Astakhov, V A; Avdeichikov, V; Awes, T C; Baba, P V K S; Badyal, S K; Baldin, A; Barabash, L; Barlag, C; Bathe, S; Batyunya, B; Bernier, T; Bhalla, K B; Bhatia, V S; Blume, C; Bock, R; Bohne, E M; Böröcz, Z K; Bucher, D; Buijs, A; Büsching, H; Carlén, L; Chalyshev, V; Chattopadhyay, S; Cherbachev, R; Chujo, T; Claussen, A; Das, A C; Decowski, M P; Delagrange, H; Dzhordzhadze, V; Dönni, P; Dubovik, I; Dutt, S K; Dutta-Majumdar, M R; El-Chenawi, K F; Eliseev, S; Enosawa, K; Foka, P Y; Fokin, S L; Frolov, V; Ganti, M S; Garpman, S I A; Gavrishchuk, O P; Geurts, F J M; Ghosh, T K; Glasow, R; Sen-Gupta, S K; Guskov, B; Gustafsson, Hans Åke; Gutbrod, H H; Higuchi, R; Hrivnacova, I; Ippolitov, M S; Kalechofsky, H; Kamermans, R; Kampert, K H; Karadzhev, K; Karpio, K; Kato, S; Kees, S; Kolb, B W; Kosarev, I G; Kucheryaev, I; Krümpel, T; Kugler, A; Kulinich, P A; Kurata, M; Kurita, K; Kuzmin, N A; Langbein, I; Lebedev, A; Lee, Y Y; Löhner, H; Luquin, Lionel; Mahapatra, D P; Man'ko, V I; Martin, M; Martínez, G; Maksimov, A; Mehdiyev, R; Mgebrishvili, G; Miake, Y; Mikhalev, D; Mir, M F; Mishra, G C; Miyamoto, Y; Mohanty, B; Morrison, D; Mukhopadhyay, D S; Myalkovskii, V; Naef, H; Nandi, B K; Nayak, S K; Nayak, T K; Neumaier, S; Nyanin, A; Nikitin, V A; Nikolaev, S; Nilsson, P O; Nishimura, S; Nomokonov, V P; Nystrand, J; Obenshain, F E; Oskarsson, A; Otterlund, I; Pachr, M; Parfenov, A; Pavlyuk, S; Peitzmann, Thomas; Petracek, V; Plasil, F; Pinganaud, W; Purschke, M L; Rak, J; Raniwala, R; Raniwala, S; Ramamurthy, V S; Rao, N K; Retière, F; Reygers, K; Roland, G; Rosselet, L; Rufanov, I A; Roy, C; Rubio, J M; Sako, H; Sambyal, S S; Santo, R; Sato, S; Schlagheck, H; Schmidt, H R; Schutz, Y; Shabratova, G; Shah, T H; Sibiryak, Yu; Siemiarczuk, T; Silvermyr, D; Sinha, B C; Slavin, N V; Söderström, K; Solomey, Nickolas; Sørensen, S P; Stankus, P; Stefanek, G; Steinberg, P; Stenlund, E; Stüken, D; Sumbera, M; Svensson, T; Trivedi, M D; Tsvetkov, A A; Tykarski, L; Urbahn, J; Van der Pijll, E C; van Eijndhoven, N; van Nieuwenhuizen, G J; Vinogradov, A; Viyogi, Y P; Vodopyanov, A S; Vörös, S; Wyslouch, B; Yagi, K; Yokota, Y; Young, G R

    2000-01-01

    The Delta /sup ++/-resonance production in central 158 A GeV /sup 208 /Pb+/sup 208/Pb collisions at the CERN SPS has been studied. The Delta /sup ++/ production was estimated from the invariant mass spectrum of p pi /sup +/-pairs by subtracting a mixed event background. The measured Delta /sup ++/ abundance is compared with the results from other experiments at lower energies, and with a model calculation assuming thermal and chemical equilibrium. (19 refs).

  7. 22 CFR 208.105 - Does this part apply to me?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Does this part apply to me? 208.105 Section 208.105 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) General § 208.105 Does this part apply to me? Portions of this part (see table at § 208.25(b...

  8. Neutron star structure and the neutron radius of 208Pb.

    Science.gov (United States)

    Horowitz, C J; Piekarewicz, J

    2001-06-18

    We study relationships between the neutron-rich skin of a heavy nucleus and the properties of neutron-star crusts. Relativistic effective field theories with a thicker neutron skin in 208Pb have a larger electron fraction and a lower liquid-to-solid transition density for neutron-rich matter. These properties are determined by the density dependence of the symmetry energy which we vary by adding nonlinear couplings between isoscalar and isovector mesons. An accurate measurement of the neutron radius in 208Pb-via parity violating electron scattering-may have important implications for the structure of the crust of neutron stars.

  9. 9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... vaccine production, the test shall be conducted in susceptible chickens. (i) Chicken Embryo Test. Each of... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Encephalomyelitis Vaccine... STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus. Avian...

  10. 47 CFR 73.208 - Reference points and distance computations.

    Science.gov (United States)

    2010-10-01

    ... SERVICES RADIO BROADCAST SERVICES FM Broadcast Stations § 73.208 Reference points and distance computations... United States Department of Interior publication entitled Index to the National Atlas of the United... filed no later than: (i) The last day of a filing window if the application is for a new FM facility or...

  11. 44 CFR 208.8 - Code of conduct.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Code of conduct. 208.8... of conduct. The Assistant Administrator will develop and implement a code of conduct for System Members acting under DHS's direction and control. Nothing in this section or the DHS code of conduct will...

  12. 50 CFR 216.208 - Letters of Authorization.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.208 Letters of Authorization. (a) A Letter of Authorization, unless...

  13. 27 CFR 9.208 - Snake River Valley.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Snake River Valley. 9.208... Snake River Valley. (a) Name. The name of the viticultural area described in this section is “Snake River Valley”. For purposes of part 4 of this chapter, “Snake River Valley” is a term of viticultural...

  14. 27 CFR 555.208 - Construction of type 2 magazines.

    Science.gov (United States)

    2010-04-01

    ..., FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.208..., weather-resistant, theft-resistant, and ventilated. They are to be supported to prevent direct contact... attached to doors by welding, riveting, or bolting (nuts on inside of door). Hinges and hasps must be...

  15. 41 CFR 101-42.208 - Custody of hazardous materials.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Custody of hazardous... Materials and Certain Categories of Property § 101-42.208 Custody of hazardous materials. Custody of extremely hazardous materials shall be the responsibility of the owning or holding Federal agency. Custody...

  16. 20 CFR 725.208 - Determination of relationship; child.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of relationship; child. 725.208... Determination of relationship; child. As used in this section, the term “beneficiary” means only a surviving... considered to be the child of a beneficiary if: (a) The courts of the State in which the beneficiary is...

  17. 29 CFR 780.208 - Forest and Christmas tree activities.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Forest and Christmas tree activities. 780.208 Section 780... Christmas tree activities. Operations in a forest tree nursery such as seeding new beds and growing and transplanting forest seedlings are not farming operations. The planting, tending, and cutting of Christmas trees...

  18. 12 CFR 208.101 - Obligations concerning institutional customers.

    Science.gov (United States)

    2010-01-01

    ... experience of the institutional customer in financial markets and specific experience with the type of... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Obligations concerning institutional customers...) Interpretations § 208.101 Obligations concerning institutional customers. (a) As a result of broadened authority...

  19. 48 CFR 2452.208-71 - Reproduction of reports.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Reproduction of reports... 2452.208-71 Reproduction of reports. As prescribed in 2437.110(b), insert the following clause in... other written materials. Reproduction of Reports (APR 1984) In accordance with Title I of the Government...

  20. Micro-RNA-208a, -208b, and -499 as Biomarkers for Myocardial Damage After Cardiac Surgery in Children.

    Science.gov (United States)

    Bolkier, Yoav; Nevo-Caspi, Yael; Salem, Yishay; Vardi, Amir; Mishali, David; Paret, Gideon

    2016-04-01

    To test the hypothesis that cardiac-enriched micro-RNAs can serve as accurate biomarkers that reflect myocardial injury and to predict the postoperative course following pediatric cardiac surgery. Micro-RNAs have emerged as plasma biomarkers for many pathologic states. We aimed to quantify preoperative and postoperative plasma levels of cardiac-enriched micro-RNA-208a, -208b, and -499 in children undergoing cardiac surgery and to evaluate correlations between their levels, the extent of myocardial damage, and the postoperative clinical course. PICU. Thirty pediatric patients that underwent open heart surgery for the correction of congenital heart defects between January 2012 to July 2013. None. At 12 hours post surgery, the plasma levels of the micro-RNAs increased by 300- to 4,000-fold. At 24 hours, their levels decreased but remained significantly higher than before surgery. Micro-RNA levels were associated with troponin levels, longer cardiopulmonary bypass and aortic crossclamp times, maximal postoperative aspartate aminotransferase levels, and delayed hospital discharge. Circulating micro-RNA-208a, -208b, and -499 are detectable in the plasma of children undergoing cardiac surgery and may serve as novel biomarkers for monitoring and forecasting postoperative myocardial injury and recovery.

  1. 44 CFR 208.38 - Reimbursement for re-supply and logistics costs incurred during Activation.

    Science.gov (United States)

    2010-10-01

    ... and logistics costs incurred during Activation. 208.38 Section 208.38 Emergency Management and... URBAN SEARCH AND RESCUE RESPONSE SYSTEM Response Cooperative Agreements § 208.38 Reimbursement for re-supply and logistics costs incurred during Activation. With the exception of emergency procurement...

  2. 5 CFR 930.208 - Administrative Law Judge Loan Program-detail to other agencies.

    Science.gov (United States)

    2010-01-01

    ...-detail to other agencies. 930.208 Section 930.208 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT... (MISCELLANEOUS) Administrative Law Judge Program § 930.208 Administrative Law Judge Loan Program—detail to other... that coordinates the loan/detail of an administrative law judge from one agency to another. An agency...

  3. 22 CFR 208.600 - How do suspension and debarment actions start?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false How do suspension and debarment actions start? 208.600 Section 208.600 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT GOVERNMENTWIDE... § 208.600 How do suspension and debarment actions start? When we receive information from any source...

  4. 8 CFR 208.8 - Limitations on travel outside the United States.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Limitations on travel outside the United States. 208.8 Section 208.8 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PROCEDURES FOR ASYLUM AND WITHHOLDING OF REMOVAL Asylum and Withholding of Removal § 208.8...

  5. 48 CFR 52.208-8 - Required Sources for Helium and Helium Usage Data.

    Science.gov (United States)

    2010-10-01

    ... Helium and Helium Usage Data. 52.208-8 Section 52.208-8 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.208-8 Required Sources for Helium and Helium Usage Data. As prescribed in 8.505, insert the following clause: Required Sources for Helium and Helium Usage Data (APR 2002) (a) Definitions...

  6. 7 CFR 761.208 - Target participation rates for socially disadvantaged groups.

    Science.gov (United States)

    2010-01-01

    ... groups. 761.208 Section 761.208 Agriculture Regulations of the Department of Agriculture (Continued) FARM... Farm Loan Programs Funds to State Offices § 761.208 Target participation rates for socially... in the county who are members of socially disadvantaged ethnic groups. (d) Women farmers. (1) The...

  7. Two-phonon giant dipole resonance in {sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Boretzky, K. [Frankfurt Univ. (Germany). Inst. fuer Kernphysik; Stroth, J. [Frankfurt Univ. (Germany). Inst. fuer Kernphysik; Wajda, E. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany)]|[Krakow Univ. (Poland). Inst. of Physics; Aumann, T. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Blaich, T. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Cub, J. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Elze, T.W. [Frankfurt Univ. (Germany). Inst. fuer Kernphysik; Emling, H. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Henning, W. [Argonne National Lab., IL (United States); Holzmann, R. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Klingler, H. [Frankfurt Univ. (Germany). Inst. fuer Kernphysik; Kulessa, R. [Krakow Univ. (Poland). Inst. of Physics; Kratz, J.V. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Lambrecht, D. [Mainz Univ. (Germany). Inst. fuer Kernchemie; Leifels, Y. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Lubkiewicz, E. [Krakow Univ. (Poland). Inst. of Physics; Stelzer, K. [Frankfurt Univ. (Germany). Inst. fuer Kernphysik; Walus, W. [Krakow Univ. (Poland). Inst. of Physics; Zinser, M. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Zude, E. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); LAND Collaboration

    1996-06-01

    Excitation of the two-phonon isovector giant dipole resonance was observed in {sup 208}Pb projectiles incident on different target nuclei (C, Sn, Ho, Pb, U) at high energy (640 A.MeV). Evidence is found for a two-step electromagnetic excitation mechanism. An enhancement of 1.33(16) for the excitation cross section is observed relative to the harmonic approximation. Neutron- and {gamma}-decay probabilities are derived as well. (orig.)

  8. Centrality Dependence of Neutral Pion Production in 158A GeV {sup 208}Pb+{sup 208}Pb Collisions

    Energy Technology Data Exchange (ETDEWEB)

    Aggarwal, M.M.; Bhatia, V.S. [University of Panjab, Chandigarh 160014 (India); Agnihotri, A.; Bhalla, K.B.; Gupta, S.K.; Raniwala, R.; Raniwala, S. [University of Rajasthan, Jaipur 302004 (India); Ahammed, Z.; Chattopadhyay, S.; Das, A.C.; Dutta Majumdar, M.R.; Ganti, M.S.; Mukhopadhyay, D.S.; Nayak, T.K.; Sinha, B.C.; Trivedi, M.D.; Viyogi, Y.P. [Variable Energy Cyclotron Centre, Calcutta 700 064 (India); Angelis, A.L.; Donni, P.; Foka, P.; Kalechofsky, H.; Martin, M.; Naef, H.; Rosselet, L.; Rubio, J.M.; Solomey, N.; Voeroes, S. [University of Geneva, CH-1211 Geneva 4 (Switzerland); Antonenko, V.; Cherbatchev, R.; Doubovik, I.; Fokin, S.; Ippolitov, M.; Karadjev, K.; Koutcheryaev, I.; Lebedev, A.; Manko, V.; Mgebrichvili, G.; Nianine, A.; Sibiriak, I.; Tsvetkov, A.; Vinogradov, A. [RRC (Kurchatov), RU-123182 Moscow (Russia); Arefiev, V.; Astakhov, V.; Avdeitchikov, V.; Baldine, A.; Barabach, L.; Batiounia, B.; Chalyshev, V.; Djordjadze, V.; Frolov, V.; Gavrishchuk, O.; Guskov, B.; Kosarev, I.; Kuzmin, N.; Maximov, A.; Mehdiyev, R.; Mikhalev, D.; Myalkovski, V.; Nikitine, V.; Nikolaev, S.; Nomokonov, P.; Parfenov, A.; Pavliouk, S.; Roufanov, I.; Shabratova, G.; Slavine, N.; Vodopianov, A. [Joint Institute for Nuclear Research, RU-141980 Dubna (Russia); Awes, T.C.; Kim, H.; Plasil, F.; Stankus, P.; Young, G.R. [Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831-6372 (United States); Baba, P.V.; Badyal, S.K.; Rao, N.K.; Sambyal, S.S. [University of Jammu, Jammu 180001 (India); Barlag, C.; Bathe, S.; Blume, C.; Bohne, E.; Boeroecz, Z.K.; Bucher, D.; Buesching, H.; Claussen, A.; Glasow, R.; Kampert, K.; Kees, S.; Kruempel, T.; Pietzmann, T.; Reygers, K.; Santo, R.; Schlagheck, H.; Stueken, D. [University of Muenster, D-48149 Muenster (Germany); Bernier, T.; Gutbrod, H.H.; Luquin, L.; Nayak, S.K.; Pinanaud, W.; Retiere, F.; Roy, C. [SUBATECH, Ecole des Mines, Nantes (France); Bock, R.; Kolb, B.W.; Langbein, I.; Lee, Y.Y.; Neumaier, S.; and others

    1998-11-01

    The production of neutral pions in 158A GeV {sup 208}Pb+ {sup 208}Pb collisions has been studied in the WA98 experiment at the CERN Super Proton Synchrotron (SPS). Transverse momentum spectra are studied for the range 0.3{le}m{sub T}{minus}m{sub 0}{le}4.0 GeV /c . The results for central collisions are compared to various models. The centrality dependence of the neutral pion spectral shape and yield is investigated. An invariance of the spectral shape and a simple scaling of the yield with the number of participating nucleons is observed for centralities with greater than about 30thinspthinspparticipating nucleons. This is most naturally explained by assuming an equilibrated system. {copyright} {ital 1998} {ital The American Physical Society }

  9. 22 CFR 208.365 - What must I do if I learn of information required under § 208.355 after entering into a covered...

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What must I do if I learn of information...-Lower Tier Participants § 208.365 What must I do if I learn of information required under § 208.355... written notice to that person if you learn either that— (a) You failed to disclose information earlier, as...

  10. Neutron Skin of Pb208 from Coherent Pion Photoproduction

    Science.gov (United States)

    Tarbert, C. M.; Watts, D. P.; Glazier, D. I.; Aguar, P.; Ahrens, J.; Annand, J. R. M.; Arends, H. J.; Beck, R.; Bekrenev, V.; Boillat, B.; Braghieri, A.; Branford, D.; Briscoe, W. J.; Brudvik, J.; Cherepnya, S.; Codling, R.; Downie, E. J.; Foehl, K.; Grabmayr, P.; Gregor, R.; Heid, E.; Hornidge, D.; Jahn, O.; Kashevarov, V. L.; Knezevic, A.; Kondratiev, R.; Korolija, M.; Kotulla, M.; Krambrich, D.; Krusche, B.; Lang, M.; Lisin, V.; Livingston, K.; Lugert, S.; MacGregor, I. J. D.; Manley, D. M.; Martinez, M.; McGeorge, J. C.; Mekterovic, D.; Metag, V.; Nefkens, B. M. K.; Nikolaev, A.; Novotny, R.; Owens, R. O.; Pedroni, P.; Polonski, A.; Prakhov, S. N.; Price, J. W.; Rosner, G.; Rost, M.; Rostomyan, T.; Schadmand, S.; Schumann, S.; Sober, D.; Starostin, A.; Supek, I.; Thomas, A.; Unverzagt, M.; Walcher, Th.; Zana, L.; Zehr, F.; Crystal Ball at MAMI; A2 Collaboration

    2014-06-01

    Information on the size and shape of the neutron skin on Pb208 is extracted from coherent pion photoproduction cross sections measured using the Crystal Ball detector together with the Glasgow tagger at the MAMI electron beam facility. On exploitation of an interpolated fit of a theoretical model to the measured cross sections, the half-height radius and diffuseness of the neutron distribution are found to be cn=6.70±0.03(stat.) fm and an=0.55±0.01(stat.)-0.03+0.02(sys.) fm, respectively, corresponding to a neutron skin thickness Δrnp=0.15±0.03(stat.)-0.03+0.01(sys.) fm. The results give the first successful extraction of a neutron skin thickness with an electromagnetic probe and indicate that the skin of Pb208 has a halo character. The measurement provides valuable new constraints on both the structure of nuclei and the equation of state for neutron-rich matter.

  11. Direct proton decay and microscopic structure of the spin-dipole resonance in Bi-208

    NARCIS (Netherlands)

    Akimune, H; Daito, [No Value; Fujita, Y; Fujiwara, M; Harakeh, MN; Janecke, J; Yosoi, M

    The microscopic structure of the spin-dipole resonance (SDR) at E-x = 21.1 MeV in Bi-208 has been investigated in the Pb-208(He-3,t)Bi-208 reaction at E(He-3) = 450 MeV and very forward scattering angles. Protons emitted due to the decay of the SDR were measured in solid-state detectors in

  12. 12 CFR Appendix C to Part 208 - Interagency Guidelines for Real Estate Lending Policies

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Interagency Guidelines for Real Estate Lending... H) Pt. 208, App. C Appendix C to Part 208—Interagency Guidelines for Real Estate Lending Policies... secured by liens on or interests in real estate or made for the purpose of financing the construction of a...

  13. 37 CFR 41.208 - Content of substantive and responsive motions.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Content of substantive and responsive motions. 41.208 Section 41.208 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND... applicant 1.31, 2.11 Professional impropriety, avoiding appearance of 1.110, 10.111 Promise of advantage...

  14. MicroRNA-208a Silencing Attenuates Doxorubicin Induced Myocyte Apoptosis and Cardiac Dysfunction

    Directory of Open Access Journals (Sweden)

    Hasahya Tony

    2015-01-01

    Full Text Available Aims. GATA4 depletion is a distinct mechanism by which doxorubicin leads to cardiomyocyte apoptosis, and preservation of GATA4 mitigates doxorubicin induced myocyte apoptosis and cardiac dysfunction. We investigated a novel approach of attenuating doxorubicin induced cardiac toxicity by silencing miR-208a, a heart specific microRNA known to target GATA4. Methods and Results. Eight-week-old female Balb/C mice were randomly assigned to sham, antagomir, and control groups. Antagomir group were pretreated with miR-208a antagomir 4 days before doxorubicin administration. At day 0, control and antagomir groups received 20 mg/kg of doxorubicin, while sham mice received phosphate buffered solution. Echocardiography was done at day 7, after which animals were sacrificed and hearts harvested and assessed for apoptosis and expression of miR-208a, GATA4, and BCL-2. Doxorubicin significantly upregulated miR-208a, downregulated GATA4, and increased myocyte apoptosis, with resulting decrease in cardiac function. In contrast, therapeutic silencing of miR-208a salvaged GATA4 and BCL-2 and decreased apoptosis, with improvement in cardiac function. Conclusion. Doxorubicin upregulates miR-208a and promotes cardiomyocyte apoptosis, while therapeutic silencing of miR-208a attenuates doxorubicin induced myocyte apoptosis with subsequent improvement in cardiac function. These novel results highlight the therapeutic potential of targeting miR-208a to prevent doxorubicin cardiotoxicity.

  15. 29 CFR 779.208 - Auxiliary activities which are “related activities.”

    Science.gov (United States)

    2010-07-01

    ... eating and drinking facilities (note that employees primarily engaged in certain food service activities... 29 Labor 3 2010-07-01 2010-07-01 false Auxiliary activities which are ârelated activities.â 779.208 Section 779.208 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT...

  16. 44 CFR 208.63 - Request by DHS for supplemental information.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Request by DHS for supplemental information. 208.63 Section 208.63 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE NATIONAL URBAN SEARCH AND RESCUE RESPONSE SYSTEM Reimbursement Claims and Appeals § 20...

  17. 44 CFR 208.37 - Reimbursement for equipment and supply costs incurred during Activation.

    Science.gov (United States)

    2010-10-01

    ... and supply costs incurred during Activation. 208.37 Section 208.37 Emergency Management and Assistance... and supply costs incurred during Activation. (a) Allowable costs. DHS will reimburse costs incurred for the emergency procurement of equipment and supplies in the number, type, and up to the cost...

  18. 27 CFR 41.208 - Maintenance and retention of records and reports.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Maintenance and retention of records and reports. 41.208 Section 41.208 Alcohol, Tobacco Products and Firearms ALCOHOL AND... PRODUCTS, CIGARETTE PAPERS AND TUBES, AND PROCESSED TOBACCO Tobacco Products Importers Filing and Retention...

  19. 48 CFR 1817.208 - Solicitation provisions and contract clauses. (NASA supplements paragraph (c))

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Solicitation provisions and contract clauses. (NASA supplements paragraph (c)) 1817.208 Section 1817.208 Federal Acquisition... supplements paragraph (c)) (c)(3) The contracting officer shall insert a provision substantially the same as...

  20. 48 CFR 1815.208 - Submission, modification, revision, and withdrawal of proposals. (NASA supplements paragraph (b))

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Submission, modification, revision, and withdrawal of proposals. (NASA supplements paragraph (b)) 1815.208 Section 1815.208 Federal... Submission, modification, revision, and withdrawal of proposals. (NASA supplements paragraph (b)) (b) The FAR...

  1. 48 CFR 253.208-2 - DD Form 448-2, Acceptance of MIPR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448-2, Acceptance... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.208-2 DD Form 448-2, Acceptance of MIPR. Follow the procedures at PGI 253.208-2 for use of DD Form 448-2. ...

  2. 21 CFR 208.20 - Content and format of a Medication Guide.

    Science.gov (United States)

    2010-04-01

    ... information on the proper use of the drug product, such as: (i) A statement stressing the importance of... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Content and format of a Medication Guide. 208.20 Section 208.20 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES...

  3. 40 CFR 33.208 - How long does an MBE or WBE certification from EPA last?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false How long does an MBE or WBE certification from EPA last? 33.208 Section 33.208 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE PARTICIPATION BY DISADVANTAGED BUSINESS ENTERPRISES IN UNITED STATES...

  4. 25 CFR 20.208 - What if the tribal redesign plan leads to increased costs?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What if the tribal redesign plan leads to increased costs? 20.208 Section 20.208 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR HUMAN SERVICES... leads to increased costs? The tribe must meet any increase in cost to the General Assistance program...

  5. 45 CFR 400.208 - Claims involving family units which include both refugees and nonrefugees.

    Science.gov (United States)

    2010-10-01

    ... refugees and nonrefugees. 400.208 Section 400.208 Public Welfare Regulations Relating to Public Welfare OFFICE OF REFUGEE RESETTLEMENT, ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES REFUGEE RESETTLEMENT PROGRAM Federal Funding Federal Funding for Expenditures for Determining...

  6. Study of the neutron skin thickness of {sup 208}Pb in mean field models

    Energy Technology Data Exchange (ETDEWEB)

    Roca-Maza, X; Centelles, M; Vinas, X; Warda, M, E-mail: xavier.roca.maza@mi.infn.it [Departament d' Estructura i Constituents de la Materia and Institut de Ciencies del Cosmos, Facultat de Fisica, Universitat de Barcelona, Diagonal 647, 08028 Barcelona (Spain)

    2011-09-16

    We study whether the neutron skin thickness {Delta}r{sub np} of {sup 208}Pb originates from the bulk or from the surface of the neutron and proton density distributions in mean field models. We find that the size of the bulk contribution to {Delta}r{sub np} of {sup 208}Pb strongly depends on the slope of the nuclear symmetry energy, while the surface contribution does not. We note that most mean field models predict a neutron density for {sup 208}Pb between the halo and skin type limits. We investigate the dependence of parity-violating electron scattering at the kinematics of the PREX experiment on the shape of the nucleon densities predicted by the mean field models for {sup 208}Pb. We find an approximate formula for the parity-violating asymmetry in terms of the central radius and the surface diffuseness of the nucleon densities of {sup 208}Pb in these models.

  7. Therapeutic Inhibition of miR-208a Improves Cardiac Function and Survival During Heart Failure

    Science.gov (United States)

    Montgomery, Rusty L.; Hullinger, Thomas G.; Semus, Hillary M.; Dickinson, Brent A.; Seto, Anita G.; Lynch, Joshua M.; Stack, Christianna; Latimer, Paul A.; Olson, Eric N.; van Rooij, Eva

    2012-01-01

    Background Diastolic dysfunction in response to hypertrophy is a major clinical syndrome with few therapeutic options. MicroRNAs act as negative regulators of gene expression by inhibiting translation or promoting degradation of target mRNAs. Previously, we reported that genetic deletion of the cardiac-specific miR-208a prevents pathological cardiac remodeling and upregulation of Myh7 in response to pressure overload. Whether this miRNA might contribute to diastolic dysfunction or other forms of heart disease is currently unknown. Methods and Results Here, we show that systemic delivery of an antisense oligonucleotide induces potent and sustained silencing of miR-208a in the heart. Therapeutic inhibition of miR-208a by subcutaneous delivery of antimiR-208a during hypertension-induced heart failure in Dahl hypertensive rats dose-dependently prevents pathological myosin switching and cardiac remodeling while improving cardiac function, overall health, and survival. Transcriptional profiling indicates that antimiR-208a evokes prominent effects on cardiac gene expression; plasma analysis indicates significant changes in circulating levels of miRNAs on antimiR-208a treatment. Conclusions These studies indicate the potential of oligonucleotide-based therapies for modulating cardiac miRNAs and validate miR-208 as a potent therapeutic target for the modulation of cardiac function and remodeling during heart disease progression. PMID:21900086

  8. Regulation of cardiac miR-208a, an inducer of obesity, by rapamycin and nebivolol.

    Science.gov (United States)

    Gul, Rukhsana; Mahmood, Abuzar; Luck, Christian; Lum-Naihe, Kelly; Alfadda, Assim A; Speth, Robert C; Pulakat, Lakshmi

    2015-11-01

    Resistance to obesity is observed in rodents and humans treated with rapamycin (Rap) or nebivolol (Neb). Because cardiac miR-208a promotes obesity, this study tested whether the modes of actions of Rap and Neb involve inhibition of miR-208a. Mouse cardiomyocyte HL-1 cells and Zucker obese (ZO) rats were used to investigate regulation of cardiac miR-208a. Angiotensin II (Ang II) increased miR-208a expression in HL-1 cells. Pretreatment with an AT1 receptor (AT1R) antagonist, losartan (1 μM), antagonized this effect, whereas a phospholipase C inhibitor, U73122 (10 μM), and an NADPH oxidase inhibitor, apocynin (0.5 mM), did not. Ang II-induced increase in miR-208a was suppressed by Rap (10 nM), an inhibitor of nutrient sensor kinase mTORC1, and Neb (1 μM), a 3rd generation β-blocker that suppressed bioavailable AT1R binding of (125) I-Ang II. Thus, suppression of AT1R expression by Neb, inhibition of AT1R activation by losartan, and inhibition of AT1R-induced activation of mTORC1 by Rap attenuated the Ang II-induced increase in miR-208a. In ZO rats, Rap treatment (750 μg kg(-1)  day(-1) ; 12 weeks) reduced obesity despite similar food intake, suppressed cardiac miR-208a, and increased cardiac MED13, a suppresser of obesity. Rap and Neb suppressed cardiac miR-208a. Suppression of miR-208a and increase in MED13 correlated with attenuated weight gain despite leptin resistance. © 2015 The Obesity Society.

  9. Asymptotic three-particle approach to the Coulomb breakup process {sup 6}Li + {sup 208}Pb → {sup 208}Pb + α + d

    Energy Technology Data Exchange (ETDEWEB)

    Igamov, S. B., E-mail: igamov@inp.uz [Uzbek Academy of Sciences, Institute of Nuclear Physics (Uzbekistan)

    2017-03-15

    On the basis of the distorted-wave method, experimental data on the triple-differential cross section for the Coulomb breakup reaction {sup 208}Pb({sup 6}Li, αd){sup 208}Pb are analyzed by employing a correct expression for the final-state {sup 208}Pb–α–d three-particle Coulomb wave function. It is shown that the effect of final-state three-particle Coulomb dynamics can be used to assess the kinematical condition of clean Coulomb breakup processes. New values of the astrophysical S factor for the direct-radiative-capture reaction d(α, γ){sup 6}Li at ultralow energies in the range of 70 ≤ E{sub dα} ≤ 600 keV were extracted from experimental data. The value of S(0) = 1.60 ± 0.17 MeV nb was obtained.

  10. New Isomers in the Neutron-Rich Region Beyond 208Pb

    Science.gov (United States)

    Gottardo, A.; Valiente-Dobón, J. J.; Benzoni, G.; Gadea, A.; Lunardi, S.; Boutachkov, P.; Bruce, A. M.; Górska, M.; Grebosz, J.; Pietri, S.; Podolyák, Zs.; Pfützner, M.; Regan, P. H.; Weick, H.; Alcántara Núñez, J.; Algora, A.; Al-Dahan, N.; de Angelis, G.; Ayyad, Y.; Alkhomashi, N.; Allegro, P. R. P.; Bazzacco, D.; Benlliure, J.; Bowry, M.; Bracco, A.; Bunce, M.; Camera, F.; Casarejos, E.; Cortes, M. L.; Crespi, F. C. L.; Corsi, A.; Bacelar, A. M. Denis; Deo, A. Y.; Domingo-Pardo, C.; Doncel, M.; Dombradi, Zs.; Engert, T.; Eppinger, K.; Farrelly, G. F.; Farinon, F.; Farnea, E.; Geissel, H.; Gerl, J.; Goel, N.; Gregor, E.; Habermann, T.; Hoischen, R.; Janik, R.; John, P. R.; Klupp, S.; Kojouharov, I.; Kurz, N.; Lenzi, S. M.; Leoni, S.; Mandal, S.; Menegazzo, R.; Mengoni, D.; Million, B.; Modamio, V.; Morales, A. I.; Napoli, D. R.; Naqvi, F.; Nicolini, R.; Nociforo, C.; Prochazka, A.; Prokopowicz, W.; Recchia, F.; Ribas, R. V.; Reed, M. W.; Rudolph, D.; Sahin, E.; Schaffner, H.; Sharma, A.; Sitar, B.; Siwal, D.; Steiger, K.; Strmen, P.; Swan, T. P. D.; Szarka, I.; Ur, C. A.; Walker, P. M.; Wieland, O.; Wollersheim, H.-J.

    2014-03-01

    The region of neutron-rich nuclei beyond 208Pb has been very difficult to explore due to its high mass and exoticity. However, recent experimental improvements allowed one to perform a quite extended isomer decay spectroscopy of these nuclei.

  11. Has a thick neutron skin in 208Pb been ruled out?

    Science.gov (United States)

    Fattoyev, F J; Piekarewicz, J

    2013-10-18

    The Lead Radius Experiment has provided the first model-independent evidence in favor of a neutron-rich skin in 208Pb. Although the error bars are large, the reported large central value of 0.33 fm is particularly intriguing. To test whether such a thick neutron skin in 208Pb is already incompatible with laboratory experiments or astrophysical observations, we employ relativistic models with neutron-skin thickness in 208Pb ranging from 0.16 to 0.33 fm to compute ground-state properties of finite nuclei, their collective monopole and dipole response, and mass-versus-radius relations for neutron stars. No compelling reason was found to rule out models with large neutron skins in 208Pb from the set of observables considered in this Letter.

  12. Chaos and Regularity in the Doubly Magic Nucleus 208Pb

    Science.gov (United States)

    Dietz, B.; Heusler, A.; Maier, K. H.; Richter, A.; Brown, B. A.

    2017-01-01

    High-resolution experiments have recently lead to a complete identification (energy, spin, and parity) of 151 nuclear levels up to an excitation energy of Ex=6.20 MeV in 208Pb [Heusler et al., Phys. Rev. C 93, 054321 (2016), 10.1103/PhysRevC.93.054321]. We present a thorough study of the fluctuation properties in the energy spectra of the unprecedented set of nuclear bound states. In a first approach, we group states with the same spin and parity into 14 subspectra, analyze standard statistical measures for short- and long-range correlations, i.e., the nearest-neighbor spacing distribution, the number variance Σ2, the Dyson-Mehta Δ3 statistics, and the novel distribution of the ratios of consecutive spacings of adjacent energy levels in each energy sequence, and then compute their ensemble average. Their comparison with a random matrix ensemble which interpolates between Poisson statistics expected for regular systems and the Gaussian orthogonal ensemble (GOE) predicted for chaotic systems shows that the data are well described by the GOE. In a second approach, following an idea of Rosenzweig and Porter [Phys. Rev. 120, 1698 (1960), 10.1103/PhysRev.120.1698], we consider the complete spectrum composed of the independent subspectra. We analyze their fluctuation properties using the method of Bayesian inference involving a quantitative measure, called the chaoticity parameter f , which also interpolates between Poisson (f =0 ) and GOE statistics (f =1 ). It turns out to be f ≈0.9 . This is so far the closest agreement with a GOE observed in the spectra of bound states in a nucleus. The same analysis is also performed with spectra computed on the basis of shell model calculations with different interactions (surface-delta interaction, Kuo-Brown, Michigan-three-Yukawa). While the simple surface-delta interaction exhibits features typical for nuclear many-body systems with regular dynamics, the other, more realistic interactions yield chaoticity parameters f close

  13. 22 CFR 208.350 - What must I do if I learn of the information required under § 208.335 after entering into a...

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What must I do if I learn of the information... Information-Primary Tier Participants § 208.350 What must I do if I learn of the information required under... USAID office with which you entered into the transaction if you learn either that— (a) You failed to...

  14. Measurement of conversion electrons with the $^{208}Pb(p,n)^{208}Bi$ reaction and derivation of the shell model proton neutron hole interaction from the properties of $^{208}Bi$

    CERN Document Server

    Maier, K H; Dracoulis, G D; Boutachkov, P; Aprahamian, A; Byrne, A P; Davidson, P M; Lane, G L; Marie-Jeanne, Mélanie; Nieminen, P; Watanabe, H

    2007-01-01

    Conversion electrons from 208Bi have been measured using singles and coincidence techniques with the 208Pb(p,n)208Bi reaction at 9 MeV. The new information on multipolarities and spins complements that available from recent gamma-gamma-coincidence studies with the same reaction [Boutachkov et al., Nucl. Phys. A768, 22 (2006)]. The results on electromagnetic decays taken together with information on spectroscopic factors from earlier single-particle transfer reaction measurements represent an extensive data set on the properties of the one-proton one-neutron-hole states below 3 MeV, a spectrum which is virtually complete. Comparison of the experimental observables, namely, energies, spectroscopic factors, and gamma-branching ratios, with those calculated within the shell model allows extraction of the matrix elements of the shell model residual interaction. More than 100 diagonal and nondiagonal elements can be determined in this way, through a least squares fit to the experimental data. This adjustment of the...

  15. Targeting procaspase-3 with WF-208, a novel PAC-1 derivative, causes selective cancer cell apoptosis.

    Science.gov (United States)

    Wang, Fangyang; Liu, Yajing; Wang, Lihui; Yang, Jingyu; Zhao, Yanfang; Wang, Nannan; Cao, Qi; Gong, Ping; Wu, Chunfu

    2015-08-01

    Caspase-3 is a critical effector caspase in apoptosis cascade, and is often over-expressed in many cancer tissues. The first synthesized procaspase-3 activator, PAC-1, induces cancer cell apoptosis and exhibits antitumour activity in murine xenograft models. To identify more potent procaspase-3 activators, a series of compounds were designed, synthesized and evaluated for their ability of inducing cancer cell death in culture. Among these compounds, WF-208 stood out by its high cytotoxicity against procaspase-3 overexpressed HL-60 cells. Compared with PAC-1, WF-208 showed higher cytotoxicity in cancer cells and lower toxicity in normal cells. The further investigation described herein showed that WF-208 activated procaspase-3, degraded IAPs (The Inhibitors of apoptosis proteins) and leaded to caspase-3-dependent cell death in tumour cells, which possibly because of the zinc-chelating properties. WF-208 also showed greater antitumour activity than PAC-1 in murine xenograft model. In conclusion, we have discovered WF-208 as a promising procaspase-3 activating compound, with higher activity and higher cell selectivity than PAC-1. © 2015 The Authors. Journal of Cellular and Molecular Medicine published by John Wiley & Sons Ltd and Foundation for Cellular and Molecular Medicine.

  16. Laser Spectroscopic Measurements of Isotope Shift and Hyperfine Structure in BISMUTH-207 and BISMUTH-208.

    Science.gov (United States)

    Fang, Zuyun

    1988-12-01

    Measurements of the hyperfine spectra of 38-yr ^{207}Bi and 3.7 times 10^5-yr ^{208}Bi in the 6p^3 ^4S_{3/2} - 6p^27s ^4P_{1/2} 306.7-nm resonance line were made using laser spectroscopic methods. The atomic excitation was produced with use of the frequency doubled output of a tunable ring dye laser. Laser absorption spectroscopy was used for the ^ {208}Bi measurement, while fluorescence spectroscopy, with photon counting detection, was used for ^{208}Bi. The experiments of ^{207}Bi were performed in both zero and high (0.7515 T) magnetic fields. The latter also provided a reliable measurement of the nuclear spin of ^{207}Bi. The results obtained from the ^ {208}Bi spectra are: A(^4P _{1/2}) = 4911(17)MHz and B( ^4S_{3/2}) = -314(92)MHz. These give the values: mu = 4.523(16) mu_{N} and Q = - 0.39(12)b. The measured isotope shift is: IS( ^{208}Bi-^{209 }Bi) = 1870(63)MHz. The results for ^{207} Bi are: I = 9/2, A(^4P_{1/2 }) = 4900.0(8.1)MHz, A(^4S_ {1/2}) = -444.6(1.5)MHz and B(^4S_{1/2}) = -443(17)MHz. These give the values: mu = 4.062(8)mu_ {N} and Q = -0.55(2)b. The measured isotope shift is: IS(^{207 }Bi-^{209}Bi) = 2997(10)MHz. The isotope shift odd-even staggering parameter for ^{208}Bi, gamma = 0.752(43), was derived and used for an isotonic comparison. The measured nuclear magnetic moments are in agreement with theoretical predictions. An improved calculation of the isotope shift constant using a diffuse nuclear charge model is given and a weak, but significant, model dependence of the isotope shifts was found.

  17. New Isomers in the Neutron-Rich Region Beyond 208Pb

    Directory of Open Access Journals (Sweden)

    Gottardo A.

    2014-03-01

    Full Text Available The region of neutron-rich nuclei beyond 208Pb has been very difficult to explore due to its high mass and exoticity. However, recent experimental improvements allowed one to perform a quite extended isomer decay spectroscopy of these nuclei.

  18. Excited states populated via nucleon transfer in the reaction [sup 32]S+[sup 208]Pb

    Energy Technology Data Exchange (ETDEWEB)

    Corradi, L.; Petrache, C.M.; Ackermann, D.; De Angelis, G.; Moreno, H.; Napoli, D.R.; Spolaore, P.; Stefanini, A.M. (INFN, Lab. Nazionali di Legnaro (Italy)); Beghini, S.; Montagnoli, G.; Scarlassara, F.; Segato, G.F.; Signorini, C. (Padua Univ. (Italy). Dipt. di Fisica INFN, Padua (Italy)); Pollarolo, G. (Turin Univ. (Italy). Dipt. di Fisica INFN, Turin (Italy))

    1993-01-01

    The population strengths of excited states in nuclei produced via transfer reactions in the 185 MeV[sup 32]S+[sup 208]Pb reaction have been investigated by heavy-ion-[gamma] coincidence techniques. The cross sections extracted from the [gamma] spectra, have been analyzed in the framework of the Complex WKB approximation theory. (orig.).

  19. 7 CFR 3560.208 - Rents during eviction or failure to recertify.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Rents during eviction or failure to recertify. 3560... HOUSING SERVICE, DEPARTMENT OF AGRICULTURE DIRECT MULTI-FAMILY HOUSING LOANS AND GRANTS Rents § 3560.208 Rents during eviction or failure to recertify. (a) Rents during eviction. If a tenant is appealing an...

  20. 49 CFR 24.208 - Aliens not lawfully present in the United States.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Aliens not lawfully present in the United States... Requirements § 24.208 Aliens not lawfully present in the United States. (a) Each person seeking relocation... of an individual, that he or she is either a citizen or national of the United States, or an alien...

  1. 8 CFR 208.5 - Special duties toward aliens in custody of DHS.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Special duties toward aliens in custody of... duties toward aliens in custody of DHS. (a) General. When an alien in the custody of DHS requests asylum... case of an alien who is in custody pending a credible fear determination under 8 CFR 208.30 or a...

  2. 22 CFR 208.850 - What is the standard of proof in a debarment action?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What is the standard of proof in a debarment... DEBARMENT AND SUSPENSION (NONPROCUREMENT) Debarment § 208.850 What is the standard of proof in a debarment... evidence. (b) If the proposed debarment is based upon a conviction or civil judgment, the standard of proof...

  3. 12 CFR 208.25 - Loans in areas having special flood hazards.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Loans in areas having special flood hazards...) Investments and Loans § 208.25 Loans in areas having special flood hazards. (a) Purpose and scope—(1) Purpose. The purpose of this section is to implement the requirements of the National Flood Insurance Act of...

  4. 7 CFR 3550.208 - Reamortization using promissory note interest rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Reamortization using promissory note interest rate... § 3550.208 Reamortization using promissory note interest rate. Reamortization using the promissory note interest rate may be authorized when RHS determines that reamortization is required to enable the borrower...

  5. 48 CFR 253.208-1 - DD Form 448, Military Interdepartmental Purchase Request.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448, Military... DD Form 448, Military Interdepartmental Purchase Request. Follow the procedures at PGI 253.208-1 for use of DD Form 448. ...

  6. 42 CFR 3.208 - Continued protection of patient safety work product.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Continued protection of patient safety work product... GENERAL PROVISIONS PATIENT SAFETY ORGANIZATIONS AND PATIENT SAFETY WORK PRODUCT Confidentiality and Privilege Protections of Patient Safety Work Product § 3.208 Continued protection of patient safety work...

  7. 31 CFR Appendix A to Part 208 - Model Disclosure for Use Until ETA SM Becomes Available

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Model Disclosure for Use Until ETA SM Becomes Available A Appendix A to Part 208 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF...

  8. 31 CFR Appendix B to Part 208 - Model Disclosure for Use After ETA SM Becomes Available

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Model Disclosure for Use After ETA SM Becomes Available B Appendix B to Part 208 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE MANAGEMENT OF...

  9. 7 CFR 1744.208 - Rural development investments before November 28, 1990.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Rural development investments before November 28... GUARANTEED AND INSURED TELEPHONE LOANS Borrower Investments § 1744.208 Rural development investments before... by RUS as a condition to approving a rural development investment before November 28, 1990, shall...

  10. 33 CFR 208.26 - Altus Dam and Reservoir, North Fork Red River, Okla.

    Science.gov (United States)

    2010-07-01

    ...) amounts to 21,448 acre-feet (based on 1953 sedimentation survey). Whenever the reservoir level is within... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Altus Dam and Reservoir, North..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE FLOOD CONTROL REGULATIONS § 208.26 Altus Dam and Reservoir...

  11. 5 CFR 842.208 - Firefighters, law enforcement officers, and nuclear materials couriers.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Firefighters, law enforcement officers... ANNUITY Eligibility § 842.208 Firefighters, law enforcement officers, and nuclear materials couriers. (a... misconduct, is entitled to an annuity— (1) After completing any combination of service as a firefighter,law...

  12. Photon and neutral meson production in 158 AGeV Pb-208+Pb collisions

    NARCIS (Netherlands)

    Peitzmann, T

    1996-01-01

    First results from the WA98 experiment on 33 TeV Pb-208 ion reactions with various targets measured at the CERN SPS are presented. Data on transverse energy production and particle multiplicity are discussed. Special emphasis is laid on photon and neutral meson production.

  13. 18 CFR 154.208 - Service of tariff filings on customers and other parties.

    Science.gov (United States)

    2010-04-01

    ... SCHEDULES AND TARIFFS Procedures for Changing Tariffs § 154.208 Service of tariff filings on customers and... customers and state regulatory commissions that have made a standing request for such service. (c) Within... section, service upon the designated recipient will be deemed service upon the customer or other party. (e...

  14. 9 CFR 381.208 - Poultry products offered for entry and entered to be handled and transported as domestic; entry...

    Science.gov (United States)

    2010-01-01

    ... Cosmetic Act. (b) Poultry products entered in accordance with this subpart may, subject to the provisions... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Poultry products offered for entry and....208 Section 381.208 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF...

  15. 22 CFR 208.420 - May I approve a transaction with an excluded or disqualified person at a lower tier?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false May I approve a transaction with an excluded or disqualified person at a lower tier? 208.420 Section 208.420 Foreign Relations AGENCY FOR INTERNATIONAL... lower tier? If a transaction at a lower tier is subject to your approval, you as an agency official may...

  16. 31 CFR 538.208 - Prohibited grant or extension of credits or loans to the Government of Sudan.

    Science.gov (United States)

    2010-07-01

    ... credits or loans to the Government of Sudan. 538.208 Section 538.208 Money and Finance: Treasury... loans to the Government of Sudan. Except as otherwise authorized, the grant or extension of credits or loans by any United States person to the Government of Sudan is prohibited. ...

  17. Atipias de Células Escamosas de Significado Indeterminado (ASCUS): estudo de 208 Casos Atypical Squamous Cells of Undetermined Significance (ASCUS): study of 208 Cases

    OpenAIRE

    José Eleutério Junior; Diane Isabelle Magno Cavalcante; Dias, Maria Tereza M. P.; Alves,Rossana M.; Queiroz,Gabriela C.; Proença,Aline R.

    2000-01-01

    Objetivos: avaliar aspectos clínicos, colposcópicos e acompanhamento citológico de quadros classificados como atipias de células escamosas de significado indeterminado (ASCUS). Métodos: foram analisados retrospectivamente 208 casos de ASCUS diagnosticados entre 1996 e 1998 e tabulados quanto a idade, queixas clínicas, colposcopia e seguimento. Resultados: a relação ASCUS:lesão intra-epitelial escamosa foi de 1:1,2, confirmando adequado controle de qualidade. Pacientes com menos de 35 anos cor...

  18. Event by Event Analysis of High Multiplicity Events Produced in 158 A GeV/c 208 Pb- 208 Pb Collisions

    CERN Document Server

    Ahmad, Shakeel; Kumar, Ashwini; Chaturvedi, O S K; Ahmad, A; Zafar, M; Irfan, M; Singh, B K

    2015-01-01

    An extensive analysis of individual high multiplicity events produced in 158 A GeV /c 208Pb- 208Pb collisions is carried by adopting different methods to examine the anomalous behavior of these rare events. A method of selecting the events with densely populated narrow regions or spikes out of a given sample of collision events is discussed.Employing this approach two events with large spikes in their eta- and phi- distributions are selected for further analysis. For the sake of comparison, another two events which do not exhibit such spikes are simultaneously analyzed. The findings suggest that the systematic studies of particle density fluctuations in one- and two-dimensional phase-spaces and comparison with those obtained from the studies of correlation free Monte Carlo events, would be useful for identifying the events with large dynamical fluctuations. Formation of clusters or jet like phenomena in multihadronic final states in individual events is also discussed and the experimental findings are compare...

  19. 22 CFR 208.300 - What must I do before I enter into a covered transaction with another person at the next lower tier?

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false What must I do before I enter into a covered transaction with another person at the next lower tier? 208.300 Section 208.300 Foreign Relations AGENCY FOR... Participants Regarding Transactions Doing Business with Other Persons § 208.300 What must I do before I enter...

  20. miR-208-3p promotes hepatocellular carcinoma cell proliferation and invasion through regulating ARID2 expression

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Peng; Wu, Dingguo; You, Yu; Sun, Jing; Lu, Lele; Tan, Jiaxing; Bie, Ping, E-mail: bieping2010@163.com

    2015-08-15

    MicroRNAs (miRNAs) are small non-coding RNAs that negatively regulate gene expression at post-transcriptional level. miRNA dysregulation plays a causal role in cancer progression. In this study, miR-208-3p was highly expressed and directly repressed ARID2 expression. As a result, ARID2 expression in hepatocellular carcinoma (HCC) was decreased. In vitro, miR-208-3p down-regulation and ARID2 over-expression elicited similar inhibitory effects on HCC cell proliferation and invasion. In vivo test results revealed that miR-208-3p down-regulation inhibited HCC tumorigenesis in Hep3B cells. Moreover, ARID2 was possibly a downstream element of transforming growth factor beta1 (TGFβ1)/miR-208-3p/ARID2 regulatory pathway. These findings suggested that miR-208-3p up-regulation is associated with HCC cell progression and may provide a new target for liver cancer treatment. - Highlights: • miR-208-3p was highly expressed and directly repressed the expression of ARID2 in HCC. • miR-208-3p contributed to HCC cell progression both in vitro and in vivo. • Over-expression of ARID2 inhibited the HCC cell proliferation and invasion. • Restoration of ARID2 partly reversed the the effect of miR-208-3p down-regulation on HCC cells. • Newly regulatory pathway: miR-208-3p mediated the repression of ARID2 by TGFβ1 in HCC cells.

  1. Coulomb excitation of re-accelerated 208Rn and 206Po beams

    Directory of Open Access Journals (Sweden)

    Grahn T.

    2013-12-01

    Full Text Available In the present study, B(E2; 2+ → 0+ values have been measured in the 208Rn and 206Po nuclei through Coulomb excitation of re-accelerated radioactive beams in inverse kinematics at CERN-ISOLDE. The resulting B(E2; 2+ → 0+ in 208Rn is ∼ 0.08 e2b2. These nuclei lie in, or at the boundary of the region where seniority scheme should persist. However, contributions from collective excitations may be present when moving away from the N = 126 shell closure. To date, surprisingly little is known of the transition probabilities between the low-spin states in this region.

  2. Scattering of {sup 8}He on {sup 208}Pb at 22 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Marquinez-Duran, G.; Sanchez-Benitez, A. M.; Martel, I.; Berjillos, R.; Duenas, J. A.; Parkar, V. V. [Depto. de Fisica Aplicada, Universidad de Huelva, 21071 Huelva (Spain); Acosta, L. [Depto. de Fisica Aplicada, Universidad de Huelva, 21071 Huelva, Spain and Laboratori Nazionali del Sud, INFN, Via Santa Sofia 62, 95123, Catania (Italy); Rusek, K. [Heavy Ion Laboratory, University of Warsaw (Poland); Alvarez, M. A. G.; Gomez-Camacho, J. [Centro Nacional de Aceleradores, 41092, Sevilla, Spain and Depto. de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, 41080 Sevilla (Spain); Borge, M. J. G.; Cruz, C.; Cubero, M.; Pesudo, V.; Tengblad, O. [Instituto de Estructura de la Materia, CSIC, 28006 Madrid (Spain); Chbihi, A. [GANIL, CEA and IN2P3-CNRS, B.P. 5027, 14076 Caen cedex (France); Fernandez-Garcia, J. P.; Moro, A. M. [Depto. de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, 41080 Sevilla (Spain); Fernandez-Martinez, B.; Labrador, J. A. [Centro Nacional de Aceleradores, 41092, Sevilla (Spain); and others

    2013-06-10

    The skin nucleus {sup 8}He is investigated by measuring the angular distribution of the elasticly scattered {sup 8}He and the {sup 6,4}He fragments produced in the collision with a {sup 208}Pb target at 22 MeV, just above the Coulomb barrier. The experiment was carried out at SPIRAL/GANIL in 2010. Here we present preliminary results for the elastic scattering.

  3. LOW-ENERGY ISOSCALAR DIPOLE STRENGTH IN CA-40, NI-58, ZR-90 AND PB-208

    NARCIS (Netherlands)

    POELHEKKEN, TD; HESMONDHALGH, SKB; HOFMANN, HJ; VANDERWOUDE, A; HARAKEH, MN

    1992-01-01

    The 1 hBAR-omega low-energy isoscalar dipole strength has been studied in Pb-208, Zr-90, Ni-58 and Ca-40, using the (alpha, alpha'gamma(0)) reaction at 0-degrees. The fraction of the isoscalar dipole EWSR exhausted by the observed 1- states in the four nuclei is at maximum 14.7%, 8.0%, 5.0% and

  4. The First Outbreak Caused by Acinetobacter baumannii ST208 and ST195 in China

    Directory of Open Access Journals (Sweden)

    Junyan Qu

    2016-01-01

    Full Text Available This study aimed to analyze the clinical characteristics of patients and molecular mechanisms of the first outbreak mainly caused by sequence types (STs 208 multidrug resistant (MDR Acinetobacter baumannii in China. A total of 10 clinical samples were collected from 5 patients who were involved in the outbreak. Bacterial identification and antibiotic sensitivity tests were performed by the VITEK-2 COMPACT automated system. MICs of tigecycline for clinical isolates were determined using broth microdilution. The clonal relatedness of A. baumannii clinical isolates in our local settings was determinated by pulsed-field gel electrophoresis (PFGE and multilocus sequence typing (MLST. A total of 7 A. baumannii strains were isolated and all were MDR strains; two of them were carbapenem-nonsusceptible strains. blaOXA-23 was the only acquired carbapenemase gene in the isolates. The isolates belonged to a single clonal pulsotype determined by PFGE and two sequences types (STs determined by MLST. The isolates belonged to the globally disseminated clonal complex 92, among which ST195 and ST208 were the most common sequence types (71.43% and 28.57%. The outbreak was successfully controlled by stringent infection control measures, especially improving the hand hygiene compliance and enhancing antimicrobial stewardship. In conclusion, this is the first description of an outbreak caused mainly by A. baumannii of ST208 in China. Infection control measures should be strengthened when infection outbreaks in hospital.

  5. Systematic study of various proximity potentials in 208Pb-daughter cluster radioactivity

    Science.gov (United States)

    Kumar, Raj; Sharma, Manoj K.

    2012-05-01

    Various types of nuclear proximity potentials are employed to study the cluster decay of radioactive nuclei, particularly those decaying to a doubly closed shell 208Pb-daughter nucleus using the preformed cluster-decay model (PCM). The deformation effect is included up to quadrupole (β2) with “optimum” cold orientations. The use of different proximity potentials modifies the potential barrier characteristics (i.e., barrier height, position, and frequency), which in turn change the preformation probability P0 and tunneling probability P, and hence the decay half-life considerably. The analysis of 208Pb-daughter cluster radioactivity is worked out at touching as well as at an elongated neck configuration by taking the neck-length parameter ΔR=0.5 fm. A wide range of barrier characteristics is covered by using various nuclear proximity potentials. We observe that Prox 1977 and Prox 1988 can reproduce the experimental half-lives very well at ΔR=0.5 fm; however, the use of the mod-Prox 1988 potential seems more reliable for 14C cluster decay. The relevance of barrier characteristics of other nuclear proximity potentials is also explored in the context of 208Pb cluster radioactivity.

  6. Safety Analysis of Pb-208 Cooled 800 MWt Modified CANDLE Reactors

    Science.gov (United States)

    Su'ud, Zaki; Widiawati, Nina; Sekimoto, H.; Artoto, A.

    2017-01-01

    Safely analysis of 800MWt Pb-208 cooled fast reactors with natural Uranium as fuel cycle input employing axial-radial combined Modiified CANDLE burnup scheme has been performed. The analysis of unprotected loss of flow(ULOF) and unprotected rod run-out transient overpower (UTOP) are discussed. Some simulations for 800 MWt Pb-208 cooled fast reactors has been performed and the results show that the reactor can anticipate complete pumping failure inherently by reducing power through reactivity feedback and remove the rest of heat through natural circulations. Compared to the Pb-nat cooled long life Fast Reactors, Pb-208 cooled reactors have smaller Doppler but higher coolant density reactivity coefficient. In the UTOP accident case the analysis has been performed against external reactivity up to 0.003dk/k. And for ULOHS case it is assumed that the secondary cooling system has broken. During all accident the cladding temperature is the most critical. Especially for the case of UTOP accident. In addition the steam generator design has also consider excess power which may reach 50% extra during severe UTOP case..

  7. 5 CFR 2640.302 - Waivers issued pursuant to 18 U.S.C. 208(b)(3).

    Science.gov (United States)

    2010-01-01

    ... ETHICS INTERPRETATION, EXEMPTIONS AND WAIVER GUIDANCE CONCERNING 18 U.S.C. 208 (ACTS AFFECTING A PERSONAL... committee upon which the individual is serving, or will serve, is an advisory committee within the meaning...

  8. Internal fixation or arthroplasty for displaced cervical hip fractures in the elderly: a randomised controlled trial of 208 patients

    National Research Council Canada - National Science Library

    Parker, M J; Pryor, G A

    2000-01-01

    208 patients aged over 70 years with a displaced cervical hip fracture were admitted to a prospective randomised trial of internal fixation using 3 parallel cannulated screws or an uncemented Austin...

  9. Sub-barrier transfer in 16O+208Pb and 32S+208Pb and its role in understanding the suppression of fusion

    Directory of Open Access Journals (Sweden)

    Hinde D. J.

    2012-10-01

    Full Text Available A detailed analysis of the projectile-like fragments detected at backward angles in the reactions 16O, 32S+208Pb at energies below the fusion barrier is presented. Excitation functions corresponding to nucleon transfer with ΔZ = 1 and ΔZ = 2 were extracted, indicating surprisingly large absolute probabilities at sub-barrier energies. A comparison of 2p transfer probabilities with time-dependent Hartree-Fock calculations suggests strong pairing correlations between the two protons. Excitation energies in the projectile-like fragments up to ~ 15MeV for the 16O and ~ 25MeV for 32S-induced reactions demonstrate the population of highly excited states in the residual nuclei, indicating substantial dissipation of kinetic energy. These highly inelastic (large excitation energies and complex (correlated few-nucleon transfer processes may be closely related to the depletion of fusion through tunnelling at sub-barrier energies.

  10. A first-in-human study of AMG 208, an oral MET inhibitor, in adult patients with advanced solid tumors.

    Science.gov (United States)

    Hong, David S; Rosen, Peter; Lockhart, A Craig; Fu, Siqing; Janku, Filip; Kurzrock, Razelle; Khan, Rabia; Amore, Benny; Caudillo, Isaac; Deng, Hongjie; Hwang, Yuying C; Loberg, Robert; Ngarmchamnanrith, Gataree; Beaupre, Darrin M; Lee, Peter

    2015-07-30

    This first-in-human study evaluated AMG 208, a small-molecule MET inhibitor, in patients with advanced solid tumors. Three to nine patients were enrolled into one of seven AMG 208 dose cohorts (25, 50, 100, 150, 200, 300, and 400 mg). Patients received AMG 208 orally on days 1 and days 4-28 once daily. The primary objectives were to evaluate the safety, tolerability, pharmacokinetics, and maximum tolerated dose (MTD) of AMG 208. Fifty-four patients were enrolled. Six dose-limiting toxicities were observed: grade 3 increased aspartate aminotransferase (200 mg), grade 3 thrombocytopenia (200 mg), grade 4 acute myocardial infarction (300 mg), grade 3 prolonged QT (300 mg), and two cases of grade 3 hypertension (400 mg). The MTD was not reached. The most frequent grade ≥3 treatment-related adverse event was anemia (n = 3) followed by hypertension, prolonged QT, and thrombocytopenia (two patients each). AMG 208 exposure increased linearly with dose; mean plasma half-life estimates were 21.4-68.7 hours. One complete response (prostate cancer) and three partial responses (two in prostate cancer, one in kidney cancer) were observed. In this study, AMG 208 had manageable toxicities and showed evidence of antitumor activity, particularly in prostate cancer.

  11. Dynamical Cluster-decay Model (DCM) applied to 9Li+208Pb reaction

    Science.gov (United States)

    Kaur, Arshdeep; Hemdeep; Kaushal, Pooja; Behera, Bivash R.; Gupta, Raj K.

    2017-10-01

    The decay mechanism of 217At* formed in 9Li+208Pb reaction is studied within the dynamical cluster-decay model (DCM) at various center-of-mass energies. The aim is to see the behavior of a light neutron-rich radioactive beam on a doubly-magic target nucleus for the (total) fusion cross section σfus and the individual decay channel cross sections. Experimentally, only the isotopic yield of heavy mass residues 211-214At * [equivalently, the light-particles (LPs) evaporation residue cross sections σxn for x = 3- 6 neutrons emission] are measured, with the fusion-fission (ff) component σff taken zero. For a fixed neck-length parameter ΔR, the only parameter in the DCM, we are able to fit σfus =∑x=16σxn almost exactly for 9Li on 208Pb at all E c . m .'s. However, the observed individual decay channels (3n-6n) are very poorly fitted, with unobserved channels (1n, 2n) and σff strongly over-estimated. Different ΔR values, meaning thereby different reaction time scales, are required to fit individually both the observed and unobserved evaporation residue channels (1n-6n) and σff, but then the compound nucleus (CN) contribution σCN is very small (< 1%), and the non-compound nucleus (nCN) decay cross section σnCN contributes the most towards total σfus (=σCN +σnCN). Thus, the 9Li induced reaction on doubly-magic 208Pb is more of a quasi-fission-like nCN decay, which is further analyzed in terms of the statistical CN formation probability PCN and CN survival probability Psurv. For the reaction under study, PCN < < 1 and Psurv → 1, in particular at above barrier energies.

  12. Study of fusion for the {sup 8}Li + {sup 208}Pb system

    Energy Technology Data Exchange (ETDEWEB)

    Aguilera, E.F.; Martinez Q, E.; Garcia M, H.; Gomez C, A. [Departamento de Aceleradores, INlN, AP 18-1027, 11801, Mexico, D.F. (Mexico); Kolata, J.J. [Physics Department, University of Notre Dame, Notre Dame, Indiana, 46556-5670 (United States); DeYoung, P.A.; Peaslee, G.F.; Mears, P.; Guess, C. [Physics Department, Hope College, Holland, Michigan, 49422-9000 (United States); Becchetti, F.D.; Lupton, J.H.; Chen, Y. [Physics Department, University of Michigan, Ann Arbor, Michigan, 48109-1120 (United States)

    2007-12-15

    The excitation function for complete fusion of the radioactive projectile {sup 8}Li with a {sup 208}Pb target has been measured at energies near but above the Coulomb barrier, via the 4n and 5n evaporation channels. Comparing with the predictions of a simple evaporation calculation using the code PACE2, the high energy behaviour of the data can be qualitatively understood if a contribution of fusion with a {sup 7}Li cluster is included, consistent with breakup prior to fusion. A fusion suppression factor of 0.7310.03 is deduced and possible incomplete fusion processes are discussed. (Author)

  13. Properties of isoscalar monopole particle-hole-type excitations in 208Pb

    Directory of Open Access Journals (Sweden)

    Gorelik M. L.

    2016-01-01

    Full Text Available The particle-hole dispersive optical model developed recently is applied to describe properties of high-energy isoscalar monopole excitations in 208Pb. We consider, in particular, the double transition density averaged over the energy of the isoscalar monopole excitations in a wide energy interval, which includes the isoscalar giant monopole resonance and its overtone. The energy-averaged strength functions of these resonances are also analyzed. Some corrections to the calculation scheme are formulated to restore the model unitarity.

  14. Measurement of the Neutron Radius of 208Pb Through Parity-Violation in Electron Scattering

    CERN Document Server

    Abrahamyan, S; Albataineh, H; Aniol, K; Armstrong, D S; Armstrong, W; Averett, T; Babineau, B; Barbieri, A; Bellini, V; Beminiwattha, R; Benesch, J; Benmokhtar, F; Bielarski, T; Boeglin, W; Camsonne, A; Canan, M; Carter, P; Cates, G D; Chen, C; Chen, J -P; Hen, O; Cusanno, F; Dalton, M M; De Leo, R; de Jager, K; Deconinck, W; Decowski, P; Deng, X; Deur, A; Dutta, D; Etile, A; Flay, D; Franklin, G B; Friend, M; Frullani, S; Fuchey, E; Garibaldi, F; Gasser, E; Gilman, R; Giusa, A; Glamazdin, A; Gomez, J; Grames, J; Gu, C; Hansen, O; Hansknecht, J; Higinbotham, D W; Holmes, R S; Holmstrom, T; Horowitz, C J; Hoskins, J; Huang, J; Hyde, C E; Itard, F; Jen, C -M; Jensen, E; Jin, G; Johnston, S; Kelleher, A; Kliakhandler, K; King, P M; Kowalski, S; Kumar, K S; Leacock, J; Leckey, J; Lee, J H; LeRose, J J; Lindgren, R; Liyanage, N; Lubinsky, N; Mammei, J; Mammoliti, F; Margaziotis, D J; Markowitz, P; McCreary, A; McNulty, D; Mercado, L; Meziani, Z -E; Michaels, R W; Mihovilovic, M; Muangma, N; Muñoz-Camacho, C; Nanda, S; Nelyubin, V; Nuruzzaman, N; Oh, Y; Palmer, A; Parno, D; Paschke, K D; Phillips, S K; Poelker, B; Pomatsalyuk, R; Posik, M; Puckett, A J R; Quinn, B; Rakhman, A; Reimer, P E; Riordan, S; Rogan, P; Ron, G; Russo, G; Saenboonruang, K; Saha, A; Sawatzky, B; Shahinyan, A; Silwal, R; Sirca, S; Slifer, K; Solvignon, P; Souder, P A; Sperduto, M L; Subedi, R; Suleiman, R; Sulkosky, V; Sutera, C M; Tobias, W A; Troth, W; Urciuoli, G M; Waidyawansa, B; Wang, D; Wexler, J; Wilson, R; Wojtsekhowski, B; Yan, X; Yao, H; Ye, Y; Ye, Z; Yim, V; Zana, L; Zhan, X; Zhang, J; Zhang, Y; Zheng, X; Zhu, P

    2012-01-01

    We report the first measurement of the parity-violating asymmetry A_PV in the elastic scattering of polarized electrons from 208Pb. A_PV is sensitive to the radius of the neutron distribution (Rn). The result A_PV = 0.656 \\pm 0.060 (stat) \\pm 0.013 (syst) corresponds to a difference between the radii of the neutron and proton distributions Rn - Rp = 0.33 +0.16 -0.18 fm and provides the first electroweak observation of the neutron skin which is expected in a heavy, neutron-rich nucleus.

  15. Contrast-enhanced Digital Mammography: A Single-Institution Experience of the First 208 Cases.

    Science.gov (United States)

    Lewis, Tiffany C; Pizzitola, Victor J; Giurescu, Marina E; Eversman, William G; Lorans, Roxanne; Robinson, Kristin A; Patel, Bhavika K

    2017-01-01

    Contrast-enhanced digital mammography (CEDM) is the only imaging modality that provides both (a) a high-resolution, low-energy image comparable to that of digital mammography and (b) a contrast-enhanced image similar to that of magnetic resonance imaging. We report the initial 208 CEDM examinations performed for various clinical indications and provide illustrative case examples. Given its success in recent studies and our experience of CEDM primarily as a diagnostic adjunct, CEDM can potentially improve breast cancer detection by combining the low-cost conclusions of screening mammography with the high sensitivity of magnetic resonance imaging. © 2016 Wiley Periodicals, Inc.

  16. Self-consistent calculation of phonon gyromagnetic ratios in 208Pb

    Science.gov (United States)

    Saperstein, E. E.; Kamerdzhiev, S. P.; Krewald, S.; Speth, J.; Tolokonnikov, S. V.

    2014-01-01

    Within the Theory of Finite Fermi Systems the gyromagnetic ratios g {/L ph } of all low-lying phonons in 208Pb are calculated. The input data, i.e., single-particle energies, single-particle wavefunctions, and the ph interaction are derived from the Energy Density Functional by Fayans et al. For the 3{1/-} phonon which is the most collective state, the g {/L ph } value is close to the prediction of the collective Bohr-Mottelson (BM) model. Gyromagnetic ratios of other phonons that are included in our calculations, two 5- states and six positive parity phonons, differ significantly from the BM model prediction.

  17. Luteolin Inhibits Ischemia/Reperfusion-Induced Myocardial Injury in Rats via Downregulation of microRNA-208b-3p.

    Directory of Open Access Journals (Sweden)

    Chen Bian

    Full Text Available Luteolin (LUT, a kind of flavonoid which is extracted from a variety of diets, has been reported to convey protective effects of various diseases. Recent researches have suggested that LUT can carry out cardioprotective effects during ischemia/reperfusion (I/R. However, there have no reports on whether LUT can exert protective effects against myocardial I/R injury through the actions of specific microRNAs (miRs. The purpose of this study was to determine which miRs and target genes LUT exerted such function through.Expression of various miRs in perfused rat hearts was detected using a gene chip. Target genes were predicted with TargetScan, MiRDB and MiRanda. Anoxia/reoxygenation was used to simulate I/R. Cells were transfected by miR-208b-3p mimic, inhibitor and small interfering RNA of Ets1 (avian erythroblastosis virus E26 (v ets oncogene homolog 1. MiR-208b-3p and Ets1 mRNA were quantified by real-time quantitative polymerase chain reaction. The percentage of apoptotic cells was detected by annexin V-fluorescein isothiocyanate/propidium iodide dyeing and flow cytometry. The protein expression levels of cleaved caspase-3, Bcl-2, Bax, and Ets1 were examined by western blot analysis. A luciferase reporter assay was used to verify the combination between miR-208b-3p and the 3'-untranslated region of Ets1.LUT pretreatment reduced miR-208b-3p expression in myocardial tissue, as compared to the I/R group. And LUT decreased miR-208b-3p expression and apoptosis caused by I/R. However, overexpression of miR-208b-3p further aggravated the changes caused by I/R and blocked all the effects of LUT. Knockdown of miR-208b-3p expression also attenuated apoptosis, while knockdown of Ets1 promoted apoptosis. Further, the luciferase reporter assay showed that miR-208b-3p could inhibit Ets1 expression.LUT pretreatment conveys anti-apoptotic effects after myocardial I/R injury by decreasing miR-208b-3p and increasing Ets1 expression levels.

  18. Fabrication of self-supporting targets of lead (206,208Pb) using evaporation technique

    Science.gov (United States)

    Goyal, Savi; Abhilash, S. R.; Kabiraj, D.; Kalkal, Sunil; Mandal, S.

    2015-03-01

    The self-supporting 206,208Pb enriched isotopic targets of thicknesses varying from 500 μg/cm2 to 800 μg/cm2 have been prepared in the high vacuum environment at the target laboratory of Inter University Accelerator Centre (IUAC), by using the resistive heating method. The limited amount of the target material, selection of the parting agent, highly oxidizing tendency of the Pb in the atmosphere and the separation of the lead film from the glass slides were the few major challenges faced in the fabrication of the targets. A limited amount of isotopic material (100 mg) was utilized for the preparation of more than 20 thick self-supporting targets of 206Pb and 208Pb isotopes. Several attempts were made to overcome the difficulty of finding a suitable parting agent to avoid direct contact of water with the target material are discussed, along with the methods adopted for the fabrication of the targets. Further Energy Dispersive X-ray (EDX) analysis was performed to check the elemental purity of the foils. These targets have been successfully used for several nuclear physics experiments using the neutron detector setup known as National Array of Neutron Detectors (NAND) at IUAC, New Delhi.

  19. Fabrication of self-supporting targets of lead ({sup 206,208}Pb) using evaporation technique

    Energy Technology Data Exchange (ETDEWEB)

    Goyal, Savi, E-mail: savi.november@gmail.com [Department of Physics & Astrophysics, University of Delhi, Delhi 110007 (India); Abhilash, S.R.; Kabiraj, D. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India); Kalkal, Sunil; Mandal, S. [Department of Physics & Astrophysics, University of Delhi, Delhi 110007 (India)

    2015-03-21

    The self-supporting {sup 206,208}Pb enriched isotopic targets of thicknesses varying from 500 μg/cm{sup 2} to 800 μg/cm{sup 2} have been prepared in the high vacuum environment at the target laboratory of Inter University Accelerator Centre (IUAC), by using the resistive heating method. The limited amount of the target material, selection of the parting agent, highly oxidizing tendency of the Pb in the atmosphere and the separation of the lead film from the glass slides were the few major challenges faced in the fabrication of the targets. A limited amount of isotopic material (100 mg) was utilized for the preparation of more than 20 thick self-supporting targets of {sup 206}Pb and {sup 208}Pb isotopes. Several attempts were made to overcome the difficulty of finding a suitable parting agent to avoid direct contact of water with the target material are discussed, along with the methods adopted for the fabrication of the targets. Further Energy Dispersive X-ray (EDX) analysis was performed to check the elemental purity of the foils. These targets have been successfully used for several nuclear physics experiments using the neutron detector setup known as National Array of Neutron Detectors (NAND) at IUAC, New Delhi.

  20. Measurement of the Parity Violating Asymmetry in Elastic Electron Scattering off 208Pb

    Energy Technology Data Exchange (ETDEWEB)

    Wexler, Jonathan [Univ. of Massachusetts, Amherst, MA (United States)

    2014-09-01

    The Lead Radius Experiment (PREX) was carried out in order to provide a model-independent measurement of the RMS radius √<$2\\atop{n}$> of the neutron distribution in the 208Pb nucleus. The parity-violating scattering asymmetry for longitudinally polarized 1.06 GeV electrons from an unpolarized 208Pb target was measured at Q2 = 0.00880 GeV2. This measurement was performed by the PREX collaboration in Hall A at Jefferson Laboratory in Newport News, VA, between March and June, 2010. The electron detectors used in this measurement were designed and fabricated by University of Massachusetts-Amherst and Smith College. The resulting parity-violating asymmetry was measured as APV = 656±60(stat.)±14(sys.) ppb. This asymmetry extrapolates to a difference in radii between the nuclear neutron and proton distributions of √<$2\\atop{n}$>-√<$2\\atop{p}$>=0.33$+0.16\\atop{-0.18}$ fm.

  1. Lead 207, 208 (n, xn gamma) reactions for neutron energies up to 200 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Pavlik, A.; Vonach, H. [Univ. Wien (Austria). Inst. fuer Radiumforschung und Kernphysik; Chadwick, M.B.; Haight, R.C.; Nelson, R.O.; Wender, S.A.; Young, P.G. [Los Alamos National Lab., NM (United States)

    1994-07-01

    High-resolution {gamma}-ray spectra from the interaction of neutrons in the energy range from 3 to 200 MeV with {sup 207,208}Pb were measured with the white neutron source at the WNR facility at Los Alamos National Laboratory. From these data, excitation functions for prominent {gamma} transitions in {sup 200,202,204,206,207,208}Pb were derived from threshold to 200 MeV incident neutron energy. These {gamma}-production cross sections represent formation cross sections for excited states of the residual nuclei. The results are compared with the predictions of nuclear reaction calculations based on the exciton model for precompound emission, the Hauser-Feshbach theory for compound nuclear decay, and coupled channels calculations to account for direct excitation of collective levels. Good agreement was obtained over the entire energy range covered in the experiment with reasonable model parameters. The results demonstrate that multiple preequilibrium emission has to be taken into account above about 40 MeV, and that the level density model of Ignatyuk should be used instead of the Gilbert-Cameron and back-shifted Fermi-gas models if excitation energies exceed about 30 MeV.

  2. Collective 2{sup +}{sub 1} excitations in {sup 206}Po and {sup 208,210}Rn

    Energy Technology Data Exchange (ETDEWEB)

    Grahn, T.; Auranen, K.; Herzan, A.; Jakobsson, U.; Julin, R.; Konki, J.; Peura, P.; Rahkila, P.; Stolze, S. [Department of Physics, University of Jyvaskyla (Finland); Helsinki Institute of Physics, Helsinki (Finland); Pakarinen, J. [Department of Physics, University of Jyvaskyla (Finland); Helsinki Institute of Physics, Helsinki (Finland); CERN-ISOLDE, PH Department, CERN, Geneva (Switzerland); Jokiniemi, L.; Suhonen, J. [Department of Physics, University of Jyvaskyla (Finland); Albers, M.; Blazhev, A.; Lewandowski, L.; Moschner, K.; Pfeiffer, M.; Radeck, D.; Reiter, P.; Rudiger, M.; Seidlitz, M.; Siebeck, B.; Steinbach, T.; Thoele, P.; Warr, N.; Vogt, A. [Universitaet zu Koeln, Institut fuer Kernphysik, Koeln (Germany); Bauer, C.; Boenig, S.; Kroell, T.; Thuerauf, M. [TU Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Bernards, C. [Yale University, Wright Nuclear Structure Laboratory, New Haven, CT (United States); Butler, P.A. [University of Liverpool, Department of Physics, Oliver Lodge Laboratory, Liverpool (United Kingdom); Damyanova, A. [Universite de Geneve (Switzerland); Coster, T. de; Witte, H. de; Elseviers, J.; Huyse, M.; Kesteloot, N.; Reynders, K.; Sambi, S.; Wrzosek-Lipska, K. [Department of Physics, Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); Gaffney, L.P. [University of Liverpool, Department of Physics, Oliver Lodge Laboratory, Liverpool (United Kingdom); Department of Physics, Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); University of the West of Scotland, School of Engineering, Paisley (United Kingdom); Rapisarda, E.; Duppen, P. van [Department of Physics, Instituut voor Kern- en Stralingsfysica, Leuven (Belgium); CERN-ISOLDE, PH Department, CERN, Geneva (Switzerland); Salsac, M.D.; Zielinska, M. [CEA-Saclay, Gif-sur-Yvette (France); Scheck, M. [TU Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); University of the West of Scotland, School of Engineering, Paisley (United Kingdom); Venhart, M.; Veselsky, M. [Slovak Academy of Sciences, Institute of Physics, Bratislava 45 (Slovakia); Vermeulen, M.J. [University of York, Department of Physics, York (United Kingdom); Werner, V. [TU Darmstadt, Institut fuer Kernphysik, Darmstadt (Germany); Yale University, Wright Nuclear Structure Laboratory, New Haven, CT (United States)

    2016-11-15

    In the present study, B(E2; 2{sup +}{sub 1} → 0{sup +}{sub 1}) values have been measured in the {sup 208,210}Rn and {sup 206}Po nuclei through Coulomb excitation of re-accelerated radioactive beams in inverse kinematics at CERN-ISOLDE. These nuclei have been proposed to lie in, or at the boundary of the region where the seniority scheme should persist. However, contributions from collective excitations are likely to be present when moving away from the N = 126 closed shell. Such an effect is confirmed by the observed increased collectivity of the 2{sup +}{sub 1} → 0{sup +}{sub 1} transitions. Experimental results have been interpreted with the aid of theoretical studies carried out within the BCS-based QRPA framework. (orig.)

  3. Observation of isomeric decays and the high spin states in doubly-odd 208Fr

    CERN Document Server

    Kanjilal, D; Goswami, A; Kshetri, R; Raut, R; Saha, S; Bhowmik, R K; Gehlot, J; Muralithar, S; Singh, R P; Jnaneswari, G; Mukherjee, G; Mukherjee, B

    2009-01-01

    Neutron deficient isotopes of Francium (Z=87, N=121-123) as excited nuclei were produced in the fusion-evaporation reaction: 197Au(16O,xn)[213-x]Fr at 100 MeV. The gamma-rays from the residues were observed through the high sensitivity Germanium Clover detector array INGA. The decay of the high spin states and the isomeric states of the doubly-odd 208Fr nuclei, identified from the known sequence of ground state transitions, were observed. The half lives of the 194(2) keV isomeric transition, known from earlier observations, was measured to be 233(18) ns. A second isomeric transition at 383(2) keV and half life of 33(7) ns was also found. The measured half lives were compared with the corresponding single particle estimates, based on a the level scheme obtained from the experiment.

  4. High spin states and isomeric decays in doubly-odd 208Fr

    Science.gov (United States)

    Kanjilal, D.; Bhattacharya, S.; Goswami, A.; Kshetri, R.; Raut, R.; Saha, S.; Bhowmik, R. K.; Gehlot, J.; Muralithar, S.; Singh, R. P.; Jnaneswari, G.; Mukherjee, G.; Mukherjee, B.

    2010-10-01

    Neutron deficient isotopes of francium ( Z=87, N˜121-123) as excited nuclei were produced in the fusion-evaporation reaction: 197Au( 16O, xn) 213 - xFr at 100 MeV. The γ rays from the residues were observed through the high sensitivity Germanium Clover detector array INGA. The decay of the high spin states and the isomeric states of the doubly-odd 208Fr nuclei, identified from the known sequence of ground state transitions, were observed. The half-lives of the E=194(2) keV isomeric transition, known from earlier observations, was measured to be T=233(18) ns. A second isomeric transition at E=383(2) keV and T=33(7) ns was also found. The measured half-lives were compared with the corresponding single particle estimates, based on the level scheme obtained from the experiment.

  5. Evaluation at the medium energy region for Pb-208 and Bi-209

    Energy Technology Data Exchange (ETDEWEB)

    Fukahori, Tokio; Pearlstein, S.

    1991-01-01

    Medium energy nuclear data in the 1--1000 MeV range is necessary to accelerator applications which include spallation neutron sources for radioactive waste treatment and accelerator shielding design, medical applications which include isotopes production and radiation therapy, and space applications. For the design of fission and fusion reactors, the nuclear data file for neutrons below 20 MeV is available and well evaluated. Evaluated nuclear data for protons and data in the medium energy region, however, have not been prepared completely. Evaluation in the medium energy region was performed using the theoretical calculation code ALICE-P or experimental data. In this paper, the evaluation of neutron and proton induced nuclear data for Pb-208 and Bi-209 has been performed using ALICE-P, empirical calculations and new systematics for the fission cross section. The evaluated data are compiled for possible inclusion in the ENDF/B-VI High Energy File. 204 refs., 51 figs., 9 tabs.

  6. Two-phonon giant resonances in {sup 136}Xe, {sup 208}Pb, and {sup 238}U

    Energy Technology Data Exchange (ETDEWEB)

    Boretzky, K.; Gruenschloss, A.; Ilievski, S.; Adrich, P.; Aumann, T.; Bertulani, C.A.; Cub, J.; Dostal, W.; Eberlein, B.; Elze, T.W.; Emling, H.; Fallot, M.; Holeczek, J.; Holzmann, R.; Kozhuharov, C.; Kratz, J.V.; Kulessa, R.; Leifels, Y.; Leistenschneider, A.; Lubkiewicz, E.; Mordechai, S.; Ohtsuki, T.; Reiter, P.; Simon, H.; Stelzer, K.; Stroth, J.; Suemmerer, K.; Surowiec, A.; Wajda, E.; Walus, W.

    2003-07-01

    The excitation of the double-phonon giant dipole resonance was observed in heavy projectile nuclei impinging on targets of high nuclear charge with energies of 500-700 MeV/nucleon. New experimental data are presented for {sup 136}Xe and {sup 238}U together with further analysis of earlier data on {sup 208}Pb. Differential cross sections d{sigma}/dE{sup *} and d{sigma}/d{theta} for electromagnetic excitations were deduced. Depending on the isotope, cross sections appear to be enhanced in comparison to those expected from a purely harmonic nuclear dipole response. The cumulative effect of excitations of two-phonon states composed of one dipole and one quadrupole phonon, of predicted anharmoniticies in the double-phonon dipole response, and of damping of the dipole resonance during the collision may account for the discrepancy. In addition, decay properties of two-phonon resonances were studied and compared to that of a statistical decay. (orig.)

  7. Self-consistent calculations of radiative nuclear reaction characteristics for 56Ni, 132Sn, 208Pb

    Science.gov (United States)

    Achakovskiy, Oleg; Kamerdzhiev, Sergei

    2017-09-01

    The photon strength functions (PSF), neutron capture cross sections and average radiative widths of neutron resonances for three double-magic nuclei 56Ni, 132Sn and 208Pb have been calculated within the self-consistent version of the microscopic theory. Our approach includes phonon coupling (PC) effects in addition to the standard QRPA approach. With our microscopic PSFs, calculations of radiative nuclear reaction characteristics have been performed using the EMPIRE 3.1 nuclear reaction code. Three nuclear level density (NLD) models have been used: the phenomenological so-called GSM, phenomenological Enhanced GSM (EGSM) and microscopical combinatorial HFB model. For all the considered characteristics, we found a noticeable contribution of the PC effects and a significant disagreement between the results obtained with the GSM and the other two NLD models. The results confirm the necessity of using consistent microscopic approaches for calculations of radiative nuclear characteristics in double-magic nuclei.

  8. LANDSAT supports data needs for EPA 208 planning. [water quality control and waste treatment management

    Science.gov (United States)

    1979-01-01

    Excerpts from federal legislation and regulations mandating areawide waster treatment management as a means of restoring and maintaining the integrity of the nation's water are presented along with requirements for grants to the states for water quality planning, management, and implementation. Experiences using LANDSAT to identify nonpoint sources of water pollution as well as land/use/land cover features in South Dakota, Kentucky, Georgia, New Jersey, and Texas are described. Present activities suggest that this type of remote sensing is an efficient, effective tool for areawide water quality planning. Interaction with cognizant federal, state, and local government personnel involved in EPA section 208 planning activities can guide the development of new capabilities and enhance their utility and prospect for use.

  9. Measurements of 208 Aitken Visual Binary Stars with a 280 mm Reflector

    Science.gov (United States)

    Serot, J.

    2017-07-01

    This paper presents the measurements of 208 visual binary stars discovered by R.G. Aitken and listed in the WDS catalog. These measurements were obtained between November 2016 and January 2017 with an 11" reflector telescope and an ASI 290MM CMOS-based camera. Binaries with a secondary component up to magnitude 15 and separation between 0.6 and 5 arcsec have been measured. Measurements were carried out on auto-correlograms computed on sequences of a thousand images. This approach allowed us to obtain reliable measurements for pairs with very large difference of magnitude (up to 6). A significant part of the observed pairs had not been observed in the previous decades and show significant movement compared to their last measurement. We also report the discovery of a yet unobserved component for the star A 2455 (WDS 06426+1937).

  10. Microsurgical clipping of ophthalmic artery aneurysms: surgical results and visual outcomes with 208 aneurysms.

    Science.gov (United States)

    Kamide, Tomoya; Tabani, Halima; Safaee, Michael M; Burkhardt, Jan-Karl; Lawton, Michael T

    2018-01-26

    OBJECTIVE While most paraclinoid aneurysms can be clipped with excellent results, new postoperative visual deficits are a concern. New technology, including flow diverters, has increased the popularity of endovascular therapy. However, endovascular treatment of paraclinoid aneurysms is not without procedural risks, is associated with higher rates of incomplete aneurysm occlusion and recurrence, and may not address optic nerve compression symptoms that surgical debulking can. The increasing endovascular management of paraclinoid aneurysms should be justified by comparisons to surgical benchmarks. The authors, therefore, undertook this study to define patient, visual, and aneurysm outcomes in the most common type of paraclinoid aneurysm: ophthalmic artery (OphA) aneurysms. METHODS Results from microsurgical clipping of 208 OphA aneurysms in 198 patients were retrospectively reviewed. Patient demographics, aneurysm morphology (size, calcification, etc.), clinical characteristics, and patient outcomes were recorded and analyzed. RESULTS Despite 20% of these aneurysms being large or giant in size, complete aneurysm occlusion was accomplished in 91% of 208 cases, with OphA patency preserved in 99.5%. The aneurysm recurrence rate was 3.1% and the retreatment rate was 0%. Good outcomes (modified Rankin Scale score 0-2) were observed in 96.2% of patients overall and in all 156 patients with unruptured aneurysms. New visual field defects (hemianopsia or quadrantanopsia) were observed in 8 patients (3.8%), decreased visual acuity in 5 (2.4%), and monocular blindness in 9 (4.3%). Vision improved in 9 (52.9%) of the 17 patients with preoperative visual deficits. CONCLUSIONS The most important risk associated with clipping OphA aneurysms is a new visual deficit. Meticulous microsurgical technique is necessary during anterior clinoidectomy, aneurysm dissection, and clip application to optimize visual outcomes, and aggressive medical management postoperatively might potentially

  11. 78 FR 22761 - Delegation of Functions Under Sections 404 and 406 of Public Law 112-208

    Science.gov (United States)

    2013-04-16

    ... From the Federal Register Online via the Government Publishing Office ] Vol. 78 Tuesday, No. 73 April 16, 2013 Part IV The President Memorandum of April 5, 2013--Delegation of Functions Under Sections 404 and 406 of Public Law 112-208 Presidential Determination No. 2013-07 of April 8, 2013--Presidential Determination on Eligibility of the Federa...

  12. Effects of the BET-inhibitor, RVX-208 on the HDL lipidome and glucose metabolism in individuals with prediabetes

    DEFF Research Database (Denmark)

    Siebel, Andrew L; Trinh, Si Khiang; Formosa, Melissa F

    2016-01-01

    AIMS: High-density lipoprotein (HDL) and apolipoprotein A-I (apoA-I) can modulate glucose metabolism through multiple mechanisms. This study determined the effects of a novel bromodomain and extra-terminal (BET) inhibitor (RVX-208) and putative apoA-I inducer on lipid species contained within HDL...

  13. 11Li Breakup on 208Pb at Energies Around the Coulomb Barrier

    DEFF Research Database (Denmark)

    Fernández-García, J.P.; Cubero, M.; Rodríguez-Gallardo, M.

    2013-01-01

    The inclusive breakup for the 11Li+208Pb reaction at energies around the Coulomb barrier has been measured for the first time. A sizable yield of 9Li following the 11Li dissociation has been observed, even at energies well below the Coulomb barrier. Using the first-order semiclassical perturbatio...

  14. 5 CFR 2640.301 - Waivers issued pursuant to 18 U.S.C. 208(b)(1).

    Science.gov (United States)

    2010-01-01

    ...(b)(1). 2640.301 Section 2640.301 Administrative Personnel OFFICE OF GOVERNMENT ETHICS GOVERNMENT ETHICS INTERPRETATION, EXEMPTIONS AND WAIVER GUIDANCE CONCERNING 18 U.S.C. 208 (ACTS AFFECTING A PERSONAL... understanding of the nature and identity of the disqualifying financial interest, the matters to which the...

  15. 12 CFR Appendix B to Part 208 - Capital Adequacy Guidelines for State Member Banks: Tier 1 Leverage Measure

    Science.gov (United States)

    2010-01-01

    ... Banks: Tier 1 Leverage Measure B Appendix B to Part 208 Banks and Banking FEDERAL RESERVE SYSTEM BOARD... Member Banks: Tier 1 Leverage Measure I. Overview a. The Board of Governors of the Federal Reserve System... on the maximum degree to which a state member bank can leverage its equity capital base. It is...

  16. Search for high excitation energy structures in 90Zr and 208Pb, via 20Ne inelastic scattering

    NARCIS (Netherlands)

    Fortier, S.; Gales, S.; Austin, Sam M.; Benenson, W.; Crawley, G.M.; Djalali, C.; Lee, J.H.; Plicht, J. van der; Winfield, J.S.

    1987-01-01

    The inelastic scattering of 20Ne on 90Zr and 208Pb has been studied at 500 and 600 MeV incident energies. High statistics spectra were measured at the grazing angle. For each target, spectra at the two incident energies were compared by means of cross correlation analysis. Structures were observed

  17. 12 CFR 741.208 - Mergers of federally insured credit unions: voluntary termination or conversion of insured status.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Mergers of federally insured credit unions... Insured State-Chartered Credit Unions § 741.208 Mergers of federally insured credit unions: voluntary... 708a and 708b of this chapter concerning mergers and voluntary termination or conversion of insured...

  18. Comprehensive Identification and Bread-Making Quality Evaluation of Common Wheat Somatic Variation Line AS208 on Glutenin Composition.

    Directory of Open Access Journals (Sweden)

    Huiyun Liu

    Full Text Available High molecular weight glutenin subunits (HMW-GSs are important seed storage proteins in wheat (Triticum aestivum that determine wheat dough elasticity and processing quality. Clarification of the defined effectiveness of HMW-GSs is very important to breeding efforts aimed at improving wheat quality. To date, there have no report on the expression silencing and quality effects of 1Bx20 and 1By20 at the Glu-B1 locus in wheat. A wheat somatic variation line, AS208, in which both 1Bx20 and 1By20 at Glu-B1 locus were silenced, was developed recently in our laboratory. Evaluation of agronomic traits and seed storage proteins by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE and reversed-phase high performance liquid chromatography (RP-HPLC indicated that AS208 was highly similar to its parental cultivar Lunxuan987 (LX987, with the exception that the composition and expression of HMW-GSs was altered. The 1Bx20 and 1By20 in AS208 were further identified to be missing by polymerase chain reaction (PCR and quantitative real-time RT-PCR (qRT-PCR assays. Based on the PCR results for HMW-GS genes and their promoters in AS208 compared with LX987, 1Bx20 and 1By20 were speculated to be deleted in AS208 during in vitro culture. Quality analysis of this line with Mixograph, Farinograph, and Extensograph instruments, as well as analysis of bread-making quality traits, demonstrated that the lack of the genes encoding 1Bx20 and 1By20 caused various negative effects on dough processing and bread-making quality traits, including falling number, dough stability time, mixing tolerance index, crude protein values, wet gluten content, bread size, and internal cell structure. AS208 can potentially be used in the functional dissection of other HMW-GSs as a plant material with desirable genetic background, and in biscuit making industry as a high-quality weak gluten wheat source.

  19. Comprehensive Identification and Bread-Making Quality Evaluation of Common Wheat Somatic Variation Line AS208 on Glutenin Composition

    Science.gov (United States)

    Du, Lipu; Cao, Xinyou; Zhang, Xiaoxiang; Zhou, Yang; Yan, Yueming; Ye, Xingguo

    2016-01-01

    High molecular weight glutenin subunits (HMW-GSs) are important seed storage proteins in wheat (Triticum aestivum) that determine wheat dough elasticity and processing quality. Clarification of the defined effectiveness of HMW-GSs is very important to breeding efforts aimed at improving wheat quality. To date, there have no report on the expression silencing and quality effects of 1Bx20 and 1By20 at the Glu-B1 locus in wheat. A wheat somatic variation line, AS208, in which both 1Bx20 and 1By20 at Glu-B1 locus were silenced, was developed recently in our laboratory. Evaluation of agronomic traits and seed storage proteins by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and reversed-phase high performance liquid chromatography (RP-HPLC) indicated that AS208 was highly similar to its parental cultivar Lunxuan987 (LX987), with the exception that the composition and expression of HMW-GSs was altered. The 1Bx20 and 1By20 in AS208 were further identified to be missing by polymerase chain reaction (PCR) and quantitative real-time RT-PCR (qRT-PCR) assays. Based on the PCR results for HMW-GS genes and their promoters in AS208 compared with LX987, 1Bx20 and 1By20 were speculated to be deleted in AS208 during in vitro culture. Quality analysis of this line with Mixograph, Farinograph, and Extensograph instruments, as well as analysis of bread-making quality traits, demonstrated that the lack of the genes encoding 1Bx20 and 1By20 caused various negative effects on dough processing and bread-making quality traits, including falling number, dough stability time, mixing tolerance index, crude protein values, wet gluten content, bread size, and internal cell structure. AS208 can potentially be used in the functional dissection of other HMW-GSs as a plant material with desirable genetic background, and in biscuit making industry as a high-quality weak gluten wheat source. PMID:26765256

  20. Effect of cadmium on the bioelement composition of Nostoc UAM208: Interaction with calcium

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez-Pinas, F.; Mateo, P.; Bonilla, I. [Universidad Autonoma de Madrid (Spain)

    1997-04-01

    Heavy metals may cause effects on the cyanobacterial cell including possible damage to the membranes and leakage from cells resulting in the loss or reduction of essential bioelements. There are many reports in the literature concerning morphological, biochemical and physiological changes caused by cadmium in cyanobacteria, but data on the influence of cadmium on the ion balance of the cell dealing with the interactive effect of cadmium and calcium are limited. Calcium has been found to exert a protective role against heavy metal toxicity in a variety of organisms, We previously reported that calcium is able to counteract the toxic effect of cadmium towards growth, photosynthesis, nitrogenase activity and pigment content of the cyanobacterium Nostoc UAM208. In the present study, we analyzed the content of essential ions, as affected by cadmium treatment, to search for possible mechanisms of heavy metal damage and toxicity in Nostoc. We also studied whether calcium enrichment (1.1 mM final concentration) has any influence on the heavy metal effect on those ionic contents. 13 refs., 2 figs.

  1. (Multi-nucleon transfer in the reactions 16O, 32S+208Pb

    Directory of Open Access Journals (Sweden)

    Hinde D.J.

    2011-10-01

    Full Text Available A detailed analysis of the projectile-like fragments detected at backward angles in the reactions 16O,32 S+208Pb at energies below the fusion barrier is presented. Excitation functions corresponding to nucleon transfer with ∆Z = 1 and ∆Z = 2 were extracted, indicating surprisingly large absolute probabilities at subbarrier energies. A comparison of 2p transfer probabilities with time-dependent Hartree-Fock calculations suggests strong pairing correlations between the two protons. Excitation energies in the projectile-like fragments ~15 MeV and ~25 MeV for the 16O and 32S-induced reactions, respectively, indicate the population of highly excited states in the residual nuclei. A comparison with expected optimum Q-values suggests large losses in kinetic energy of the projectile-like fragments. These highly inelastic (large excitation energies and complex (correlated few-nucleon transfer processes may be closely related to the depletion of fusion through tunnelling at sub-barrier energies.

  2. New high spin states and isomers in the {sup 208}Pb and {sup 207}Pb nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Broda, R.; Wrzesinski, J.; Pawlat, T. [and others

    1996-12-31

    The two most prominent examples of the heavy doubly closed shell (DCS) nuclei, {sup 208}Pb and {sup 132}Sn, are not accessible by conventional heavy-ion fusion processes populating high-spin states. This experimental difficulty obscured for a long time the investigation of yrast high-spin states in both DCS and neighboring nuclei and consequently restricted the study of the shell model in its most attractive regions. Recent technical development of multidetector gamma arrays opened new ways to exploit more complex nuclear processes which populate the nuclei of interest with suitable yields for gamma spectroscopy and involve population of moderately high spin states. This new possibility extended the range of accessible spin values and is a promising way to reach new yrast states. Some of these states are expected to be of high configurational purity and can be a source of important shell model parameters which possibly can be used later to check the validity of the spherical shell model description at yet higher spin and higher excitation energy. The nuclei in the closest vicinity of {sup 132}Sn are produced in spontaneous fission and states with spin values up to I=14 can be reached in fission gamma spectroscopy studies with the presently achieved sensitivity of gamma arrays. New results on yrast states in the {sup 134}Te and {sup 135}I nuclei populated in fission of the {sup 248}Cm presented at this conference illustrate such application of the resolving power offered by modern gamma techniques.

  3. Microstructure and microhardness of CLAM steel irradiated up to 20.8 dpa in STIP-V

    Energy Technology Data Exchange (ETDEWEB)

    Peng, Lei, E-mail: penglei@ustc.edu.cn [School of Nuclear Science and Technology, University of Science and Technology of China, Hefei, Anhui, 230027 (China); Ge, Hongen [School of Nuclear Science and Technology, University of Science and Technology of China, Hefei, Anhui, 230027 (China); Laboratory for Nuclear Materials, Paul Scherrer Institut, 5232, Villigen PSI (Switzerland); Dai, Yong [Laboratory for Nuclear Materials, Paul Scherrer Institut, 5232, Villigen PSI (Switzerland); Huang, Qunying [Institute of Nuclear Energy Safety Technology, Chinese Academy of Sciences, Hefei, Anhui, 230031 (China); Ye, Minyou [School of Nuclear Science and Technology, University of Science and Technology of China, Hefei, Anhui, 230027 (China)

    2016-01-15

    Specimens of China low activation martensitic (CLAM) steel were irradiated in the fifth experiment of SINQ target irradiation program (STIP-V) up to 20.8 dpa/1564 appm He. Microhardness measurements and transmission electron microscope (TEM) observations have been performed to investigate irradiation induced hardening effects. The results of CLAM steel specimens show similar trend in microhardness and microstructure changes with irradiation dose, compared to F82H/Optimax-A steels irradiated in STIP-I/II. Defects and helium bubbles were observed in all specimens, even at a very low dose of 5.4 dpa. For defects and bubbles, the mean size and number density increased with increasing irradiation dose to 13 dpa, and then the mean size increased and number density decreased with the increasing irradiation dose to 20.8 dpa.

  4. Microstructure and microhardness of CLAM steel irradiated up to 20.8 dpa in STIP-V

    Science.gov (United States)

    Peng, Lei; Ge, Hongen; Dai, Yong; Huang, Qunying; Ye, Minyou

    2016-01-01

    Specimens of China low activation martensitic (CLAM) steel were irradiated in the fifth experiment of SINQ target irradiation program (STIP-V) up to 20.8 dpa/1564 appm He. Microhardness measurements and transmission electron microscope (TEM) observations have been performed to investigate irradiation induced hardening effects. The results of CLAM steel specimens show similar trend in microhardness and microstructure changes with irradiation dose, compared to F82H/Optimax-A steels irradiated in STIP-I/II. Defects and helium bubbles were observed in all specimens, even at a very low dose of 5.4 dpa. For defects and bubbles, the mean size and number density increased with increasing irradiation dose to 13 dpa, and then the mean size increased and number density decreased with the increasing irradiation dose to 20.8 dpa.

  5. Beam losses from ultraperipheral nuclear collisions between ^{208}Pb^{82+} ions in the Large Hadron Collider and their alleviation

    Directory of Open Access Journals (Sweden)

    R. Bruce

    2009-07-01

    Full Text Available Electromagnetic interactions between colliding heavy ions at the Large Hadron Collider (LHC at CERN will give rise to localized beam losses that may quench superconducting magnets, apart from contributing significantly to the luminosity decay. To quantify their impact on the operation of the collider, we have used a three-step simulation approach, which consists of optical tracking, a Monte Carlo shower simulation, and a thermal network model of the heat flow inside a magnet. We present simulation results for the case of ^{208}Pb^{82+} ion operation in the LHC, with focus on the ALICE interaction region, and show that the expected heat load during nominal ^{208}Pb^{82+} operation is 40% above the quench level. This limits the maximum achievable luminosity. Furthermore, we discuss methods of monitoring the losses and possible ways to alleviate their effect.

  6. Search for single top production via FCNC at LEP at $\\sqrt{s}$ = 189-208 GeV

    CERN Document Server

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crawley, B; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L S; Di Ciaccio, Lucia; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, Borut P; Kerzel, U; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Meyer, W T; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L M; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, R; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, Antonio; Rames, J; Ramler, L; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Rosenberg, E I; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Veloso, F; Venus, W A; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zinchenko, A I; Zupan, M

    2004-01-01

    A search for single top production (e+e- -> t cbar) via Flavour Changing Neutral Currents (FCNC) was performed using the data taken by the DELPHI detector at LEP2. The data analysed have been accumulated at centre-of-mass energies ranging from 189 to 208 GeV. Limits at 95% confidence level were obtained on the anomalous coupling parameters kappa_gamma and kappa_Z.

  7. Reaction cross sections for 65 MeV protons on targets from {sup 9}Be to {sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Ingemarsson, A.; Nyberg, J.; Renberg, P.U.; Sundberg, O. [Uppsala Univ. (Sweden). The Svedberg Laboratory; Carlson, R.F. [Univ. of Redlands, CA (United States); Auce, A.; Johansson, R.; Tibell, G. [Uppsala Univ. (Sweden). Dept. of Radiation Sciences; Clark, B.C.; Kerr, L.K. [Ohio State Univ., Columbus, OH (United States); Hama, S. [Hiroshima Univ. of Economics (Japan)

    1999-03-01

    Reaction cross sections for 65.5 MeV protons have been measured for {sup 9}Be, {sup 12}C, {sup 16}O, {sup 28}Si, {sup 40}Ca, {sup 58}, {sup 60}Ni, {sup 112}, {sup 116}, {sup 118}, {sup 1} and {sup 208}Pb. The results are compared with optical model predictions using relativistic global potentials 14 refs, 8 figs, 4 tabs

  8. Study of shell evolution around the doubly magic $^{208}$Pb via a multinucleon transfer reaction with an unstable beam

    CERN Multimedia

    This proposal aims at the study of the neutron-rich region around the doubly-magic nucleus $^{208}$Pb populated via a multinucleon transfer reaction. An unstable $^{94}$Rb beam will be delivered by HIE-ISOLDE at 5.5 MeV$\\cdot$u onto a $^{208}$Pb 13.0 mg/cm$^{2}$ target. The $\\gamma$- rays will be recorded by the MINIBALL $\\gamma$-ray spectrometer. The aim of the experiment is twofold: \\\\ \\\\ i) firstly it will represent the proof of principle that multinucleon transfer reactions with neutron-rich unstable beams is efficient to populate neutron-rich heavy binary partners and represents a competitive method to cold fragmentation \\\\ ii) secondly we aim at populating medium- to high-spin states in $^{212;214}$Pb and $^{208;210}$Hg to elucidate the existence of the 16$^{+}$ isomer in the lead isotopes and at the same time to disentangle the puzzling case of a very low energy 3$^{-}$ state in $^{210}$Hg not described by any nuclear model. \\\\ \\\\ The experimental results will be compared with large-scale shell-model ...

  9. Radiogenic Lead with Dominant Content of 208Pb: New Coolant and Neutron Moderator for Innovative Nuclear Facilities

    Directory of Open Access Journals (Sweden)

    A. N. Shmelev

    2011-01-01

    Full Text Available As a rule materials of small atomic weight (light and heavy water, graphite, and so on are used as neutron moderators and reflectors. A new very heavy atomic weight moderator is proposed—radiogenic lead consisting mainly of isotope 208Pb. It is characterized by extremely low neutron radiative capture cross-section (0.23 mbarn for thermal neutrons, i.e., less than that for graphite and deuterium and highest albedo of thermal neutrons. It is evaluated that the use of radiogenic lead makes it possible to slow down the chain fission reaction on prompt neutrons in a fast reactor. This can increase safety of the fast reactors and reduce as well requirements pertaining to the fuel fabrication technology. Radiogenic lead with high 208Pb content as a liquid-metal coolant of fast reactors helps to achieve a favorable (negative reactivity coefficient on coolant temperature. It is noteworthy that radiogenic lead with high 208Pb content may be extracted from thorium (as well as thorium-uranium ores without isotope separation. This has been confirmed experimentally by the investigations performed at San Paulo University, Brazil.

  10. γ strength function and level density of 208Pb from forward-angle proton scattering at 295 MeV

    Science.gov (United States)

    Bassauer, S.; von Neumann-Cosel, P.; Tamii, A.

    2016-11-01

    Background: γ strength functions (GSFs) and level densities (LDs) are essential ingredients of statistical nuclear reaction theory with many applications in astrophysics, reactor design, and waste transmutation. Purpose: The aim of the present work is a test of systematic parametrizations of the GSF recommended by the RIPL-3 database for the case of 208Pb. The upward GSF and LD in 208Pb are compared to γ decay data from an Oslo-type experiment to examine the validity of the Brink-Axel (BA) hypothesis. Methods: The E 1 and M1 parts of the total GSF are determined from high-resolution forward angle inelastic proton scattering data taken at 295 MeV at the Research Center for Nuclear Physics (RCNP), Osaka, Japan. The total LD in 208Pb is derived from the 1- LD extracted with a fluctuation analysis in the energy region of the isovector giant dipole resonance. Results: The E 1 GSF is compared to parametrizations recommended by the RIPL-3 database showing systematic deficiencies of all models in the energy region around neutron threshold. The new data for the poorly known spin-flip M 1 resonance call for a substantial revision of the model suggested in RIPL-3. The total GSF derived from the present data is larger in the PDR energy region than the Oslo data but the strong fluctuations due to the low LD resulting from the double shell closure of 208Pb prevent a conclusion on a possible violation of the BA hypothesis. Using the parameters suggested by RIPL-3 for a description of the LD in 208Pb with the back-shifted Fermi gas model, remarkable agreement between the two experiments spanning a wide excitation energy range is obtained. Conclusions: Systematic parametrizations of the E 1 and M 1 GSF parts need to be reconsidered at low excitation energies. The good agreement of the LD provides an independent confirmation of the approach underlying the decomposition of GSF and LD in Oslo-type experiments.

  11. Impact of miR-208 and its Target Gene Nemo-Like Kinase on the Protective Effect of Ginsenoside Rb1 in Hypoxia/Ischemia Injuried Cardiomyocytes

    Directory of Open Access Journals (Sweden)

    Xu Yan

    2016-09-01

    Full Text Available Background/Aims: Ginsenoside Rb1 (GS-Rb1 is one of the most important active pharmacological extracts of the Traditional Chinese Medicine ginseng, with extensive evidence of its cardioprotective properties. Mir-208 has been shown to act as a biomarker of acute myocardial infarction in vivo studies including man. However the impact of miR-208 on the protective effect of GS-Rb1 in hypoxia/ischemia injured cardiomyocytes remains unclear. The current study aims to investigate the target gene of miR-208 and the impact on the protective effect of GS-Rb1 in hypoxia/ischemia (H/I injuried cardiomyocytes. Materials and Methods: Primary cultures of neonatal rat cardiomyocytes (NRCMs was subjected to the H/I conditions with or without GS-Rb1. Cell viability was calculated by MTT assay and confirmed by flow cytometry analysis. Mir-208 was then detected by qRT-PCR. Luciferase reporter assay was carried out to detect the target gene of Mir-208. Then the NRCMs were transfected with miR-208 mimics and inhibitors to evaluate the impact on cardioprotective properties of Rb1. Results: The miR-208 expression level was clearly upregulated in the H/I treated NRCMs accompanied by the percentage of the apoptotic cells which could be reversed by GS-Rb1 pretreatment. The nemo-like kinase (NLK mRNA and protein expression levels were decreased in H/I group measured by RT-PCR and western blotting. Luciferase activity assay was then carried out to identify that NLK may be a direct target of mir-208. MTT assay showed that miR-208 inhibitor slightly decreased the protective effect of Rb1 on the H/I impaired NRCMs. However, results showed no statistical difference. Conclusions: These findings proved that NLK was a direct target of mir-208 and miR-208 act indirectly during Rb1 protecting H/I impaired NRCMs and further researches were needed to explore the relationship that microRNAs and other signal pathways in the protective effect of GS-Rb1 on the hypoxia/ischemia injuries in

  12. Melt Compositional Diversities in Early Ignimbrite from the 2.08 Ma Huckleberry Ridge Eruption, Yellowstone

    Science.gov (United States)

    Swallow, E. J.; Wilson, C. J. N.; Myers, M.; Collins, K. S.

    2016-12-01

    Detailed, stratigraphically-constrained geochemical analyses can shed light on the nature of magma systems and mechanisms behind the initiation and escalation of large caldera-forming eruptions1,2. The 2.08 Ma, ˜2,500 km3 Huckleberry Ridge Tuff is the first of three caldera-forming eruptions in the Yellowstone area3, and consists of a widespread initial fall deposit3,4 followed by three ignimbrite members3: A, B and C. Myers et al.2 demonstrated the episodic and multi-vent initiation of the HRT event during eruption of the initial fall deposits, with sequential tapping of three discrete melt bodies, the last of which becomes dominant within the later fall deposits. Here, we build on their dataset to consider glass compositions in the earliest-erupted parts of the overlying ignimbrite (member A). Trace element analyses of ignimbrite shards reveals clustering of compositions and signifies a continuation of the tapping of multiple melt domains. Principal component and cluster analysis indicate at least seven clusters, separated out by crystal fractionation processes. These early flows tapped a range of melts (paralleled by whole-rock magma compositions), from highly evolved (as in the fall deposits) to hotter, less evolved material not represented in the fall deposits. Variations are greatest in Ba (10-900 ppm), Rb/Sr ratios (10-210) and degrees of LREE depletion. However there is an absence of geographical variation, with locations north and south of the subsequent caldera, and in proximal and distal regions, exhibiting similar ranges of glass composition from inferred contemporaneous flow deposition. These observations suggest complexities in the early stages of the tapping of a heterogeneous magma chamber (comprising multiple melt/magma domains), possibly accompanying the onset of caldera collapse. We also consider that external controls, such as rifting, were at least initially important as an eruption trigger2 but understanding of the mechanisms controlling the

  13. On-line Ratings of Spine Surgeons: Analysis of 208 surgeons.

    Science.gov (United States)

    Zhang, Jun; Omar, Adan; Mesfin, Addisu

    2017-11-14

    Observational study OBJECTIVE.: To evaluate the online ratings of spine surgeons and variables that may affect online ratings. Physician review websites (PRW) are rapidly growing for-profit businesses. Most Orthopaedic surgeons are rated on at least one PRW as are other surgical specialists. To date the online ratings of spine surgeons have not been evaluated. Cervical Spine Research Society (CSRS) surgeon ratings on 5 physician rating websites were performed in April 2016: 'healthgrade.com', 'vitals.com', 'ratemd.com', 'webmd.com' and 'yelp.com'. Numeric ratings from the PRWs were standardized on a scale of 0 to 100 with a higher score indicating positive ratings. Sex, practice sector (academic or private), specialty (orthopaedics or neurosurgery), geographic location, and years of practice were also collected. 209 spine surgeons were included in our study. 208 of the 209 (99.52%) were rated at least once in one of the five PRWs. Average number of ratings per surgeon was 2.96. Average rating was 80 (40 to 100). There were 4 female (1.92%) and 204 male surgeons (98.1%). There were 121 (58.2%) in academic practice and 87 (41.8%) in private practice. There were 175 (84.1%) orthopaedic surgeons and 33 (15.9%) neurosurgeons. Most of the surgeons were Caucasian 163 (78.4%) and worked in the South and Northeast 135 (64.9%). Those in academic practice had significantly higher ratings (81.6 versus 77.65; p = 0.026). Number of years in practice was significantly associated with ratings (p = 0.0003) with those in practice for 21 or more years having significantly lower ratings. In this first study evaluating the online ratings of spine surgeons, we found that 99.5% of spine surgeon had at least one rating on a PRW. The average score, 80, indicated mostly positive ratings. Being in practice for twenty years or less and being in academic practice significantly associated with higher ratings. 4.

  14. Measurement of the Neutron Radius of 208Pb Through Parity Violation in Electron Scattering

    Energy Technology Data Exchange (ETDEWEB)

    Saenboonruang, Kiadtisak [Univ. of Virginia, Charlottesville, VA (United States)

    2013-05-01

    In contrast to the nuclear charge densities, which have been accurately measured with electron scattering, the knowledge of neutron densities still lack precision. Previous model-dependent hadron experiments suggest the difference between the neutron radius, Rn, of a heavy nucleus and the proton radius, Rp, to be in the order of several percent. To accurately obtain the difference, Rn-Rp, which is essentially a neutron skin, the Jefferson Lab Lead (208Pb) Radius Experiment (PREX) measured the parity-violating electroweak asymmetry in the elastic scattering of polarized electrons from 208Pb at an energy of 1.06 GeV and a scattering angle of 5° . Since Z0 boson couples mainly to neutrons, this asymmetry provides a clean measurement of Rn with respect to Rp. PREX was conducted at the Jefferson lab experimental Hall A, from March to June 2010. The experiment collected a final data sample of 2x 107 helicity-window quadruplets. The measured parity-violating electroweak asymmetry APV = 0.656 ± 0.060 (stat) ± 0.014 (syst) ppm corresponds to a difference between the radii of the neutron and proton distributions, Rn-Rp = 0.33+0.16-0.18 fm and provides the first electroweak observation of the neutron skin as expected in a heavy, neutron-rich nucleus. The value of the neutron radius of 208Pb has important implications for models of nuclear structure and their application in atomic physics and astrophysics such as atomic parity non-conservation (PNC) and neutron stars.

  15. Study of the elastic scattering of {sup 6}He on {sup 208}Pb at energies around the Coulomb barrier

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez-Benitez, A.M. [Departamento de Fisica Aplicada, Universidad de Huelva, E-21071 Huelva (Spain); Centre de Recherches du Cyclotron, Universite Catholique de Louvain, B-1348 Louvain-la-Neuve (Belgium); Escrig, D. [Instituto de Estructura de la Materia, CSIC, E-28006 Madrid (Spain); Alvarez, M.A.G.; Andres, M.V. [Departamento de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, E-41080 Sevilla (Spain); Angulo, C. [Centre de Recherches du Cyclotron, Universite Catholique de Louvain, B-1348 Louvain-la-Neuve (Belgium); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, E-28006 Madrid (Spain); Cabrera, J. [Centre de Recherches du Cyclotron, Universite Catholique de Louvain, B-1348 Louvain-la-Neuve (Belgium); Cherubini, S. [INFN Laboratori Nazionali del Sud, I-95123 Catania (Italy); Demaret, P. [Centre de Recherches du Cyclotron, Universite Catholique de Louvain, B-1348 Louvain-la-Neuve (Belgium); Espino, J.M. [Dept. de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, E-41080 Sevilla (Spain); Figuera, P. [INFN Laboratori Nazionali del Sud, I-95123 Catania (Italy); Freer, M. [School of Physics and Astronomy, University of Birmingham, B15 2TT Birmingham (United Kingdom); Garcia-Ramos, J.E. [Departamento de Fisica Aplicada, Universidad de Huelva, E-21071 Huelva (Spain); Gomez-Camacho, J. [Dept. de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, E-41080 Sevilla (Spain); Gulino, M. [INFN Laboratori Nazionali del Sud, I-95123 Catania (Italy); Kakuee, O.R. [Van der Graaff Laboratory, Nuclear Research Centre, AEOI, PO Box 14155-1339, Tehran (Iran, Islamic Republic of); Martel, I. [Dept. de Fisica Aplicada, Universidad de Huelva, E-21071 Huelva (Spain)], E-mail: imartel@uhu.es; Metelko, C. [School of Physics and Astronomy, University of Birmingham, B15 2TT Birmingham (United Kingdom); Moro, A.M. [Dept. de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, E-41080 Sevilla (Spain)] (and others)

    2008-04-15

    The elastic scattering of {sup 6}He on {sup 208}Pb has been measured at laboratory energies of 14, 16, 18 and 22 MeV. These data were analyzed using phenomenological Woods-Saxon form factors and optical model calculations. A semiclassical polarization potential was used to study the effect of the Coulomb dipole polarizability. Evidence for long range absorption, partially arising from Coulomb dipole polarizability, is reported. The energy variation of the optical potential was found to be consistent with the dispersion relations which connect the real and imaginary parts of the potential.

  16. Toward lifetime and g factor measurements of short-lived states in the vicinity of 208Pb

    Science.gov (United States)

    Ralet, D.; Georgiev, G.; E Stuchbery, A.; Clément, E.; Lemasson, A.; Michelagnoli, C.; Rejmund, M.; Atanasova, L.; Balabanski, D. L.; Bocchi, G.; Carroll, R.; Dewald, A.; Dudouet, J.; Fornal, B.; de France, G.; Franchoo, S.; Fransen, C.; Müller-Gatermann, C.; Goasduff, A.; Gadea, A.; Jacquot, B.; John, P. R.; Kocheva, D.; Konstantinopoulos, T.; Korichi, A.; Kusoglu, A.; Lenzi, S. M.; Leoni, S.; Ljungvall, J.; Lozeva, R.; Maj, A.; Navin, A.; Perez, R.; Pietralla, N.; Shand, C.; Stezowski, O.; Yordanov, D.

    2017-05-01

    The multi-nucleon transfer reaction mechanism was used to produce and study nuclei in the vicinity of 208Pb. This mass region is a test case for the nuclear shell model. The mass identification of the fragments was performed with the large acceptance magnetic spectrometer VAMOS++ coupled to the AGATA γ-tracking array. This experiment aimed to determine both lifetimes and gyromagnetic ratios of excited states with the Cologne plunger device. The analysis indicates promising results with the possibility to determine several new lifetimes in this region.

  17. Study of the 2 n-evaporation channel in the 4,6He + 206,208Pb reactions

    Science.gov (United States)

    Lukyanov, S. M.; Penionzhkevich, Yu. E.; Astabatian, R. A.; Demekhina, N. A.; Dlouhy, Z.; Ivanov, M. P.; Kalpakchieva, R.; Kulko, A. A.; Markarian, E. R.; Maslov, V. A.; Revenko, R. V.; Skobelev, N. K.; Smirnov, V. I.; Sobolev, Yu. G.; Trazska, W.; Khlebnikov, S. V.

    2009-01-01

    Excitation functions of the reaction products were measured for the reactions induced by 4,6He projectiles on 208,206Pb targets, leading to the same compound nucleus. This was accomplished by using the stacked-foil activation technique. The identification of the reaction products (accumulated in the Pb targets) was done by their radioactive α-decays. The excitation functions for the various products were obtained at energies including the sub-Coulomb barrier region. A large value of the fusion cross section was observed in the case of the reaction induced by the weakly bound 6He projectile.

  18. Excitation of giant monopole resonance in {sup 208}Pb and {sup 116}Sn using inelastic deuteron scattering

    Energy Technology Data Exchange (ETDEWEB)

    Patel, D.; Garg, U. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Itoh, M. [Cyclotron and Radioisotope Center, Tohoku University, Sendai 980-8578 (Japan); Akimune, H. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Berg, G.P.A. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Fujiwara, M. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan); Harakeh, M.N. [Kernfysisch Versneller Instituut, University of Groningen, 9747 AA Groningen (Netherlands); GANIL, CEA/DSM-CNRS/IN2P3, 14076 Caen (France); Iwamoto, C. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Kawabata, T. [Division of Physics and Astronomy, Kyoto University, Kyoto 606-8502 (Japan); Kawase, K. [Japan Atomic Energy Agency, Kyoto 619-0215 (Japan); Matta, J.T. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Joint Institute for Nuclear Astrophysics, University of Notre Dame, Notre Dame, IN 46556 (United States); Murakami, T. [Division of Physics and Astronomy, Kyoto University, Kyoto 606-8502 (Japan); Okamoto, A. [Department of Physics, Konan University, Kobe 568-8501 (Japan); Sako, T. [Japan Atomic Energy Agency, Kyoto 619-0215 (Japan); Schlax, K.W. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Takahashi, F. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan); White, M. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States); Yosoi, M. [Research Center for Nuclear Physics, Osaka University, Osaka 567-0047 (Japan)

    2014-07-30

    The excitation of the isoscalar giant monopole resonance (ISGMR) in {sup 208}Pb and {sup 116}Sn has been investigated using small-angle (including 0°) inelastic scattering of 100 MeV/u deuteron and multipole-decomposition analysis (MDA). The extracted strength distributions agree well with those from inelastic scattering of 100 MeV/u α particles. These measurements establish deuteron inelastic scattering at E{sub d}∼100 MeV/u as a suitable probe for extraction of the ISGMR strength with MDA, making feasible the investigation of this resonance in radioactive isotopes in inverse kinematics.

  19. Down-regulation of miR-135b in colon adenocarcinoma induced by a TGF-β receptor I kinase inhibitor (SD-208

    Directory of Open Access Journals (Sweden)

    Abolfazl Akbari

    2015-09-01

    Full Text Available Objective(s:Transforming growth factor-β(TGF-β is involved in colorectal cancer (CRC. The SD-208 acts as an anti-cancer agent in different malignancies via TGF-β signaling. This work aims to show the effect of manipulation of TGF-β signaling on some miRNAs implicated in CRC. Materials and Methods: We investigated the effects of SD-208 on SW-48, a colon adenocarcinoma cell line. The cell line was treated with 0.5, 1 and 2 μM concentrations of SD-208. Then, the xenograft model of colon cancer was established by subcutaneous inoculation of SW-48 cell line into the nude mice. The animals were treated with SD-208 for three weeks. A quantitative real-time PCR was carried out for expression level analysis of selected oncogenic (miR-21, 31, 20a and 135b and suppressor-miRNAs (let7-g, miR-133b, 145 and 200c. Data were analyzed using the 2-∆∆CT method through student’s t-test via the GraphPad Prism software. Results: Our results revealed that SD-208 could significantly down-regulate the expression of one key onco-miRNA, miR-135b, in either SW-48 colon cells (P=0.006 or tumors orthotopically implanted in nude mice (P=0.018. Our in silico study also predicted that SD-208 could modulate the expression of potential downstream tumor suppressor targets of the miR135b. Conclusion: Our data provide novel evidence that anticancer effects of SD-208 (and likely other TGF-β inhibitors may be owing to their ability to regulate miRNAs expression.

  20. Freeze-Out Parameters in Central 158A GeV P{number_sign}208 b+Pb Collision80s

    Energy Technology Data Exchange (ETDEWEB)

    Aggarwal, M.M.; Bhatia, V.S. [University of Panjab, Chandigarh 160014 (India); Agnihotri, A.; Bhalla, K.B.; Gupta, S.K.; Raniwala, R.; Raniwala, S. [University of Rajasthan, Jaipur 302004, Rajasthan (India); Ahammed, Z.; Chattopadhyay, S.; Das, A.C.; Dutta Majumdar, M.R.; Ganti, M.S.; Mukhopadhyay, D.S.; Nayak, T.K.; Sinha, B.C.; Trivedi, M.D.; Viyogi, Y.P. [Variable Energy Cyclotron Centre, Calcutta 700 064 (India); Angelis, A.L.; Donni, P.; Foka, P.; Kalechofsky, H.; Martin, M.; Naef, H.; Rosselet, L.; Rubio, J.M.; Solomey, N.; Voeroes, S. [University of Geneva, CH-1211 Geneva 4 (Switzerland); Antonenko, V.; Cherbatchev, R.; Doubovik, I.; Fokin, S.; Ippolitov, M.; Karadjev, K.; Koutcheryaev, I.; Lebedev, A.; Manko, V.; Mgebrichvili, G.; Nianine, A.; Sibiriak, I.; Tsvetkov, A.; Vinogradov, A. [RRC Kurchatov Institute, RU-123182 Moscow (Russia); Arefiev, V.; Astakhov, V.; Avdeitchikov, V.; Baldine, A.; Barabach, L.; Batiounia, B.; Chalyshev, V.; Djordjadze, V.; Frolov, V.; Gavrishchuk, O.; Guskov, B.; Kosarev, I.; Kuzmin, N.; Maximov, A.; Mehdiyev, R.; Mikhalev, D.; Myalkovski, V.; Nikitine, V.; Nikolaev, S.; Nomokonov, P.; Parfenov, A.; Pavliouk, S.; Roufanov, I.; Shabratova, G.; Slavine, N.; Vodopianov, A. [Joint Institute for Nuclear Research, RU-141980 Dubna (Russia); Awes, T.C.; Kim, H.; Plasil, F.; Stankus, P.; Young, G.R. [Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831-6372 (United States); Baba, P.V.; Badyal, S.K.; Dutt, S.; Mir, M.F.; Rao, N.K.; Sambyal, S.S.; Shah, T.H. [University of Jammu, Jammu 180001 (India); Barlag, C.; Bathe, S.; Blume, C.; Bohne, E.; Boeroecz, Z.K.; Bucher, D.; Buesching, H.; Claussen, A.; Glasow, R.; Kampert, K.; Kees, S.; Kruempel, T.; Peitzmann, T.; Reygers, K.; Santo, R.; Schlagheck, H.; Stueken, D. [University of Muenster, D-48149 Muenster (Germany); Bernier, T.; Delagrange, H.; Gutbrod, H.H.; Luquin, L.; Martinez, G.; Nayak, S.K.; Pinganaud, W.; Retiere, F.; Roy, C.; Schutz, Y. and others

    1999-08-01

    Neutral pion production in central 158A GeV {sup 208}Pb+ {sup 208} Pb collisions has been studied in the WA98 experiment at the CERN Super Proton Synchrotron. The {pi}{sup 0} transverse mass spectrum has been analyzed in terms of a thermal model with hydrodynamic expansion. The high accuracy and large kinematic coverage of the measurement allow one to limit previously noted ambiguities in the extracted freeze-out parameters. The results are shown to be sensitive to the shape of the velocity distribution at freeze-out. {copyright} {ital 1999} {ital The American Physical Society }

  1. Extending and refining the mass surface around $^{208}$Pb by high-precision Penning-trap mass spectrometry with ISOLTRAP

    CERN Multimedia

    Herfurth, F; Stora, T; Blaum, K; Beck, D; Kowalska, M; Schwarz, S; Stanja, J; Herlert, A J; Yamaguchi, T

    We propose high-precision mass spectrometry of nuclides around the doubly magic $^{208}$Pb. On the neutron-rich side, we aim to extend the knowledge of Fr, At, Hg, and Au masses to study the robustness of the N = 126 shell closure and to provide mass data necessary for modeling the rapid-neutron-capture process. On the proton-rich side, we aim at high-resolution mass spectrometry of selected Au, At, and Fr isotopes to verify the predicted existence of very low-lying isomeric states. The proposal will make use of newly-available laser-ionization schemes for Au and At. Finally, the recently implemented multi-reflection time-of-flight mass separator for auxiliary isobaric purification now allows measurements which were not feasible before.

  2. Polarization correlations from electron-impact excitation of multipolarity L=3-5 in 208Pb and 89Y nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakubassa-Amundsen, Doris [Mathematics Institute, LMU Munich (Germany)

    2015-07-01

    The DWBA formalism is used to calculate differential excitation cross sections and to predict spin asymmetries for the scattering of spin-polarized electrons from heavy nuclei. Polarization correlations between the incoming and the scattered electron are a sensitive tool to study the various nuclear models inherent in the transition densities. By selecting the lowest 3- and 5- states of 208Pb it is found that the spin asymmetries for elastic and inelastic electron scattering are comparably large as long as the contribution from the current-current interaction is negligible. The investigation of the 89Y nucleus with its large magnetic transition densities shows, however, a strong quenching of the transverse polarization correlations at backward scattering angles.

  3. New chronometers for the metamorphism of ophiolitic rocks: 40Ar/39Ar neptunite and 232Th/208Pb joaquinite

    Science.gov (United States)

    Borneman, N.; Hodges, K. V.; Van Soest, M. C.

    2015-12-01

    Both primary magmatism and metamorphism of ophiolite sequences are difficult to date, due in large part to the fact that the majority of lithologies present tend to contain very low concentrations of radioactive elements. As a result, researchers are often forced to process large amounts of material to search for accessory phases like zircons in gabbro, or to employ geochronometers that often yield multiply interpretable results (e.g., 40Ar/39Ar glaucophane or phengite), or to rely on indirect evidence for inferring ages. Here, we introduce two new options for chronometery of metamorphosed ophiolites: 40Ar/39Ar neptunite and 232Th/208Pb joaquinite. The best known locality for these rare minerals is the New Idria serpentinite diapir, found within the southern Diablo Range of the Coast Range Province of California. Here, both the joaquinite and neptunite chronometers record indistinguishable dates that we interpret to be the crystallization age of the phases during diapir ascent, based on the demonstrated low temperature history of the diapir as whole and the agreement of dates from chromonometers that almost certainly have different closure temperatures. This age is generally inferred to be coincident with the timing of the passage of the Mendocino Triple Junction and associated initiation of the San Andreas fault in this area. We propose that the mean40Ar/39Ar neptunite plateau date of 12.375 ± 0.082 Ma and corroborating 232Th/208Pb joaquinite date (12.08 ± 0.59 Ma) may represent a high-precision constraint on the timing of this event. We also report a second application of these chronometers to samples from the Yarlung suture, which formed at the time of initial India-Eurasia collision in southern Tibet. Here, both chronometers record indistinguishable dates of ca. 52 Ma, which we also interpret as the crystallization age. This age is consistent with most previously published estimates for the timing of the India-Eurasia collision.

  4. Reaction cross sections for protons on {sup 12}C, {sup 40}Ca, {sup 90}Zr and {sup 208}Pb at energies between 80 and 180 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Auce, A.; Ingemarsson, A.; Johansson, R. [and others

    2005-04-01

    Results of reaction cross section measurements on {sup 12}C, {sup 40}Ca, {sup 90}Zr and {sup 208}Pb at incident proton energies between 80 and 180 MeV and for {sup 58}Ni at 81 MeV are presented. The experimental procedure is described and the results are compared with earlier measurements and predictions using macroscopic and microscopic models.

  5. EXCITATION OF GIANT-RESONANCES IN PB-208, SN-120, ZR-90 AND NI-60 BY 84 MEV/NUCLEON O-17 IONS

    NARCIS (Netherlands)

    NETO, RL; ROUSSELCHOMAZ, P; ROCHAIS, L; ALAMANOS, N; AUGER, F; GASTEBOIS, J; GILLIBERT, A; LACEY, R; MICZAIKA, A; PIERROUTSAKOU, D; BARRETTE, J; MARK, SK; TURCOTTE, R; BLUMENFELD, Y; FRASCARIA, N; GARRON, JP; ROYNETTE, JC; SCARPACI, JA; SUOMIJARVI, T; VANDERWOUDE, A; VANDENBERG, AM

    1993-01-01

    Elastic and inelastic scattering of 1435 MeV 170 ions on Pb-208, Sn-120, Zr-90 and Ni-60 have been measured. Hindrance in the excitation of the first 3- states is observed. Parameters of the isoscalar giant monopole and quadrupole resonances are obtained. The quadrupole resonance exhausts

  6. Isoscalar giant dipole resonance in Zr-90, Sn-116, Sm-144 and Pb-208 excited by 240 MeV alpha particle scattering

    NARCIS (Netherlands)

    Clark, HL; Lui, YW; Youngblood, DH; Bachtr, K; Garg, U; Harakeh, MN; Kalantar-Nayestanaki, N

    1999-01-01

    The giant resonance regions of Zr-90, Sn-116, Sm-144 and (208)pb were investigated using 240 MeV a particle scattering at small angles including 0 degrees. E1 strengths corresponding to 91+/-11%, 89+/-10%, 105+/-12% and 95+/-13% of the isoscalar E1 energy-weighted sum rule were identified between 18

  7. VECTOR AND TENSOR ANALYZING POWERS IN THE PB-208(D)OVER-RIGHT-ARROW,T)PB-207 REACTION AT 200 AND 360 MEV

    NARCIS (Netherlands)

    VANDEWIELE, J; LANGEVINJOLIOT, H; GUILLOT, J; ROSIER, LH; WILLIS, A; MORLET, M; DUHAMELCHRETIEN, G; GERLIC, E; TOMASIGUSTAFSSON, E; BLASI, N; MICHELETTI, S; VANDERWERF, SY

    1992-01-01

    Cross sections and vector and tensor analyzing powers for the main levels in Pb-207 have been measured via the Pb-208(d over arrow pointing right, t)Pb-207 reaction at 200 and 360 MeV incident energies. A(y) and A(yy) spin observables allow a clear identification of the valence levels, especially at

  8. Survival time of dogs with splenic hemangiosarcoma treated by splenectomy with or without adjuvant chemotherapy: 208 cases (2001-2012).

    Science.gov (United States)

    Wendelburg, Kristin M; Price, Lori Lyn; Burgess, Kristine E; Lyons, Jeremiah A; Lew, Felicia H; Berg, John

    2015-08-15

    To determine survival time for dogs with splenic hemangiosarcoma treated with splenectomy alone, identify potential prognostic factors, and evaluate the efficacy of adjuvant chemotherapy. Retrospective case series. 208 dogs. Medical records were reviewed, long-term follow-up information was obtained, and survival data were analyzed statistically. 154 dogs were treated with surgery alone, and 54 were treated with surgery and chemotherapy. Twenty-eight dogs received conventional chemotherapy, 13 received cyclophosphamide-based metronomic chemotherapy, and 13 received both conventional and metronomic chemotherapy. Median survival time of dogs treated with splenectomy alone was 1.6 months. Clinical stage was the only prognostic factor significantly associated with survival time. When the entire follow-up period was considered, there was no significant difference in survival time between dogs treated with surgery alone and dogs treated with surgery and chemotherapy. However, during the first 4 months of follow-up, after adjusting for the effects of clinical stage, survival time was significantly prolonged among dogs receiving any type of chemotherapy (hazard ratio, 0.6) and among dogs receiving both conventional and metronomic chemotherapy (hazard ratio, 0.4). Clinical stage was strongly associated with prognosis for dogs with splenic hemangiosarcoma. Chemotherapy was effective in prolonging survival time during the early portion of the follow-up period. Combinations of doxorubicin-based conventional protocols and cyclophosphamide-based metronomic protocols appeared to be more effective than either type of chemotherapy alone, but prolongations in survival time resulting from current protocols were modest.

  9. A measurement of (n,xn{gamma}) cross sections for {sup 208}Pb from threshold up to 20 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Mihailescu, L.C.; Borcea, C. [European Commission, Joint Research Center, Institute for Reference Materials and Measurements, B-2440 Geel (Belgium); ' Horia Hulubei' National Institute for Physics and Nuclear Engineering, PO Box MG-6, 76900 Bucharest (Romania); Baumann, P.; Dessagne, Ph. [Institut Pluridisciplinaire Hubert Curien, 23 rue du Loess, BP28, 67037 Strasbourg (France); Jericha, E. [Atominstitut, Vienna University of Technology, Stadionallee 2, A-1020 Wien (Austria); Karam, H.; Kerveno, M. [Institut Pluridisciplinaire Hubert Curien, 23 rue du Loess, BP28, 67037 Strasbourg (France); Koning, A.J. [Nuclear Research Group Petten, Westerduinweg 3, 1755 ZG Petten (Netherlands); Leveque, N. [European Commission, Joint Research Center, Institute for Reference Materials and Measurements, B-2440 Geel (Belgium); Pavlik, A. [Faculty of Physics, University of Vienna, Waehringer Strasse 17, A-1090 Wien (Austria); Plompen, A.J.M. [European Commission, Joint Research Center, Institute for Reference Materials and Measurements, B-2440 Geel (Belgium)], E-mail: arjan.plompen@ec.europa.eu; Quetel, C. [European Commission, Joint Research Center, Institute for Reference Materials and Measurements, B-2440 Geel (Belgium); Rudolf, G. [Institut Pluridisciplinaire Hubert Curien, 23 rue du Loess, BP28, 67037 Strasbourg (France); Tresl, I. [European Commission, Joint Research Center, Institute for Reference Materials and Measurements, B-2440 Geel (Belgium)

    2008-10-01

    Gamma production cross sections for neutron inelastic scattering, (n,2n{gamma}) and (n,3n{gamma}) reactions on {sup 208}Pb were measured at the Geel Electron Linear Accelerator (GELINA) from the respective thresholds up to at most 20 MeV. An unprecedented neutron energy resolution of 1.1 keV at 1 MeV (35 keV at 10 MeV) and a total uncertainty of about 5% was achieved for the integral gamma production cross section of the most intense transition in {sup 208}Pb. The gamma production cross section was measured for 29 transitions of the inelastic channel, 5 transitions of the (n,2n{gamma}) channel and one transition of the (n,3n{gamma}) channel. Based on the evaluated level scheme of {sup 208}Pb, the total neutron inelastic scattering cross section and the level cross sections were deduced. Four large volume HPGe (high purity germanium) detectors were used for the detection of the {gamma}-rays. The 88.11% enriched {sup 208}Pb sample was placed at a flight path length of 198.551 m. The cross sections were measured relative to the {sup 235}U(n,f) standard cross section by continuously monitoring the neutron flux with a fission chamber containing {sup 235}U. The results are compared with the existing experimental data from the literature and with model estimates obtained with the recent TALYS 1.00 code. A good agreement of the present data is found with both the existing experimental data and with the calculations. The present work greatly expands the number of measured gamma production cross sections and the level cross sections derived for this nucleus.

  10. Complete genome sequence of Acinetobacter baumannii XH386 (ST208, a multi-drug resistant bacteria isolated from pediatric hospital in China

    Directory of Open Access Journals (Sweden)

    Youhong Fang

    2016-03-01

    Full Text Available Acinetobacter baumannii is an important bacterium that emerged as a significant nosocomial pathogen worldwide. The rise of A. baumannii was due to its multi-drug resistance (MDR, while it was difficult to treat multi-drug resistant A. baumannii with antibiotics, especially in pediatric patients for the therapeutic options with antibiotics were quite limited in pediatric patients. A. baumannii ST208 was identified as predominant sequence type of carbapenem resistant A. baumannii in the United States and China. As we knew, there was no complete genome sequence reproted for A. baumannii ST208, although several whole genome shotgun sequences had been reported. Here, we sequenced the 4087-kilobase (kb chromosome and 112-kb plasmid of A. baumannii XH386 (ST208, which was isolated from a pediatric hospital in China. The genome of A. baumannii XH386 contained 3968 protein-coding genes and 94 RNA-only encoding genes. Genomic analysis and Minimum inhibitory concentration assay showed that A. baumannii XH386 was multi-drug resistant strain, which showed resistance to most of antibiotics, except for tigecycline. The data may be accessed via the GenBank accession number CP010779 and CP010780.

  11. Complete genome sequence of Acinetobacter baumannii XH386 (ST208), a multi-drug resistant bacteria isolated from pediatric hospital in China.

    Science.gov (United States)

    Fang, Youhong; Quan, Jingjing; Hua, Xiaoting; Feng, Ye; Li, Xi; Wang, Jianfeng; Ruan, Zhi; Shang, Shiqiang; Yu, Yunsong

    2016-03-01

    Acinetobacter baumannii is an important bacterium that emerged as a significant nosocomial pathogen worldwide. The rise of A. baumannii was due to its multi-drug resistance (MDR), while it was difficult to treat multi-drug resistant A. baumannii with antibiotics, especially in pediatric patients for the therapeutic options with antibiotics were quite limited in pediatric patients. A. baumannii ST208 was identified as predominant sequence type of carbapenem resistant A. baumannii in the United States and China. As we knew, there was no complete genome sequence reproted for A. baumannii ST208, although several whole genome shotgun sequences had been reported. Here, we sequenced the 4087-kilobase (kb) chromosome and 112-kb plasmid of A. baumannii XH386 (ST208), which was isolated from a pediatric hospital in China. The genome of A. baumannii XH386 contained 3968 protein-coding genes and 94 RNA-only encoding genes. Genomic analysis and Minimum inhibitory concentration assay showed that A. baumannii XH386 was multi-drug resistant strain, which showed resistance to most of antibiotics, except for tigecycline. The data may be accessed via the GenBank accession number CP010779 and CP010780.

  12. Peripheral T-cell lymphomas: analysis of histology, staging and response to treatment of 208 cases at a single institution.

    Science.gov (United States)

    Broussais-Guillaumot, Florence; Coso, Diane; Belmecheri, Nawel; Ivanov, Vadim; Schiano de Collela, Jean-Marc; Aurran-Schleinitz, Thérèse; Stoppa, Anne-Marie; Chetaille, Bruno; Xerri, Luc; Esterni, Benjamin; Blaise, Didier; Bouabdallah, Reda

    2013-11-01

    Peripheral T-cell lymphomas are characterized by a poor clinical outcome. We retrospectively analyzed 208 adults treated in our institution between 2000 and 2011. Median age at diagnosis was 55 years. Fifty-one percent had B symptoms and 51% serum elevated lactate dehydrogenase (LDH) levels. Eastern Cooperative Oncology Group (ECOG) performance status (PS) was 0-1 in 63% and 2-4 in 37%. According to Ann Arbor classification, 16% were at stage I-II and 84% at stage III-IV. Histological subtypes were: 39% peripheral T-cell non-Hodgkin lymphoma (NHL) unspecified (PTCL-U), 19.5% anaplastic large cell lymphoma (ALCL), with 9.5% ALK+ and 10% ALK-, and 25% angioimmunoblastic lymphoma (AILT). Primary extranodal lymphoma represented 17%, and 8% were diagnosed with hemophagocytosis. Induction chemotherapy was CHOP (cyclophosphamide, doxorubicin, vincristine, prednisone) in 87% of patients. The median number of chemotherapy cycles was 2 (1-7). A complete response was obtained in 57% of the patients. Among them, 32% had an autologous stem cell transplant (ASCT) and 10% allogeneic SCT, while 38% were primary refractory. Five-year overall survival (OS) was 28.5% (22.3-36.3), and 5-year event-free survival (EFS) was 18.4% (13.4-25.3). A multivariate analysis showed that ALCL-ALK+ (p = 0.004), AILT (p 1 (p = 0.04), LDH < normal (p = 0.003) and hemophagocytosis (p = 0.001) were independent adverse factors for OS. We conclude that conventional chemotherapy with intensive treatment is not sufficient to improve the response rate. Optimal management is required.

  13. In vitro biosynthesis, isolation, and identification of predominant metabolites of 2-(4-(2-hydroxyethoxy)-3,5-dimethylphenyl)-5,7-dimethoxyquinazolin-4(3H)-one (RVX-208).

    Science.gov (United States)

    Khmelnitsky, Yuri L; Mozhaev, Vadim V; Cotterill, Ian C; Michels, Peter C; Boudjabi, Sihem; Khlebnikov, Vladimir; Madhava Reddy, M; Wagner, Gregory S; Hansen, Henrik C

    2013-06-01

    The structures of the two predominant metabolites (M4 and M5) of RVX-208, observed both in in vitro human and animal liver microsomal incubations, as well as in plasma from animal in vivo studies, were determined. A panel of biocatalytic systems was tested to identify biocatalysts suitable for milligram scale production of metabolite M4 from RVX-208. Rabbit liver S9 fraction was selected as the most suitable system, primarily based on pragmatic metrics such as catalyst cost and estimated yield of M4 (∼55%). Glucuronidation of RVX-208 catalyzed by rabbit liver S9 fraction was optimized to produce M4 in amounts sufficient for structural characterization. Structural studies using LC/MS/MS analysis and (1)H NMR spectroscopy showed the formation of a glycosidic bond between the primary hydroxyl group of RVX-208 and glucuronic acid. NMR results suggested that the glycosidic bond has the β-anomeric configuration. A synthetic sample of M4 confirmed the proposed structure. Metabolite M5, hypothesized to be the carboxylate of RVX-208, was prepared using human liver microsomes, purified by HPLC, and characterized by LC/MS/MS and (1)H NMR. The structure was confirmed by comparison to a synthetic sample. Both samples confirmed M5 as a product of oxidation of primary hydroxyl group of RVX-208 to carboxylic acid. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  14. Image-guided neurosurgery comparing a pointer device system with a navigating microscope: a retrospective analysis of 208 cases.

    Science.gov (United States)

    Roessler, K; Ungersboeck, K; Aichholzer, M; Dietrich, W; Czech, T; Heimberger, K; Matula, C; Koos, W T

    1998-06-01

    A retrospective analysis of neuronavigation procedures performed at the Vienna Neurosurgical Clinic was undertaken to elucidate the advantages of 2 technically different navigation systems in clinical use. In a 30-month period, 208 frameless stereotactic procedures were performed using a stereotactic microscope (MKM System, Zeiss; 92 procedures in 87 patients; 47 female, 40 male; mean age, 46 yrs) and a light emitting diode (LED) based pointer navigation device (Easy Guide Neuro (EGN), Philips; 116 procedures in 114 patients; 63 female, 51 male; mean age 46.4 yrs). The navigating microscope was exclusively used for cranial navigation, the pointer device system in 107 cases for cranial and in 9 cases for spinal navigation. Procedures were CCT-guided in 109 cases, MRI-guided in 95, and both CT/MRI guided in 4 cases. Skin fiducials were used in all these procedures. The MKM system provided coordinate-based navigation, similar to frame systems. This allowed surgical planning and performance using stereotactic coordinates for target calculation. Additionally, tumor volumes were defined by contours and projected into the ocular of the microscope, allowing guidance during targeting and resection of lesions. Both of these features proved beneficial in tumor surgery (60.8% MKM cases), cavernoma surgery (21.8% MKM cases), and epilepsy surgery (14.1% MKM cases). In contrast to the microscope, the pointer navigation system could be employed for intuitive correlation of image points with points of interest in the operating field by using a LED-equipped pointer device. This permitted image guidance during a wide spectrum of neurosurgical procedures, in tumor surgery (68.1% EGN cases), cavernoma surgery (5.1% EGN cases), epilepsy surgery (14.1% EGN cases), vascular surgery (3.4% EGN cases), spinal surgery (7.8% EGN cases), and guidance for burr holes and drainages (6.9% EGN cases), without calculating stereotactic coordinates. This analysis showed clear differences in the

  15. Alanine analogues of [D-Trp]CJ-15,208: novel opioid activity profiles and prevention of drug- and stress-induced reinstatement of cocaine-seeking behaviour.

    Science.gov (United States)

    Aldrich, J V; Senadheera, S N; Ross, N C; Reilley, K A; Ganno, M L; Eans, S E; Murray, T F; McLaughlin, J P

    2014-07-01

    The novel macrocyclic peptide cyclo[Phe-D-Pro-Phe-D-Trp] ([D-Trp]CJ-15,208) exhibits κ opioid (KOP) receptor antagonist activity in both in vitro and in vivo assays. The four alanine analogues of this peptide were synthesized and characterized both in vitro and in vivo to assess the contribution of different amino acid residues to the activity of [D-Trp]CJ-15,208. The peptides were synthesized by a combination of solid phase peptide synthesis and cyclization in solution. The analogues were evaluated in vitro in receptor binding and functional assays, and in vivo with mice using a tail-withdrawal assay for antinociceptive and opioid antagonist activity. Mice demonstrating extinction of cocaine conditioned-place preference (CPP) were pretreated with selected analogues to evaluate prevention of stress or cocaine-induced reinstatement of CPP. The alanine analogues displayed pharmacological profiles in vivo distinctly different from [D-Trp]CJ-15,208. While the analogues exhibited varying opioid receptor affinities and κ and μ opioid receptor antagonist activity in vitro, they produced potent opioid receptor-mediated antinociception (ED50 = 0.28-4.19 nmol, i.c.v.) in vivo. Three of the analogues also displayed KOP receptor antagonist activity in vivo. Pretreatment with an analogue exhibiting both KOP receptor agonist and antagonist activity in vivo prevented both cocaine- and stress-induced reinstatement of cocaine-seeking behaviour in the CPP assay in a time-dependent manner. These unusual macrocyclic peptides exhibit in vivo opioid activity profiles different from the parent compound and represent novel compounds for potential development as therapeutics for drug abuse and possibly as analgesics. © 2014 The British Pharmacological Society.

  16. Search for supersymmetric particles assuming R-parity non-conservation in $e^+e^-$ collisions at $\\sqrt{s}$ = 192 to 208 GeV

    CERN Document Server

    Abdallah, J.; Adam, W.; Adzic, P.; Albrecht, T.; Alderweireld, T.; Alemany-Fernandez, R.; Allmendinger, T.; Allport, P.P.; Amaldi, U.; Amapane, N.; Amato, S.; Anashkin, E.; Andreazza, A.; Andringa, S.; Anjos, N.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Ask, S.; Asman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barbier, R.; Bardin, D.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Behrmann, A.; Ben-Haim, E.; Benekos, N.; Benvenuti, A.; Berat, C.; Berggren, M.; Berntzon, L.; Bertrand, D.; Besancon, M.; Besson, N.; Bloch, D.; Blom, M.; Bluj, M.; Bonesini, M.; Boonekamp, M.; Booth, P.S.L.; Borisov, G.; Botner, O.; Bouquet, B.; Bowcock, T.J.V.; Boyko, I.; Bracko, M.; Brenner, R.; Brodet, E.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buschmann, P.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Castro, Nuno Filipe; Cavallo, F.; Chapkin, M.; Charpentier, Ph.; Checchia, P.; Chierici, R.; Chliapnikov, P.; Chudoba, J.; Chung, S.U.; Cieslik, K.; Collins, P.; Contri, R.; Cosme, G.; Cossutti, F.; Costa, M.J.; Crennell, D.; Cuevas, J.; D'Hondt, J.; Dalmau, J.; da Silva, T.; Da Silva, W.; Della Ricca, G.; De Angelis, A.; De Boer, W.; De Clercq, C.; De Lotto, B.; De Maria, N.; De Min, A.; de Paula, L.; Di Ciaccio, L.; Di Simone, A.; Doroba, K.; Drees, J.; Dris, M.; Eigen, G.; Ekelof, T.; Ellert, M.; Elsing, M.; Espirito Santo, M.C.; Fanourakis, G.; Fassouliotis, D.; Feindt, M.; Fernandez, J.; Ferrer, A.; Ferro, F.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fulda-Quenzer, F.; Fuster, J.; Gandelman, M.; Garcia, C.; Gavillet, Ph.; Gazis, Evangelos; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Graziani, E.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hallgren, A.; Hamacher, K.; Hamilton, K.; Haug, S.; Hauler, F.; Hedberg, V.; Hennecke, M.; Herr, H.; Hoffman, J.; Holmgren, S.O.; Holt, P.J.; Houlden, M.A.; Hultqvist, K.; Jackson, John Neil; Jarlskog, G.; Jarry, P.; Jeans, D.; Johansson, Erik Karl; Johansson, P.D.; Jonsson, P.; Joram, C.; Jungermann, L.; Kapusta, Frederic; Katsanevas, S.; Katsoufis, E.; Kernel, G.; Kersevan, B.P.; Kerzel, U.; Kiiskinen, A.; King, B.T.; Kjaer, N.J.; Kluit, P.; Kokkinias, P.; Kourkoumelis, C.; Kouznetsov, O.; Krumstein, Z.; Kucharczyk, M.; Lamsa, J.; Leder, G.; Ledroit, Fabienne; Leinonen, L.; Leitner, R.; Lemonne, J.; Lepeltier, V.; Lesiak, T.; Liebig, W.; Liko, D.; Lipniacka, A.; Lopes, J.H.; Lopez, J.M.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Malek, A.; Maltezos, S.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Mazzucato, F.; Mazzucato, M.; McNulty, R.; Meroni, C.; Migliore, E.; Mitaroff, W.; Mjoernmark, U.; Moa, T.; Moch, M.; Monig, Klaus; Monge, R.; Montenegro, J.; Moraes, D.; Moreno, S.; Morettini, P.; Mueller, U.; Muenich, K.; Mulders, M.; Mundim, L.; Murray, W.; Muryn, B.; Myatt, G.; Myklebust, T.; Nassiakou, M.; Navarria, F.; Nawrocki, K.; Nicolaidou, R.; Nikolenko, M.; Oblakowska-Mucha, A.; Obraztsov, V.; Olshevski, A.; Onofre, A.; Orava, R.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Palacios, J.P.; Palka, H.; Papadopoulou, Th.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Peralta, L.; Perepelitsa, V.; Perrotta, A.; Petrolini, A.; Piedra, J.; Pieri, L.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Poireau, V.; Pol, M.E.; Polok, G.; Pozdniakov, V.; Pukhaeva, N.; Pullia, A.; Rames, J.; Read, Alexander L.; Rebecchi, P.; Rehn, J.; Reid, D.; Reinhardt, R.; Renton, P.; Richard, F.; Ridky, J.; Rivero, M.; Rodriguez, D.; Romero, A.; Ronchese, P.; Roudeau, P.; Rovelli, T.; Ruhlmann-Kleider, V.; Ryabtchikov, D.; Sadovsky, A.; Salmi, L.; Salt, J.; Sander, C.; Savoy-Navarro, A.; Schwickerath, U.; Segar, A.; Sekulin, R.; Siebel, M.; Sisakian, A.; Smadja, G.; Smirnova, O.; Sokolov, A.; Sopczak, A.; Sosnowski, R.; Spassov, T.; Stanitzki, M.; Stocchi, A.; Strauss, J.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Szumlak, T.; Tabarelli, T.; Taffard, A.C.; Tegenfeldt, F.; Timmermans, Jan; Tkatchev, L.; Tobin, M.; Todorovova, S.; Tome, B.; Tonazzo, A.; Tortosa, P.; Travnicek, P.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Turluer, M.L.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Uvarov, V.; Valenti, G.; Van Dam, Piet; Van Eldik, J.; Van Lysebetten, A.; van Remortel, N.; Van Vulpen, I.; Vegni, G.; Veloso, F.; Venus, W.; Verdier, P.; Verzi, V.; Vilanova, D.; Vitale, L.; Vrba, V.; Wahlen, H.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.; Wilkinson, G.; Winter, M.; Witek, M.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zhuravlov, V.; Zimine, N.I.; Zintchenko, A.; Zupan, M.

    2004-01-01

    Searches for pair-production of supersymmetric particles under the assumption of non-conservation of R-parity with a dominant LLEbar or UbarDbarDbar term have been performed using the data collected by the DELPHI experiment at LEP in e+e- collisions at centre-of-mass energies from 192 up to 208 GeV. No excess of data above Standard Model expectations was observed. The results were used to constrain the MSSM parameter space and to derive limits on the masses of supersymmetric particles.

  17. The cross sections and energy spectra of the particle emission in proton induced reaction on 204,206,207,208Pb and 209Bi

    Directory of Open Access Journals (Sweden)

    Zhang Zhengjun

    2017-01-01

    Full Text Available All cross sections of proton induced reactions, angular distributions, energy spectra and double differential cross sections of neutron, proton, deuteron, triton, helium and alpha-particle emissions for p+ 204,206,207,208Pb, 209Bi reactions are consistently calculated and analyzed at incident proton energies below 200 MeV. The optical model, the distorted wave Born approximation theory, the unified Hauser-Feshbach and exciton model which includes the improved Iwamoto-Harada model are used. Theoretically calculated results are compared with the existing experimental data.

  18. Draft Genome Sequence of Four Coccolithoviruses: Emiliania huxleyi Virus EhV-88, EhV-201, EhV-207, and EhV-208

    OpenAIRE

    Nissimov, Jozef I.; Worthy, Charlotte A.; Rooks, Paul; Napier, Johnathan A.; Kimmance, Susan A.; Henn, Matthew R.; Ogata, Hiroyuki; Allen, Michael J.

    2012-01-01

    The Coccolithoviridae are a group of viruses which infect the marine coccolithophorid microalga Emiliania huxleyi. The Emiliania huxleyi viruses (known as EhVs) described herein have 160- to 180-nm diameter icosahedral structures, have genomes of approximately 400 kbp, and consist of more than 450 predicted coding sequences (CDSs). Here, we describe the genomic features of four newly sequenced coccolithoviruses (EhV-88, EhV-201, EhV-207, and EhV-208) together with their draft genome sequences...

  19. Draft genome sequence of four coccolithoviruses: Emiliania huxleyi virus EhV-88, EhV-201, EhV-207, and EhV-208.

    Science.gov (United States)

    Nissimov, Jozef I; Worthy, Charlotte A; Rooks, Paul; Napier, Johnathan A; Kimmance, Susan A; Henn, Matthew R; Ogata, Hiroyuki; Allen, Michael J

    2012-03-01

    The Coccolithoviridae are a group of viruses which infect the marine coccolithophorid microalga Emiliania huxleyi. The Emiliania huxleyi viruses (known as EhVs) described herein have 160- to 180-nm diameter icosahedral structures, have genomes of approximately 400 kbp, and consist of more than 450 predicted coding sequences (CDSs). Here, we describe the genomic features of four newly sequenced coccolithoviruses (EhV-88, EhV-201, EhV-207, and EhV-208) together with their draft genome sequences and their annotations, highlighting the homology and heterogeneity of these genomes to the EhV-86 model reference genome.

  20. Completion Report for Wells ER-20-8 and ER-20-8#2 Corrective Action Units 101 and 102: Central and Western Pahute Mesa

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Management

    2011-02-28

    Wells ER-20-8 and ER-20-8#2 were drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of the Nevada Environmental Restoration Project at the Nevada National Security Site (formerly Nevada Test Site), Nye County, Nevada. The holes were drilled in July and August 2009, as part of the Pahute Mesa Phase II drilling program. The primary purpose of these wells was to provide detailed hydrogeologic information in the Tertiary volcanic section that will help address uncertainties within the Pahute Mesa–Oasis Valley hydrostratigraphic framework model. They may also be used as long-term monitoring wells.

  1. {alpha}-particle production in the scattering of {sup 6}He by {sup 208}Pb at energies around the Coulomb barrier

    Energy Technology Data Exchange (ETDEWEB)

    Escrig, D. [Instituto de Estructura de la Materia, CSIC, E-28006 Madrid (Spain); Sanchez-Benitez, A.M. [Departamento de Fisica Aplicada, Universidad de Huelva, E-21071 Huelva (Spain); Institut de Physique Nucleaire and Centre de Recherches du Cyclotron, Universite catholique de Louvain, B-1348 Louvain-la-Neuve (Belgium); Moro, A.M. [Departamento de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, Apdo. 1065, E-41080 Sevilla (Spain)]. E-mail: moro@us.es (and others)

    2007-08-01

    New experimental data from the scattering of {sup 6}He + {sup 208}Pb at energies around and below the Coulomb barrier are presented. The yield of breakup products coming from projectile fragmentation is dominated by a strong group of {alpha} particles. The energy and angular distribution of this group have been analyzed and compared with theoretical calculations. This analysis indicates that the {alpha} particles emitted at backward angles in this reaction are mainly due to two-neutron transfer to weakly bound states of the final nucleus.

  2. The sup 3 He-scattering potential from a model-unrestricted analysis of sup 3 He+ sup 208 Pb and its interpretation in the folding model

    Energy Technology Data Exchange (ETDEWEB)

    Heberle, N.; Clement, H.; Ermer, M.; Grabmayr, P. (Tuebingen Univ. (Germany, F.R.). Physikalisches Inst.); Hammans, M.; Henneck, R.; Sick, I. (Basel Univ. (Switzerland). Inst. fuer Physik)

    1990-11-01

    The elastic scattering of {sup 3}He from {sup 208}Pb has been measured at 49 MeV and 130 MeV over a large angular range covering both diffractive and refractive regions. The model-unrestricted Fourier-Bessel analysis of the 130 MeV data results in a unique solution for the underlying scattering potential. Its real central part fits very well into the systematics observed in nucleon, deuteron and alpha scattering and agrees with double folding calculations confirming the weak density-dependence of the nucleon-nucleon interaction found recently. (orig.).

  3. Excitation functions of product nuclei from 40 to 2600 MeV proton-irradiated {sup 206,207,208,nat}Pb and {sup 209}Bi

    Energy Technology Data Exchange (ETDEWEB)

    Titarenko, Yury E. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation)]. E-mail: yury.titarenko@itep.ru; Batyaev, Viacheslav F. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation); Mulambetov, Ruslan D. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation); Zhivun, Valery M. [Institute for Theoretical and Experimental Physcis, 117218 Moscow (Russian Federation); Barashenkov, Vladilen S. [Joint Institute for Nuclear Research, 141980 Dubna (Russian Federation); Mashnik, Stepan G. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Shubin, Yury N. [Institute for Physics and Power Engineering, 249020 Obninsk (Russian Federation); Ignatyuk, Anatoly V. [Institute for Physics and Power Engineering, 249020 Obninsk (Russian Federation)

    2006-06-23

    5972 nuclide yields from proton-irradiated {sup 206,207,208,nat}Pb and {sup 209}Bi thin targets have been measured for 11 proton energies within the range 0.04-2.6 GeV. The measured data have been compared with data obtained at other laboratories as well as with theoretical simulations by seven codes. We found that the predictive power of the tested codes is different but is satisfactory for most of the nuclides in the spallation region, though none of the codes agree well with the data in the whole mass region of product nuclides and all should be improved further.

  4. Searches for supersymmetric particles in $e^{+} e^{-}$ collisions up to 208 GeV and interpretation of the results within the MSSM

    CERN Document Server

    Abdallah, J.; Adam, W.; Adzic, P.; Albrecht, T.; Alderweireld, T.; Alemany-Fernandez, R.; Allmendinger, T.; Allport, P.P.; Amaldi, U.; Amapane, N.; Amato, S.; Anashkin, E.; Andreazza, A.; Andringa, S.; Anjos, N.; Antilogus, P.; Apel, W.D.; Arnoud, Y.; Ask, S.; Asman, B.; Augustin, J.E.; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barbier, R.; Bardin, D.; Barker, G.J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.H.; Begalli, M.; Behrmann, A.; Ben-Haim, E.; Benekos, N.; Benvenuti, A.; Berat, C.; Berggren, M.; Berntzon, L.; Bertrand, D.; Besancon, M.; Besson, N.; Bloch, D.; Blom, M.; Bluj, M.; Bonesini, M.; Boonekamp, M.; Booth, P.S.L.; Borisov, G.; Botner, O.; Bouquet, B.; Bowcock, T.J.V.; Boyko, I.; Bracko, M.; Brenner, R.; Brodet, E.; Bruckman, P.; Brunet, J.M.; Bugge, L.; Buschmann, P.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Castro, Nuno Filipe; Cavallo, F.; Chapkin, M.; Charpentier, P.; Checchia, P.; Chierici, R.; Chliapnikov, P.; Chudoba, J.; Chung, S.U.; Cieslik, K.; Collins, P.; Contri, R.; Cosme, G.; Cossutti, F.; Costa, M.J.; Crawley, B.; Crennell, D.; Cuevas, J.; D'Hondt, J.; Dalmau, J.; da Silva, T.; Da Silva, W.; Della Ricca, G.; De Angelis, A.; De Boer, W.; De Clercq, C.; De Lotto, B.; De Maria, N.; De Min, A.; de Paula, L.; Di Ciaccio, L.; Di Simone, A.; Doroba, K.; Drees, J.; Dris, M.; Eigen, G.; Ekelof, T.; Ellert, M.; Elsing, M.; Espirito Santo, M.C.; Fanourakis, G.; Fassouliotis, D.; Feindt, M.; Fernandez, J.; Ferrer, A.; Ferro, F.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fulda-Quenzer, F.; Fuster, J.; Gandelman, M.; Garcia, C.; Gavillet, P.; Gazis, Evangelos; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Graziani, E.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hallgren, A.; Hamacher, K.; Hamilton, K.; Hansen, J.; Haug, S.; Hauler, F.; Hedberg, V.; Hennecke, M.; Herr, H.; Hoffman, J.; Holmgren, S.O.; Holt, P.J.; Houlden, M.A.; Hultqvist, K.; Jackson, John Neil; Jarlskog, G.; Jarry, P.; Jeans, D.; Johansson, Erik Karl; Johansson, P.D.; Jonsson, P.; Joram, C.; Jungermann, L.; Kapusta, Frederic; Katsanevas, S.; Katsoufis, E.; Kernel, G.; Kersevan, B.P.; Kiiskinen, A.; King, B.T.; Kjaer, N.J.; Kluit, P.; Kokkinias, P.; Kourkoumelis, C.; Kouznetsov, O.; Krumstein, Z.; Kucharczyk, M.; Lamsa, J.; Leder, G.; Ledroit, Fabienne; Leinonen, L.; Leitner, R.; Lemonne, J.; Lepeltier, V.; Lesiak, T.; Liebig, W.; Liko, D.; Lipniacka, A.; Lopes, J.H.; Lopez, J.M.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Malek, A.; Maltezos, S.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Mazzucato, F.; Mazzucato, M.; McNulty, R.; Meroni, C.; Meyer, W.T.; Migliore, E.; Mitaroff, W.; Mjoernmark, U.; Moa, T.; Moch, M.; Monig, Klaus; Monge, R.; Montenegro, J.; Moraes, D.; Moreno, S.; Morettini, P.; Mueller, U.; Muenich, K.; Mulders, M.; Mundim, L.; Murray, W.; Muryn, B.; Myatt, G.; Myklebust, T.; Nassiakou, M.; Navarria, F.; Nawrocki, K.; Nicolaidou, R.; Nikolenko, M.; Oblakowska-Mucha, A.; Obraztsov, V.; Olshevski, A.; Onofre, A.; Orava, R.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Palacios, J.P.; Palka, H.; Papadopoulou, T.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Peralta, L.; Perepelitsa, V.; Perrotta, A.; Petrolini, A.; Piedra, J.; Pieri, L.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Poireau, V.; Pol, M.E.; Polok, G.; Poropat, P.; Pozdniakov, V.; Pukhaeva, N.; Pullia, A.; Rames, J.; Ramler, L.; Read, Alexander L.; Rebecchi, P.; Rehn, J.; Reid, D.; Reinhardt, R.; Renton, P.; Richard, F.; Ridky, J.; Rivero, M.; Rodriguez, D.; Romero, A.; Ronchese, P.; Rosenberg, E.; Roudeau, P.; Rovelli, T.; Ruhlmann-Kleider, V.; Ryabtchikov, D.; Sadovsky, A.; Salmi, L.; Salt, J.; Savoy-Navarro, A.; Schwickerath, U.; Segar, A.; Sekulin, R.; Siebel, M.; Sisakian, A.; Smadja, G.; Smirnova, O.; Sokolov, A.; Sopczak, A.; Sosnowski, R.; Spassov, T.; Stanitzki, M.; Stocchi, A.; Strauss, J.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Szumlak, T.; Tabarelli, T.; Taffard, A.C.; Tegenfeldt, F.; Timmermans, Jan; Tkatchev, L.; Tobin, M.; Todorovova, S.; Tome, B.; Tonazzo, A.; Tortosa, P.; Travnicek, P.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Turluer, M.L.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Uvarov, V.; Valenti, G.; Van Dam, Piet; Van Eldik, J.; Van Lysebetten, A.; van Remortel, N.; Van Vulpen, I.; Vegni, G.; Veloso, F.; Venus, W.; Verbeure, F.; Verdier, P.; Verzi, V.; Vilanova, D.; Vitale, L.; Vrba, V.; Wahlen, H.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.; Wilkinson, G.; Winter, M.; Witek, M.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zhuravlov, V.; Zimine, N.I.; Zintchenko, A.; Zupan, M.

    2004-01-01

    DELPHI data collected at centre-of-mass energies up to 208 GeV have been analysed to search for charginos, neutralinos and sfermions in the framework of the Minimal Supersymmetric Standard Model (MSSM) with R-parity conservation. No evidence for a signal was found in any of the channels. The results of each search were used to derive limits on production cross-sections and particle masses. In addition, the combined result of all searches excludes regions in the parameter space of the constrained MSSM, leading to limits on the mass of the Lightest Supersymmetric Particle and other supersymmetric particles.

  5. Analysis of light particles correlation selected by neutron calorimetry in the reaction {sup 208} Pb+{sup 93} Nb at 29 MeV/u; Analyse de correlation de particules legeres selectionnees par calorimetrie neutronique dans la reaction {sup 208} Pb+{sup 93} Nb a 29 MeV/u

    Energy Technology Data Exchange (ETDEWEB)

    Ghisalberti, C.

    1994-11-10

    This work deals with the analysis of light particles correlation selected by neutrons calorimetry in the reaction : {sup 208} Pb+{sup 93} Nb at 29 MeV/u. In the first part are described the interest of correlation functions, the proton-proton correlation function study, the classical model developed for describing the correlations of two light particles emitted by a nucleus in thermal equilibrium, the quantum model and some notions about exclusive sources and measures. The second part is a description of the experience : {sup 208} Pb+{sup 93} Nb at 29 MeV/u. The analysis of experimental data and of experimental correlation functions are given respectively in the third and the fourth parts. (O.L.). 38 refs., 82 figs., 11 tabs.

  6. EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Ai ds (CEF); Scientific Opinion on Flavouring Group Evaluation 208 (FGE.208): Consideration of genotoxicity data on representatives for 10 alicyclic aldehydes with the α , β - unsaturation in ring / side - chain and precursors from chemical subgroup 2.2 of FGE.19 b y EFSA

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

    additional genotoxicity studies for p-mentha-1,8-dien-7-al [FL-no: 05.117]. p-Mentha-1,8-dien-7-al will represent the other nine flavouring substances in FGE.208. Based on the presently available data the Panel concluded that some concern for the genotoxic potential of p-mentha-1,8-dien-7-al remains...

  7. In vitro screening of reversible and time-dependent inhibition on CYP3A by TM208 and TM209 in rat liver microsomes

    Directory of Open Access Journals (Sweden)

    Miaoran Ning

    2012-04-01

    Full Text Available TM208 and TM209, dithiocarbamate derivatives with potential anti-cancer effects, were evaluated in reversible and time-dependent cytochrome P450 (CYP 3A inhibition assays in rat liver microsomes using testosterone as probe substrate. Both compounds were found to be weak reversible inhibitors and moderate mechanism-based inhibitors of rat CYP3A. For reversible inhibition on rat CYP3A, the Ki values of competitive inhibition model were 12.10±1.75 and 13.94±1.31 μM, respectively. For time-dependent inhibition, the inactivation constants (Kl were 31.93±12.64 and 32.91±15.58 μM, respectively, and the maximum inactivation rates (kinact were 0.03497±0.0069 and 0.07259±0.0172 min−1 respectively. These findings would provide useful in vitro information for future in vivo DDI studies on TM208 or TM209.

  8. Pahute Mesa Well Development and Testing Analyses for Wells ER-20-8 and ER-20-4, Nevada National Security Site, Nye County, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Greg Ruskauff and Sam Marutzky

    2012-09-01

    Wells ER-20-4 and ER-20-8 were drilled during fiscal year (FY) 2009 and FY 2010 (NNSA/NSO, 2011a and b). The closest underground nuclear test detonations to the area of investigation are TYBO (U-20y), BELMONT (U-20as), MOLBO (U-20ag), BENHAM (U-20c), and HOYA (U-20 be) (Figure 1-1). The TYBO, MOLBO, and BENHAM detonations had working points located below the regional water table. The BELMONT and HOYA detonation working points were located just above the water table, and the cavity for these detonations are calculated to extend below the water table (Pawloski et al., 2002). The broad purpose of Wells ER-20-4 and ER-20-8 is to determine the extent of radionuclide-contaminated groundwater, the geologic formations, groundwater geochemistry as an indicator of age and origin, and the water-bearing properties and hydraulic conditions that influence radionuclide migration. Well development and testing is performed to determine the hydraulic properties at the well and between other wells, and to obtain groundwater samples at the well that are representative of the formation at the well. The area location, wells, underground nuclear detonations, and other features are shown in Figure 1-1. Hydrostratigraphic cross sections A-A’, B-B’, C-C’, and D-D’ are shown in Figures 1-2 through 1-5, respectively.

  9. Ratio of ellipticities between 192 and 208 nm (R1): An effective electronic circular dichroism parameter for characterization of the helical components of proteins and peptides.

    Science.gov (United States)

    Banerjee, Raja; Sheet, Tridip

    2017-11-01

    Circular dichroism (CD) spectroscopy represents an important tool for characterization of the peptide and protein secondary structures that mainly arise from the conformational disposition of the peptide backbone in solution. In 1991 Manning and Woody proposed that, in addition to the signal intensity, the ratio between [θ]nπ* and [θ]ππ*ǁ ((R 2 ) ≅ [θ] 222 /[θ] 208 ), along with [θ]ππ*⊥ and [θ]ππ*ǁ ((R 1 ) ≅ [θ] 192 /[θ] 208 ), may be utilized towards identifying the peptide/protein conformation (especially 3 10 - and α-helices). However, till date the use of the ratiometric ellipticity component for helical structure analysis of peptides and proteins has not been reported. We studied a series of temperature dependent CD spectra of a thermally stable, model helical peptide and its related analogs in water as a function of added 2,2,2-trifluoroethanol (TFE) in order to explore their landscape of helicity. For the first time, we have experimentally shown here that the R 1 parameter can characterize better the individual helices, while the other parameter R 2 and the signal intensity do not always converge. We emphasize the use of the R 1 ratio of ellipticities for helical characterization because of the common origin of these two bands (exciton splitting of the amide π→ π* transition in a helical polypeptide). This approach may become worthwhile and timely with the increasing accessibility of CD synchrotron sources. © 2017 Wiley Periodicals, Inc.

  10. Freeze-Out Parameters in Central 158A GeV P[number sign]208 b+Pb Collision80s

    Energy Technology Data Exchange (ETDEWEB)

    Aggarwal, M.M.; Bhatia, V.S. (University of Panjab, Chandigarh 160014 (India)); Agnihotri, A.; Bhalla, K.B.; Gupta, S.K.; Raniwala, R.; Raniwala, S. (University of Rajasthan, Jaipur 302004, Rajasthan (India)); Ahammed, Z.; Chattopadhyay, S.; Das, A.C.; Dutta Majumdar, M.R.; Ganti, M.S.; Mukhopadhyay, D.S.; Nayak, T.K.; Sinha, B.C.; Trivedi, M.D.; Viyogi, Y.P. (Variable Energy Cyclotron Centre, Calcutta 700 064 (India)); Angelis, A.L.; Donni, P.; Foka, P.; Kalechofsky, H.; Martin, M.; Naef, H.; Rosselet, L.; Rubio, J.M.; Solomey, N.; Voeroes, S. (University of Geneva, CH-1211 Geneva 4 (Switzerland)); Antonenko, V.; Cherbatchev, R.; Doubovik, I.; Fokin, S.; Ippolitov, M.; Karadjev, K.; Koutcheryaev, I.; Lebedev, A.; Manko, V.; Mgebrichvili, G.; Nianine, A.; Sibiriak, I.; Tsvetkov, A.; Vinogradov, A. (RRC Kurchatov Institute, RU-123182 Moscow (Russia)); Arefiev, V.; Astakhov, V.; Avdeitchikov, V.; Baldine, A.; Barabach, L.; Batiounia, B.; Chalyshev, V.; Djordjadze, V.; Frolov, V.; Ga

    1999-08-01

    Neutral pion production in central 158A GeV [sup 208]Pb+ [sup 208] Pb collisions has been studied in the WA98 experiment at the CERN Super Proton Synchrotron. The [pi][sup 0] transverse mass spectrum has been analyzed in terms of a thermal model with hydrodynamic expansion. The high accuracy and large kinematic coverage of the measurement allow one to limit previously noted ambiguities in the extracted freeze-out parameters. The results are shown to be sensitive to the shape of the velocity distribution at freeze-out. [copyright] [ital 1999] [ital The American Physical Society

  11. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  12. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  13. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  14. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  15. Measurement of hadron and lepton-pair production in $e^{+}e^{-}$ collisions at $\\sqrt{s} = 192 - 208 GeV$ at LEP

    CERN Document Server

    Achard, P.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Anderhub, H.; Andreev, Valery P.; Anselmo, F.; Arefiev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, G.; Baksay, L.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Biasini, M.; Biglietti, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bottai, S.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.; Casaus, J.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Chamizo, M.; Chang, Y.H.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; de la Cruz, B.; Cucciarelli, S.; de Asmundis, R.; Deglon, P.; Debreczeni, J.; Degre, A.; Dehmelt, K.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; Dionisi, C.; Dittmar, M.; Doria, A.; Dova, M.T.; Duchesneau, D.; Duda, M.; Echenard, B.; Eline, A.; El Hage, A.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Extermann, P.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisher, W.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gentile, S.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hirschfelder, J.; Hofer, H.; Hohlmann, M.; Holzner, G.; Hou, S.R.; Jin, B.N.; Jindal, P.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, J.K.; Kirkby, J.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Le Goff, J.M.; Leiste, R.; Levtchenko, M.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Luci, C.; Luminari, L.; Lustermann, W.; Ma, W.G.; Malgeri, L.; Malinin, A.; Mana, C.; Mans, J.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Muanza, G.S.; Muijs, A.J.M.; Musy, M.; Nagy, S.; Natale, S.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Nisati, A.; Novak, T.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Pal, I.; Palomares, C.; Paolucci, P.; Paramatti, R.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Piccolo, D.; Pierella, F.; Pieri, M.; Pioppi, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Pothier, J.; Prokofiev, D.; Rahal-Callot, G.; Rahaman, Mohammad Azizur; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Razis, P.; Rembeczki, S.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Roe, B.P.; Romero, L.; Rosca, A.; Rosemann, C.; Rosenbleck, C.; Rosier-Lees, S.; Roth, Stefan; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Sakharov, A.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Schafer, C.; Schegelsky, V.; Schopper, H.; Schotanus, D.J.; Sciacca, C.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Son, D.; Souga, C.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Tang, X.W.; Tarjan, P.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Ulbricht, J.; Valente, E.; Van de Walle, R.T.; Vasquez, R.; Vesztergombi, G.; Vetlitsky, I.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobiev, I.; Vorobyov, A.A.; Wadhwa, M.; Wang, Q.; Wang, X.L.; Wang, Z.M.; Weber, M.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Yeh, S.C.; Zalite, An.; Zalite, Yu.; Zhang, Z.P.; Zhao, J.; Zhu, G.Y.; Zhu, R.Y.; Zhuang, H.L.; Zichichi, A.; Zimmermann, B.; Zoller, M.

    2006-01-01

    Hadron production and lepton-pair production in e+e- collisions are studied with data collected with the L3 detector at LEP at centre-of-mass energies sqrt{s}=192-208GeV. Using a total integrated luminosity of 453/pb, 36057 hadronic events and 12863 lepton-pair events are selected. The cross sections for hadron production and lepton-pair production are measured for the full sample and for events where no high-energy initial-state-radiation photon is emitted prior to the collisions. Lepton-pair events are further investigated and forward-backward asymmetries are measured. Finally, the differential cross sections for electron-positron pair-production is determined as a function of the scattering angle. An overall good agreement is found with Standard Model predictions.

  16. Final evaluation report for Westinghouse Hanford Company, WRAP-1,208 liter waste drum, docket 94-35-7A, type A packaging

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, D.L., Westinghouse Hanford

    1996-06-12

    This report documents the U.S. Department of Transportation Specification 7A Type A (DOT-7A) compliance test results of the Westinghouse Hanford Company, Waste Receiving and Processing Facility, Module 1 (WRAP-1) Drum. The WRAP-1 Drum was tested for DOE-HQ in August 1994, by Los Alamos National Laboratory, under docket number 94-35-7A. Additionally, comparison and evaluation of the approved, as-tested packaging configuration was performed by WHC in September 1995. The WRAP-1 Drum was evaluated against the performance of the DOT-17C, 208 1 (55-gal) steel drums tested and evaluated under dockets 89-13-7A/90-18-7A and 94-37-7A.

  17. Stretched configuration of states as inferred from γ-ray angular distributions in {sup 40}Ar + {sup 208}Pb neutron transfer reactions

    Energy Technology Data Exchange (ETDEWEB)

    Colovic, P.; Szilner, S.; Mijatovic, T.; Jelavic Malenica, D.; Soic, N. [Ruder Boskovic Institute, Zagreb (Croatia); Corradi, L.; Fioretto, E.; Stefanini, A.M.; Valiente-Dobon, J.J. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Legnaro, Legnaro (Italy); Pollarolo, G. [Dipartimento di Fisica Teorica, Universita di Torino (Italy); Istituto Nazionale di Fisica Nucleare, Torino (Italy); Goasduff, A. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Legnaro, Legnaro (Italy); Dipartimento di Fisica, Universita di Padova (Italy); Istituto Nazionale di Fisica Nucleare, Padova (Italy); Montanari, D. [Dipartimento di Fisica, Universita di Padova (Italy); Istituto Nazionale di Fisica Nucleare, Padova (Italy); Universite de Strasbourg, Institut Pluridisciplinaire Hubert Curien, CNRS-IN2P3, Strasbourg (France); Chapman, R.; Smith, J.F. [University of the West of Scotland, School of Engineering and Computing, Paisley (United Kingdom); Gadea, A. [Instituto de Fisica Corpuscular, CSIC-Universitat de Valencia, Valencia (Spain); Haas, F. [Universite de Strasbourg, Institut Pluridisciplinaire Hubert Curien, CNRS-IN2P3, Strasbourg (France); Marginean, N.; Ur, C.A. [Horia Hulubei National Institute of Physics and Nuclear Engineering and ELI-NP, Bucharest (Romania); Mengoni, D.; Montagnoli, G.; Scarlassara, F. [Dipartimento di Fisica, Universita di Padova (Italy); Istituto Nazionale di Fisica Nucleare, Padova (Italy); Milin, M. [University of Zagreb, Department of Physics, Faculty of Science, Zagreb (Croatia)

    2017-08-15

    Angular distributions of γ-rays for selected transitions in {sup 40,41,42}Ar isotopes have been studied with the PRISMA magnetic spectrometer coupled to the CLARA γ array. These transitions were populated in Ar isotopes reached via neutron transfer in the {sup 40}Ar + {sup 208}Pb reaction. By comparison with the shape of the experimental angular distribution of the known E2 transitions we established more firmly the spin and parity of excited states. In particular, in {sup 41}Ar for the (11/2{sup -}) state through the (11/2{sup -}) → 7/2{sup -} transition whose structure was discussed in terms of a phonon-fermion coupled state. The comparison with the expected fully aligned spin indicated that a high level of spin alignment has been reached. (orig.)

  18. Mapping the boundaries of the seniority regime and collective motion: Coulomb excitation studies of N = 122 isotones $^{206}$Po and $^{208}$Rn

    CERN Multimedia

    Butler, P; Voulot, D; Rahkila, P J; Darby, I G; Grahn, T; Bree, N C F; Julin, R J; Diriken, J V J; Jenkins, D G; Kroell, T; Huyse, M L

    In regions near magic nuclei, seniority can be regarded as a good quantum number. In the N = 122 isotones above the Z = 82 shell closure relative high-$\\textit{j}\\,$ single-particle proton orbitals dominate the structure and thus levels up to $\\textit{I}$ = 2$\\textit{j}$ - 1 could, in principle, be understood within the seniority scheme. While B(E2) values usually increase within the band with increasing $\\textit{I}$, the seniority scheme can lead to a contrasting result. The present proposal addresses this phenomenon through the measurements of previously unknown B(E2; 0$^{+}\\rightarrow$ 2$^{+}$) values in $^{206}$Po and $^{208}$Rn. The proposed Coulomb excitation measurements of radioactive beams will be carried out at the REX-ISOLDE facility using the MINIBALL $\\gamma$-ray spectrometer.

  19. A polymorphism in the porcine miR-208b is associated with microRNA biogenesis and expressions of SOX-6 and MYH7 with effects on muscle fibre characteristics and meat quality.

    Science.gov (United States)

    Kim, J M; Lim, K S; Hong, J S; Kang, J H; Lee, Y S; Hong, K C

    2015-02-01

    MicroRNAs (miRNAs) encoded by the myosin heavy chain (MHC) genes are muscle-specific miRNAs (myomiRs) and regulate the expression of MHC isoforms in skeletal muscle. These miRNAs have been implicated in muscle fibre types and their characteristics by affecting the heterogeneity of myosin. In pigs, miR-208b and miR-499 are embedded in introns of MYH7 and MYH7b respectively. Here, we identified a novel single nucleotide polymorphism (SNP) in intron 30 of MYH7 by which porcine miR-208b is encoded. Based on the association study using a total of 487 pigs including Berkshire (n = 164), Landrace (n = 121) and Yorkshire (n = 202), the miR-208b SNP (g.17104G>A) had significant effects on the proportions of types I and IIb fibre numbers (P MYH7 (P = 0.046). Taken together, our data suggest that the porcine miR-208b SNP differentially represses the expression of SOX-6 by regulating miRNA biogenesis, thereby affecting the expression of MYH7 and the traits of muscle fibre characteristics and meat quality. © 2014 Stichting International Foundation for Animal Genetics.

  20. Protein profile analysis by SDS-PAGE of Mycoplasma Gallisepticum strains S6(208 and F-K810 grown in Hayflick's and Frey's media Análise do perfil protéico das amostras Mycoplasma gallisepticum S6(208 e F-K810 cultivadas em meio de Hayflick e Frey, por SDS-PAGE

    Directory of Open Access Journals (Sweden)

    Priscila N. Ferraz

    2000-06-01

    Full Text Available The Mycoplasma gallisepticum strains [wild-type S6 (208 and a vaccine-type F-K810] grown in Frey´s and Hayflick´s media were analyzed by SDS-PAGE. No visual changes in the protein profiles of these strains were observed regardless of the media composition used, although the polyacrylamide gel electrophoretograms showed minor differences do exist when densitometer traces of the gel are compared. Both strains were easily differentiated on SDS-PAGE analysis by a peptide band p75, that is specific for MG F-K810 strain, used as vaccine.Culturas de Mycoplasma gallisepticum [cepa selvagem S6(208 e vacina F-K810] cultivadas em meio de Frey e Hayflick foram analisadas por SDS-PAGE. Não houve alteração visual nos perfis protéicos das cepas utilizadas, apesar da mudança dos constituintes dos meios. Todavia, a análise por densitometria revelou diferenças menores. A amostras foram facilmente diferenciadas por SDS-PAGE, através da presença da banda peptídica p75, específica da cepa MG F-K810, usada como vacina.

  1. Mixing of isoscalar and isovector magnetic dipole excitation modes in /sup 206/Pb and /sup 208/Pb: Case of electron scattering form factors

    Energy Technology Data Exchange (ETDEWEB)

    Schanz, M.; Richter, A.; Lipparini, E.

    1987-08-01

    Inelastic electron scattering form factors of the J/sup ..pi../ = 1/sup +/ states at excitation energies E/sub x/ = 5.800 and 5.846 MeV in /sup 206/Pb and /sup 208/Pb, respectively, are discussed in terms of a simple model of isoscalar-isovector mixing. It is known that for these states, which are often called loosely ''isoscalar'' 1/sup +/ states, about half of the transition strength is accounted for by this mixing. It is demonstrated here that the isoscalar-isovector mixing is also crucial for explaining the momentum dependence and the absolute magnitude of the form factor. The relative importance of the convection current contribution to the form factor with respect to the spin one is also studied. Finally, the isovector M1 strength distribution in /sup 206/Pb between E/sub x/ = 6.7--8.2 MeV derived from high resolution inelastic electron scattering is shown to agree in shape and magnitude with the one measured recently in an experiment with tagged polarized photons.

  2. Identification of TMEM208 and PQLC2 as reference genes for normalizing mRNA expression in colorectal cancer treated with aspirin.

    Science.gov (United States)

    Zhu, Yuanyuan; Yang, Chao; Weng, Mingjiao; Zhang, Yan; Yang, Chunhui; Jin, Yinji; Yang, Weiwei; He, Yan; Wu, Yiqi; Zhang, Yuhua; Wang, Guangyu; RajkumarEzakiel Redpath, Riju James; Zhang, Lei; Jin, Xiaoming; Liu, Ying; Sun, Yuchun; Ning, Ning; Qiao, Yu; Zhang, Fengmin; Li, Zhiwei; Wang, Tianzhen; Zhang, Yanqiao; Li, Xiaobo

    2017-04-04

    Numerous evidences indicate that aspirin usage causes a significant reduction in colorectal cancer. However, the molecular mechanisms about aspirin preventing colon cancer are largely unknown. Quantitative reverse transcription polymerase chain reaction (qRT-PCR) is a most frequently used method to identify the target molecules regulated by certain compound. However, this method needs stable internal reference genes to analyze the expression change of the targets. In this study, the transcriptional stabilities of several traditional reference genes were evaluated in colon cancer cells treated with aspirin, and also, the suitable internal reference genes were screened by using a microarray and were further identified by using the geNorm and NormFinder softwares, and then were validated in more cell lines and xenografts. We have showed that three traditional internal reference genes, β-actin, GAPDH and α-tubulin, are not suitable for studying gene transcription in colon cancer cells treated with aspirin, and we have identified and validated TMEM208 and PQLC2 as the ideal internal reference genes for detecting the molecular targets of aspirin in colon cancer in vitro and in vivo. This study reveals stable internal reference genes for studying the target genes of aspirin in colon cancer, which will contribute to identify the molecular mechanism behind aspirin preventing colon cancer.

  3. Pahute Mesa Well Development and Testing Analyses for Wells ER-20-7, ER-20-8 #2, and ER-EC-11, Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Greg Ruskauff

    2011-12-01

    This report analyzes the following data collected from ER-20-7, ER-20-8 No.2, and ER-EC-11 during WDT operations: (1) Chemical indicators of well development (Section 2.0); (2) Static hydraulic head (Section 3.0); (3) Radiochemistry and geochemistry (Section 4.0); (4) Drawdown observed at locations distal to the pumping well (Section 5.0); and (5) Drilling water production, flow logs, and temperature logs (Section 6.0). The new data are further considered with respect to existing data as to how they enhance or change interpretations of groundwater flow and transport, and an interim small-scale conceptual model is also developed and compared to Phase I concepts. The purpose of well development is to remove drilling fluids and drilling-associated fines from the formation adjacent to a well so samples reflecting ambient groundwater water quality can be collected, and to restore hydraulic properties near the well bore. Drilling fluids can contaminate environmental samples from the well, resulting in nonrepresentative measurements. Both drilling fluids and preexisting fines in the formation adjacent to the well can impede the flow of water from the formation to the well, creating artifacts in hydraulic response data measured in the well.

  4. Understanding the two neutron transfer reaction mechanism in {sup 206}Pb({sup 18}O,{sup 16}O){sup 208}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Parmar, A.; Sonika [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Roy, B.J., E-mail: bjroy@barc.gov.in [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Jha, V.; Pal, U.K. [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India); Sinha, T. [High Energy Nuclear and Particle Physics Division, Saha Institute of Nuclear Physics, Kolkata - 700 064 (India); Pandit, S.K.; Parkar, V.V.; Ramachandran, K.; Mahata, K.; Santra, S.; Mohanty, A.K. [Nuclear Physics Division, Bhabha Atomic Research Centre, Mumbai - 400 085 (India)

    2015-08-15

    The absolute cross sections for elastic scattering and two-neutron transfer reaction for {sup 18}O + {sup 206}Pb system have been measured at an incident energy near the Coulomb barrier. Detailed coupled reaction channel calculations have been carried out for description of the measured angular distributions for the elastic scattering and transfer reactions simultaneously. The two-neutron transfer reaction {sup 206}Pb({sup 18}O, {sup 16}O){sup 208}Pb in the g.s. → g.s. transition is analyzed in (i) extreme cluster model assuming a di-neutron transfer, (ii) two-step successive transfer, and (iii) microscopic approach (independent coordinate scheme) of simultaneous transfer of two neutrons. The relative importance of one step simultaneous transfer versus two-step successive transfer has been studied. Present analysis suggests dominance of cluster transfer of a di-neutron. The contribution from the two-step sequential processes is less significant, however, the combined “two-step plus simultaneous (microscopic)” calculations give a reasonably good agreement with the measurement. The possibility of multi-step route via projectile and target excitations and contribution from such indirect transfer paths to the present two-neutron transfer cross section has been investigated.

  5. CDCC calculations of elastic scattering for the systems 6Li+144Sm and 6Li+208Pb. Effect of resonances of 6Li on elastic scattering angular distributions

    Science.gov (United States)

    Gómez Camacho, A.

    2015-01-01

    Calculations of elastic scattering angular distributions for reactions of the weakly bound projectile 6Li with targets 144Sm and 208Pb at energies above the barrier, are performed with the Continuum Discretized Coupled-Channel method (CDCC). Ground, resonant and nonresonant continuum states of 6Li are included up to some maximum energy epsilonmax for which convergence is achieved. In the three-body system, global interactions are used for the α-target and d - target sub-systems. The effect of continuum resonant states of 6Li, i.e., l = 2, jπ = 3+, 2+ and 1+ on elastic scattering angular distributions is investigated by extracting these states from the continuum space. It is found that the calculated elastic scattering angular distributions are in good agreement with the measurements for most of the cases studied where consideration of couplings to continuum states is essential. It is also found that the resonance character of the continuum states is in some cases important to obtain agreement with the data.

  6. Urea Cycle Defects: Early-Onset Disease Associated with A208T Mutation in OTC Gene—Expanding the Clinical Phenotype

    Directory of Open Access Journals (Sweden)

    Ana Isabel Sánchez

    2017-01-01

    Full Text Available Ornithine transcarbamylase deficiency (OMIM: 311250 is the most common disorder of urea cycle disorders, accounting for nearly 50% of all cases. We report a case of a two-month- old male patient, who attends our medical genetics consultation because of low citrulline levels and elevated glutamine to citrulline ratio detected by expanded newborn screening with tandem mass spectrometry. He is an asymptomatic male with a normal physical examination and appropriate neurodevelopmental milestones. The patient has a family history of one older brother who died at 18 months old from severe and sudden hyperammonemia and a maternal aunt who suddenly died at two years old. He had high plasma ammonium concentration and a confirmed OTC mutation (p.A208T. Usually, this mutation causes OTC deficiency of late onset in adult males. However, this report raises awareness about mutations previously described as a late-onset causing disease, which can cause severe hyperammonemia and high risk of dying at an early age.

  7. Excitation function for the production of 262Bh (Z = 107) in theodd-Z projectile reaction 208Pb(55Mn, n)

    Energy Technology Data Exchange (ETDEWEB)

    Folden III, C.M.; Nelson, S.L.; Dullmann, Ch.E.; Schwantes, J.M.; Sudowe, R.; Zielinski, P.M.; Gregorich, K.E.; Nitsche, H.; Hoffman, D.C.

    2005-05-16

    The excitation function for production of 262Bh in the odd-Z-projectile reaction 208Pb(55Mn,n) has been measured at three projectile energies using the Berkeley Gas-filled Separator at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. In total, 33 decay chains originating from 262Bh and 2 decay chains originating from 261Bh were observed. The measured decay properties are in good agreement with previous reports. The maximum cross section of 540 +180 - 150 pb is observed at a lab-frame center-of-target energy of 264.0 MeV and is more than fives times larger than that expected based on previously reported results for production of 262Bh in the analogous even-Z-projectile reaction 209Bi(54Cr,n). Our results indicate that the optimum beam energy in one-neutron-out heavy-ion fusion reactions can be estimated simply using the ''Optimum Energy Rule'' proposed by Swiatecki, Siwek-Wilczynska, and Wilczynski.

  8. Evaluation of the Addition liquor with high ammonia and Carbon Dioxide contentin the still 208 of the “Comandante Che Guevara” industry (ECG

    Directory of Open Access Journals (Sweden)

    María Elena Magaña-Haynes

    2015-12-01

    Full Text Available Adding fresh liquor through the 5th ring in still 208 of distilling liquor product (liquor obtained as a result of ammonium carbonate leaching of lateritic ore in the “Comandante Che Guevara” industry, were evaluated with the objective of reducing the dissolved nickel content of the effluent there from, as well as to improve the characteristics of the nickel carbonate which is delivered to the calcinations process. For the development of the survey, the same methodology used in 2001 for the test was applied. The results showed that by adding fresh liquor, it is possible to reduce the dissolved nickel content at the exit of the distillation column, so that the need for precipitation is minimized, thereby reducing the consumption of reagents and the and the cost for their acquisition. It was possible to corroborate the relationship between the content of NH3 at the discharge and the nickel dissolved therein appreciating that to achieve these results it is necessary to maintain the ammonia in the discharge between 1,0-1,8 g/L. The carbonate obtained in the column where liquor is added with high CO2 and NH3 reached high values of this last element in its composition and to the extent that increased sulphur content decreased. It was also seen an increase in the size of the coarse carbonates particles, which will influence in a decrease of energy consumption.

  9. Study of elastic pion scattering from /sup 9/Be, /sup 28/Si, /sup 58/Ni, and /sup 208/Pb at 162 MeV. [Total and differential cross sections, scattering yields, scattering amplitudes

    Energy Technology Data Exchange (ETDEWEB)

    Devereux, M.J.

    1979-05-01

    Elastic pion scattering from /sup 9/Be, /sup 28/Si, /sup 58/Ni, and /sup 208/Pb at 162 MeV is analyzed and compared with an optical model theory which incorporates a pion--nucleon range. Excellent fits to the data are obtained in all but one case. The fitted values of the pion--nucleon range, as well as other fitted values are listed. 108 references.

  10. Allanite from the El Muerto Pegmatite, Oaxaca, Mexico: A Potential New Standard for 232Th-208Pb Dating by LA-ICP-MS

    Science.gov (United States)

    Price, J.; Crowley, J. L.; Solari, L.; Prol-Ledesma, R.

    2012-12-01

    Allanite dating may be important to studies addressing tectonomagmatic evolution, provenance of monocyclic sediment, and mineral weathering. Obtaining accurate allanite ages by SIMS has been challenging and time-consuming due to the mineral's extreme chemical variability which often prevents finding adequately matrix-matched standards. Isotopic measurements by LA-ICP-MS minimize the need for standards of nearly identical composition to the unknown allanite being analyzed, and it is done relatively rapidly. Dating by LA-ICP-MS requires high quality standards for isotopic fractionation corrections. However, readily accessible and well characterized allanite standards are scarce. We investigated gemstone allanite from the El Muerto pegmatite, Oaxaca, Mexico, as a potential new geochronology standard for 232Th-208Pb allanite dating by LA-ICP-MS. Compositional homogeneity was thoroughly investigated by scanning and backscatter electron microscopy, cathodoluminescence, quantitative and qualitative energy dispersive x-ray spectroscopy, electron microprobe, and LA-ICP-MS. The possibility of metamictization was investigated by extensive X-ray diffraction analyses. The El Muerto allanite was U-Pb dated by ID-TIMS, with common Pb ratios determined from cogenetic K-feldspar by ID-TIMS and LA-MC-ICP-MS. Future work includes Th-Pb dating by ID-TIMS. The samples investigated are homogeneous with respect to major and trace elements. Major element compositional results are generally in agreement with published values, and no metamictization was identified despite the allanite being nearly 1 Ga. The only limitation of the El Muerto allanite is that it contains small, generally <100 μm, scarce inclusions of quartz, calciothorite, albite, calcite, and biotite. However, these grains are easily recognized and avoided during LA-ICP-MS analyses. Based on these results, the El Muerto allanite has the potential to serve as a standard for LA-ICP-MS dating.

  11. Commissioning of the STAR test section for experimental simulation of loss of coolant accident using the EC-208 instrumented fuel assembly of the IEA-R1 reactor

    Energy Technology Data Exchange (ETDEWEB)

    Maprelian, Eduardo; Torres, Walmir M.; Prado, Adelk C.; Umbehaun, Pedro E.; Franca, Renato L.; Santos, Samuel C.; Macedo, Luiz A.; Sabundjian, Gaiane, E-mail: emaprel@ipen.br, E-mail: wmtorres@ipen.br, E-mail: acprado@ipen.br, E-mail: umbehaun@ipen.br, E-mail: rlfranca@ipen.br, E-mail: samuelcs@ipen.br, E-mail: lamacedo@ipen.br, E-mail: gdjian@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SO (Brazil)

    2015-07-01

    The three basic safety functions of Research Reactors (RR) are the safe shutdown of the reactor, the proper cooling of the decay heat of the fuel elements and the confinement of radioactive materials. Compared to Nuclear Power Reactors, RR power release is small, yet its three safety functions must be met to ensure the integrity of the reactor. During a loss of coolant accident (LOCA) in pool type RR, partial or complete loss of pool water may occur, with consequent partial or complete uncovering of the fuel assemblies. In such an accident, the decay heat removal safety function must not be compromised. The Test Section for Experimental Simulation of Loss of Coolant Accident (STAR) is in commissioning phase. This test section will provide experimental data on partial and total uncovering of the EC-208 instrumented fuel assembly (IFA) irradiated in the IEA-R1. Experimental results will be useful in validation of computer codes for RR safety analysis, particularly on heat removal efficiency aspects (safety function) in accident conditions. STAR comprises a base on which is installed the IFA, the cylindrical stainless steel hull, the compressed air system for the test section emptying and refilling, and the instrumentation for temperature and level measurements. The commissioning tests or pre-operational check, consist of several preliminary tests to verify experimental procedures, the difficulties during assembling of STAR in the pool, the difficulties in control the emptying and refilling velocities, as well as, the repeatability capacity, tests of equipment, valves and systems and tests of instrumentation and data acquisition system. Safety, accuracy and easiness of operation will be checked. (author)

  12. Performance of potential non-crop or wild species under OECD 208 testing guideline study conditions for terrestrial non-target plants.

    Science.gov (United States)

    Pallett, Ken; Cole, Jon; Oberwalder, Christian; Porch, John

    2007-02-01

    The inclusion of 52 potential non-crop or wild species in new OECD guidelines for terrestrial non-target plant (TNTP) testing led to a ring test conducted by four laboratories experienced in regulatory testing. Species selected had shown potential to meet validity criteria of emergence for TNTP studies in a previous evaluation of the 52 species. OECD 208 guideline conditions were applied, with and without seed pretreatments recommended to enhance germination. These species were Abutilon theophrasti (L.) Medic., Avena fatua L., Fallopia convolvulus (L.) Adans., Galium aparine L., Ipomoea hederacea (L.) Jacq. and Veronica persica Poir. Only I. hederacea met the validity criterion of 70% emergence in all laboratories and showed a low variability in biomass. Of the other species, none led to 70% emergence in all four laboratories. The recommended pretreatments did not have a major impact on emergence. Biomass was also investigated with A. theophrasti, A. fatua, Centaurea cyanus L., I. hederacea and Rumex crispus L. Variability of biomass, a key parameter in TNTP regulatory studies, exceeded normal biomass variability of crop species used for TNTP studies. The addition of a thin layer of quartz sand to the soil surface resulted in improved emergence of C. cyanus, G. aparine and V. persica; however, such a procedure, while routine in screening studies to improve germination, is a deviation from the TNTP guidelines. These initial studies indicate that some species could meet the emergence criteria for TNTP testing. However, there is a need for further studies on seed source, seed quality and conditions for uniform emergence before their use in routine regulatory testing.

  13. AMENDAMENTELE OPERATE ÎN CODUL CONTRAVENȚIONAL PRIN LEGEA NR. 208/2016: IMPLICAȚII JURIDICO-PENALE

    Directory of Open Access Journals (Sweden)

    Sergiu BRÎNZA

    2017-07-01

    Full Text Available Scopul investigației de față îl constituie analiza implicațiilor juridico-penale ale amendamentelor operate prin Legea nr.208/2016. Analiza efectuată arată că modificarea operată în alin.(6 art.16 din Codul contravențional a îndepărtat în plan terminologic Codul contravențional de Codul penal. Din aceleași considerente, este inoportună modificarea alin.(4 art.17 din Codul contravențional. În același timp, se prezintă ca oportună modificarea art.18 din Codul contravențional. De asemenea, se justifică modificarea cu caracter de precizare a art.541 din Codul contravențional. La fel, este salutară modificarea alin.(1 și (2 art.96, art.97, alin.(1 și (2 art.971, art.972, art.99-103, art.149, alin.(2 art.155 și a art.243 din Codul contravențional. Totuși, acestea nu sunt singurele norme contravenționale care se află într-o relație de comple­men­­taritate cu anumite norme penale. De aceea, legiuitorul ar trebui să dea dovadă de mai multă consecvență și să abordeze uniform ipotezele similare care vizează complementaritatea dintre ilicitul penal și ilicitul contravențional. Este oportună completarea dispoziției alin.(10 art.157 din Codul contravențional, în final, cu textul „ , dacă fapta nu constituie infrac­țiune,”. Aceasta va permite delimitarea mai precisă a faptei contravenționale prevăzute de această normă de unele infrac­țiuni. Se justifică completarea Codului contravențional cu art.1991-19912, 2201-2205. Aceste norme au completat lista de norme contravenționale care sunt complementare față de art.263 CP RM. Este oportună excluderea sintagmei „încalcă normele morale,” din dispoziția art.354 din Codul contravențional.THE AMENDMENTS MADE TO THE CONTRAVENTION CODE BY LAW NO.208/2016: JURIDICAL-PENAL CONSIDERATIONSThe purpose of the investigation is to analyze the juridical-penal considerations of the amendments made by Law No.208/2016. As a result of the analysis there

  14. Solution of the Skyrme Hartree Fock Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis. (V) HFODD(v2.08k)

    Science.gov (United States)

    Dobaczewski, J.; Olbratowski, P.

    2005-05-01

    We describe the new version (v2.08k) of the code HFODD which solves the nuclear Skyrme-Hartree-Fock or Skyrme-Hartree-Fock-Bogolyubov problem by using the Cartesian deformed harmonic-oscillator basis. Similarly as in the previous version (v2.08i), all symmetries can be broken, which allows for calculations with angular frequency and angular momentum tilted with respect to the mass distribution. In the new version, three minor errors have been corrected. New Version Program SummaryTitle of program: HFODD; version: 2.08k Catalogue number: ADVA Catalogue number of previous version: ADTO (Comput. Phys. Comm. 158 (2004) 158) Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADVA Program obtainable from: CPC Program Library, Queen's University of Belfast, N. Ireland Does the new version supersede the previous one: yes Computers on which this or another recent version has been tested: SG Power Challenge L, Pentium-II, Pentium-III, AMD-Athlon Operating systems under which the program has been tested: UNIX, LINUX, Windows-2000 Programming language used: Fortran Memory required to execute with typical data: 10M words No. of bits in a word: 64 No. of lines in distributed program, including test data, etc.: 52 631 No. of bytes in distributed program, including test data, etc.: 266 885 Distribution format:tar.gz Nature of physical problem: The nuclear mean-field and an analysis of its symmetries in realistic cases are the main ingredients of a description of nuclear states. Within the Local Density Approximation, or for a zero-range velocity-dependent Skyrme interaction, the nuclear mean-field is local and velocity dependent. The locality allows for an effective and fast solution of the self-consistent Hartree-Fock equations, even for heavy nuclei, and for various nucleonic ( n-particle n-hole) configurations, deformations, excitation energies, or angular momenta. Similar Local Density Approximation in the particle-particle channel, which is equivalent to using a zero

  15. Effect of small body habitus on peri-operative outcomes after robotic-assisted pulmonary lobectomy: retrospective analysis of 208 consecutive cases.

    Science.gov (United States)

    Velez-Cubian, Frank O; Zhang, Wei-Wei; Rodriguez, Kathryn L; Thau, Matthew R; Ng, Emily P; Moodie, Carla C; Garrett, Joseph R; Fontaine, Jacques-Pierre; Toloza, Eric M

    2016-06-01

    Patients with smaller body surface area (BSA) have smaller pleural cavities, which limit visualization and instrument mobility during video-assisted thoracoscopic surgery (VATS). We investigated the effects of BSA on outcomes with robotic-assisted VATS lobectomy. We analyzed 208 consecutive patients who underwent robotic-assisted lobectomy over 34 months. Patients were separated into group A (BSA ≤1.65 m(2)) and group B (BSA >1.65 m(2)). Operative times, estimated blood loss (EBL), conversions to thoracotomy, complications, hospital length of stay (LOS), and in-hospital mortality were compared. Group A had 40 patients (BSA 1.25-1.65 m(2)), and group B had 168 patients (BSA 1.66-2.86 m(2)). Median skin-to-skin operative times [± standard error of the mean (SEM)] were 169±16 min for group A and 176±6 min for group B (P=0.34). Group A had median EBL of 150±96 mL compared to 200±24 mL for group B (P=0.37). Overall conversion rate to thoracotomy was 8/40 (20.0%) in group A versus 12/168 (7.1%) in group B (P=0.03); while emergent conversion for bleeding was 2/40 (5.0%) in group A versus 5/168 (3.0%) in group B (P=0.62). Postoperative complications occurred in 12/40 (30.0%) in group A, compared to 66/168 (39.3%) in group B (P=0.28). Patients from both groups had median hospital LOS of 5 days (P=0.68) and had similar in-hospital mortality. Patients with BSA ≤1.65 m(2) have similar perioperative outcomes and complication risks as patients with larger BSA. Patients with BSA ≤1.65 m(2) have a higher overall conversion rate to thoracotomy, but similar conversion rate for bleeding as patients with larger BSA. Robotic-assisted pulmonary lobectomy is feasible and safe in patients with small body habitus.

  16. Recovery of radiogenic lead-208 from a residue of thorium and rare earths obtained during the operation of a thorium purification pilot plant; Separacao e recuperacao de chumbo-208 dos residuos de torio terras raras gerados na unidade piloto de purificacao de nitrato de torio

    Energy Technology Data Exchange (ETDEWEB)

    Seneda, Jose Antonio

    2006-07-01

    Brazil has a long tradition in thorium technology, from mineral dressing (monazite) to the nuclear grade thorium compounds. The estimate reserves are 1200,000. ton of ThO{sub 2}. As a consequence from the work of thorium purification pilot plant at Instituto de Pesquisas Energeticas e Nucleares-CNEN/IPEN-SP, about 25 ton of a sludge containing thorium and rare earths was accumulated. It comes as a raffinate and washing solutions from thorium solvent extraction. This sludge, a crude hydroxide named RETOTER contains thorium, rare earths and minor impurities including the radiogenic lead-208, with abundance 88.34 %. This work discusses the results of the studies and main parameters for its recovery by anionic ion exchange technique in the hydrochloric system. The isotope abundance of this lead was analyzed by high resolution mass spectrometer (ICPMS) and thermoionic mass spectrometer (TIMS) and the data was used to calculate the thermal neutron capture cross section. The value of {sigma}{gamma}{sup 0} = 14.6{+-}0.7 mb was found, quite different from the {sigma}{gamma}{sup 0} = 174.2 {+-} 7.0 mb measure cross section for the natural lead. Preliminary study for the thorium and rare earths separation and recovery was discussed as well. (author)

  17. Measurement of isotopic cross sections of the fission fragments produced in 500 AMeV {sup 208}Pb + p reaction; Etude de la production des fragments de fission issus de la reaction {sup 208}Pb + p a 500 AMeV

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez-Dominguez, B

    2003-03-01

    The aim of this work is the study of the fission fragments produced in the spallation reaction {sup 208}Pb + p at 500 AMeV. The fission fragments from Z=23 up to Z=59 have been detected and identified by using the inverse kinematics technique with the high-resolution spectrometer FRS. The production cross sections and the recoil velocities of 430 nuclei have been measured. The measured data have been compared with previous data. The isotopic distributions show a high precision. However, the absolute value of the fission cross section is higher than expected. From the experimental data the characteristics of the average fissioning system have been reconstructed (Z{sub fis}, A{sub fis}, E*{sub fis}). In addition, the number of post-fission neutrons emitted from the fission fragments, v{sub post}, has been determined by using a new method. The experimental data have been compared to the two-steps models describing the spallation reaction. The impact of the model parameters on the observables has been analysed and the reasons Leading to the observed differences between the codes are also presented. This analyse shows a good agreement with the INCL4+ABLA code. (author)

  18. Neutron and proton optical potentials for {sup 12}C, {sup 16}O, {sup 27}Al, {sup 56}Fe, {sup 90}Zr and {sup 208}Pb up to 250 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Young-Ouk; Chang, Jonghwa [Korea Atomic Energy Research Institute, Yusong, Taejon (Korea); Fukahori, Tokio; Chiba, Satoshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2000-03-01

    In order to perform nuclear data evaluation without unphysical discontinuities, optical models should cover the whole mass and energy range of interest continuously. In this work, the best set of optical model parameters were obtained with energy dependent potential forms which incorporate effects of dispersion relationship for neutron and proton up to 250 MeV on {sup 12}C, {sup 16}O, {sup 27}Al, {sup 56}Fe, {sup 90}Zr and {sup 208}Pb. Applicability of adopting an identical geometrical factor for the real volume, imaginary volume and imaginary surface potentials has been investigated as well in the process of parameter search. (author)

  19. Study of tracking detector of NEMO3 experiment - simulation of the measurement of the ultra low {sup 208}Tl radioactivity in the source foils used as neutrinoless double beta decay emitters in NEMO3 experiment; Etude du detecteur de traces de l'experience NEMO3. Simulation de la mesure de l'ultra-faible radioactivite en {sup 208}Tl des sources de l'experience NEMO3 candidates a la double desintegration {beta} sans emission de neutrino

    Energy Technology Data Exchange (ETDEWEB)

    Errahmane, K

    2001-04-01

    The purpose of NEMO3 experiment is the research of the neutrinoless double beta decay. This low energy process can sign the massive and Majorana nature of neutrino. This experiment, with a very low radioactive background and containing 10 kg of enriched isotopes, studies mainly {sup 100}Mo. Installed at the Frejus underground laboratory, NEMO3 is a cylindrical detector, which consists in very thin central source foils, in a tracking detector made up of vertical drift cells operating in Geiger mode, in a calorimeter and in a suitable shielding. This thesis is divided in two different parts. The first part is a full study of the features of the tracking detector. With a prototype composed of 9 drift cells, we characterised the longitudinal and transverse reconstruction of position of the ionisation created by a LASER. With the first 3 modules under operation, we used radioactive external neutron sources to measure the transverse resolution of ionisation position in a drift cell for high energy electrons. To study the vertex reconstruction on the source foil, sources of {sup 207}Bi, which produced conversion electrons, were used inside the 3 modules. The second part of this thesis, we show, with simulations, that we can measure, with NEMO3 detector itself, the ultra low level of contamination in {sup 208}Tl of the source foil, which comes from the natural radioactive chain of thorium. Using electron-photons channels, we can obtain the {sup 208}Tl activity in the sources. With an analysis on the energy and on the time of flight of particles, NEMO3 is able to reach a sensitivity of 20{mu}Bq/kg after only 2 months of measurement. This sensitivity is the maximum {sup 208}Tl activity, which we accepted for the sources in the NEMO3 proposal. (author)

  20. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  1. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    Energy Technology Data Exchange (ETDEWEB)

    Patin, Joshua Barnes [Univ. of California, Berkeley, CA (United States)

    2002-01-01

    The study of the reactions between heavy ions and 208Pb, 209Bi, 238U, and 248Cm Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238U(18O,xn)256-xFm, 238U(22Ne,xn)260-xNo, and 248Cm(15N,xn)263-xLr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 48Pb(238Ca,xn)256-xNo, 208Pb(50Ti,xn)258-xRf, 208Pb(51V,xn)259-xDb, 50Bi(238Ti,xn)259-xDb, and 209Bi(51V,xn)260-xSg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics.

  2. High resolution neutron (n,xn) cross-section measurements for {sup 206,207,208}Pb and {sup 209}Bi from threshold up to 20 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Mihailescu, L.C.; Borcea, C.; Plompen, A.J.M. [European Commission, Joint Research Center, Institute for Reference Materials and Measurements, Geel (Belgium); Baumann, P.; Dessagne, P.; Kerveno, M.; Lukic, S.; Rudolf, G. [IReS, IN2P3, 67 - Strasbourg (France); Jericha, E.; Pavlik, A. [Wien Technische Univ. (Austria); Koning, A.J. [Nuclear Research Group Petten (Netherlands)

    2008-07-01

    Gamma production cross sections for neutron inelastic scattering reactions (n,xn) (x = 1, 2, 3) were measured for three different highly enriched targets of {sup 206}Pb, {sup 207}Pb and {sup 208}Pb and for {sup 209}Bi. Using the known decay schemes of these isotopes, the total inelastic cross sections and level inelastic cross sections were determined. The measurements are continuous in neutron energy and cover a wide interval (from threshold energy up to about 20 MeV). The experiments were performed at the GELINA white neutron source, at the 200 m flight path station with a time resolution of 8 ns, resulting in an unprecedented neutron energy resolution of 1.1 keV at 1 MeV (36 keV at 10 MeV). (authors)

  3. Preparing a journey to the east of {sup 208}Pb with ISOLTRAP: Isobaric purification at A = 209 and new masses for {sup 211-213}Fr and {sup 211}Ra

    Energy Technology Data Exchange (ETDEWEB)

    Kowalska, M.; Herlert, A. [CERN, Physics Department, Geneva 23 (Switzerland); Naimi, S.; Audi, G.; Lunney, D.; Minaya-Ramirez, E. [Universite de Paris Sud, CSNSM-IN2P3-CNRS, Orsay (France); Agramunt, J.; Estevez, E.; Rubio, B. [CSIC-Universidad de Valencia, IFIC, Valencia (Spain); Algora, A. [CSIC-Universidad de Valencia, IFIC, Valencia (Spain); Institute of Nuclear Research of the Hungarian Academy of Sciences, Debrecen (Hungary); Beck, D.; Herfurth, F. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Blank, B. [Universite Bordeaux 1/CNRS/IN2P3, CENBG, Gradignan Cedex (France); Blaum, K.; Boehm, C.; Kellerbauer, A.; Neidherr, D.; Warring, U. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Breitenfeldt, M.; Rosenbusch, M.; Schweikhard, L. [Ernst-Moritz-Arndt-Universitaet, Institut fuer Physik, Greifswald (Germany); Fraile, L.M.; Olaizola, B. [Universidad Complutense, Departamento de Fisica Atomica, Molecular y Nuclear, Madrid (Spain); George, S. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Johannes Gutenberg-Universitaet, Institut fuer Physik, Mainz (Germany); Riisager, K. [University of Aarhus, Department of Physics and Astronomy, Aarhus (Denmark); Schwarz, S. [Michigan State University, NSCL, East Lansing, MI (United States)

    2009-12-15

    With the Penning trap mass spectrometer ISOLTRAP, located at ISOLDE/CERN, preparatory work has been performed towards mass and decay studies on neutron-rich Hg and Tl isotopes beyond N=126. The properties of these isotopes are not well known because of large isobaric contamination coming mainly from surface-ionised Fr. Within the studies, production tests using several target-ion source combinations were performed. It was furthermore demonstrated around mass number A=209 that the resolving power required to purify Fr is achievable with ISOLTRAP. In addition, masses of several isobaric contaminants, {sup 211-213}Fr and {sup 211}Ra, were determined with a three-fold improved precision. The results influence masses of more than 20 other nuclides in the {sup 208}Pb region. (orig.)

  4. Inherited thrombophilia in women with poor aPL-related obstetric history: prevalence and outcomes. Survey of 208 cases from the European Registry on Obstetric Antiphospholipid Syndrome cohort.

    Science.gov (United States)

    Alijotas-Reig, Jaume; Ferrer-Oliveras, Raquel; Esteve-Valverde, Enrique; Ruffatti, Amelia; Tincani, Angela; Lefkou, Elmina; Bertero, Maria Tiziana; Espinosa, Gerard; Coloma, Emmanuel; de Carolis, Sara; Rovere-Querini, Patrizia; Canti, Valentina; Picardo, Elisa; Fredi, Micaela; Mekinian, Arsene

    2016-08-01

    To analyse the prevalence and effects of inherited thrombophilic disorders (ITD) on maternal-foetal outcomes in cases of antiphospholipid antibody related to obstetric complications. Women with obstetric complaints who tested positive for aPL and with inherited thrombophilia were prospectively and retrospectively included. ITD data were available in 208 of 338: 147 had obstetric antiphospholipid syndrome (OAPS) and 61 aPL-related obstetric morbidity (OMAPS). 24.1% had ITD. Laboratory categories I and IIa were more related to OAPS-ITD and IIb and IIc to OMAPS-ITD. No significant differences in obstetric complaints were observed. Regarding ITD carriers, treatment rates were higher in OAPS than in OMAPS for LMWH and LDA plus LMWH (P=.002). Cases with aPL-related OAPS/OMAPS showed no differences in maternal-foetal outcomes regardless of the presence of one ITD. Maternal thrombotic risk was low, with ITD-positive cases included. Registry data concur with Sydney criteria, whereby aPL-ITD-positive patients are classified as having antiphospholipid syndrome. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  5. Rayleigh LIDAR and satellite (HALOE, SABER, CHAMP and COSMIC measurements of stratosphere-mesosphere temperature over a southern sub-tropical site, Reunion (20.8° S; 55.5° E: climatology and comparison study

    Directory of Open Access Journals (Sweden)

    V. Sivakumar

    2011-04-01

    Full Text Available For the first time, climatology of the middle atmosphere thermal structure is presented, based on 14 years of LIDAR and satellite (HALOE, SABER, CHAMP and COSMIC temperature measurements. The data is collected over a southern sub-tropical site, Reunion Island (20.8° S; 55.5° E, for the height range between 30 and 60 km. The overall monthly mean temperature shows a maximum of 265–270 K at the stratopause height region from ~44–52 km and peaks during the months of March and November. Furthermore, the temperature profiles are compared with different satellite datasets (HALOE, CHAMP, COSMIC and SABER and the results are found to be in reasonable agreement with each other, although a relative difference in temperature of ± 5 to 6 K is noticed. In comparison, LIDAR shows higher/lower temperatures for the lower mesosphere/upper stratosphere height region. The differences in temperature measured by the LIDAR and satellite measurements are analogous with previous results available elsewhere. Long-term temperature measurements are used to further study seasonal oscillations, especially annual, semi-annual and quasi-biennial oscillations. In comparison with SAO, the measured spectral amplitudes of AO shows dominant amplitudes in both the upper stratosphere and lower mesosphere height regions. Using LIDAR and the other satellite measurements, the quasi-biennial oscillation was found to be approximately 26 months. The spectral amplitudes are comparable to the results reported earlier by other researchers.

  6. The flow dynamics of an extremely large volume pyroclastic flow, the 2.08-Ma Cerro Galán Ignimbrite, NW Argentina, and comparison with other flow types

    Science.gov (United States)

    Cas, Ray A.F.; Wright, Heather M.; Folkes, Christopher B.; Lesti, Chiara; Porreca, Massimiliano; Giordano, Guido; Viramonte, Jose G.

    2011-01-01

    The 2.08-Ma Cerro Galán Ignimbrite (CGI) represents a >630-km3 dense rock equivalent (VEI 8) eruption from the long-lived Cerro Galán magma system (∼6 Ma). It is a crystal-rich (35–60%), pumice (explain the contemporaneous maintenance of high particle concentration, high sedimentation rate at the depositional boundary layer and a high level of mobility, it is also proposed that the flow(s) was continuously supplied at a high mass feeding rate. It is also proposed that internal gas pressure within the flow, directed downwards onto the substrate over which the flow was passing, reduced the friction between the flow and the substrate and also enhanced its mobility. The pervasive sub-horizontal fabric of aligned pumice, lithic and even biotite crystals indicates a consistent horizontal shear force existed during transport and deposition in the basal granular flow, consistent with the existence of a laminar, shearing, granular flow regime during the final stages of transport and deposition.

  7. Multi-step processes in the (d, t) and (d, {sup 3}He) reactions on {sup 116}Sn and {sup 208}Pb targets at E{sub d} = 200 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Langevin-Joliot, H.; Van de Wiele, J.; Guillot, J. [Institut de Physique Nucleaire, IN2P3/CNRS, 91 - Orsay (France); Koning, A.J. [Nuclear Research and Consultancy Group NRG, NL (Netherlands)

    2000-07-01

    The role of multi-step processes in the reactions {sup 116}Sn(d,t), {sup 208}Pb(d,t) and {sup 116}Sn(d,{sup 3}He), previously studied at E{sub d} = 200 MeV at forward angles and for relatively low energy transfers, has been investigated. We have performed for the first time multi-step calculations taking into account systematically collective excitations in the second and higher order step inelastic transitions. A calculation code based on the Feshbach, Kerman and Koonin model has been modified to handle explicitly these collective excitations, most important in the forward angle domain. One step double differential pick-up cross sections were built from finite range distorted wave results spread in energy using known or estimated hole state characteristics. It is shown that two-step cross sections calculated using the above method compare rather well with those deduced via coupled channel calculations for the same collective excitations. The multi-step calculations performed up to 6 steps reproduce reasonably well the {sup 115}Sn, {sup 207}Pb and {sup 115}In experimental spectra measured up to E{sub x}{approx}- 40 MeV and 15 deg. The relative contributions of steps of increasing order to pick-up cross sections at E{sub d} = 200 MeV and 150 MeV are discussed. (authors)

  8. 48 CFR 208.7002 - Assignment authority.

    Science.gov (United States)

    2010-10-01

    ... activities concerned. (b) Under the Integrated Materiel Management Program, assignments are made by the... Secretary of Defense (Logistics); (2) To GSA, through agreement with GSA, by the Deputy Under Secretary of Defense (Logistics); (3) Outside the contiguous United States, by the Unified Commanders; and (4) For...

  9. Publications | Page 208 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The content and materials in this teaching manual grew out of four years of collaborative teaching of a graduate short-course in ecosystem approaches to health ... In Utilization Focused Evaluation (UFE) evaluators facilitate a learning process with attention on how real people in the real world apply evaluation findings and ...

  10. 14 CFR 1274.208 - Intellectual property.

    Science.gov (United States)

    2010-01-01

    ... supplier of an item or service and is not in a position to take unfair advantage of the results of the..., the recipient may assert copyright. Data exchanged with a notice showing that the data is protected by copyright must include appropriate licenses in order for NASA to use the data as needed. (5) Recognizing...

  11. 24 CFR 1710.208 - General information.

    Science.gov (United States)

    2010-04-01

    ... URBAN DEVELOPMENT (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting Requirements... registration has been made by the developer for the sale of lots in the subdivision. (4) If any State listed in paragraph (a)(3) of this section has not permitted a registration to become effective or has suspended the...

  12. GPCR Interaction: 208 [GRIPDB[Archive

    Lifescience Database Archive (English)

    Full Text Available growth hormone releasing hormone (GHRH), and interfaces of SecR C Secretin ... SecR C Growth hormone releasing...releasing hormone ... GHRH Experiment SecR does not interact with CTR (calcitonin receptor). 18401761 BRET,

  13. 50 CFR 223.208 - Corals.

    Science.gov (United States)

    2010-10-01

    ... Removal; Liability for Damage to Natural ResourcesFL Statute § 376.121 FDEP Land and Water Management... Natural and Environmental Resources, or the U.S. Virgin Islands Department of Planning and Natural Resources. The exportation or take must be in compliance with the applicable terms and conditions of the...

  14. 12 CFR 208.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... disbursed; (ii) An office of an affiliated or unaffiliated institution that provides services to customers... checks, or lends money. A branch may include a temporary, seasonal, or mobile facility that meets these... operated by the bank; (iii) An automated teller machine; (iv) A remote service unit; (v) A facility to...

  15. Publications | Page 208 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  16. 30 CFR 208.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... enterprise under the rules of the Small Business Administration (13 CFR part 121). Entitlement means the..., corporation, association, partnership, consortium, or joint venture. Preference eligible refiner means an... applicable mineral leasing law. Secretary means the Secretary of the Department of the Interior or his/her...

  17. PART OF KEFFI SHEET 208 NE

    African Journals Online (AJOL)

    Michael Horsfall

    Nitrate contamination is high in sample L2W, possibility of fertilizer pollution is suspected since it was located at swampy surface area, The analyzed sample was characterized by very low bacterial count compared to nitrate concentration they both have a very low count on the result analyzed, Nitrate concentration varies ...

  18. 208-IJBCS-Article-Dr Bulus Adzu

    African Journals Online (AJOL)

    RHUMSIKI

    prolonged pentobarbital induced hypnosis and decrease the head-dip responses in the exploratory behaviour tests dose ... Hypnotic effect index was recorded .... Neuroscience, 61: 237-243. Cavalier-Smith T. 1981. Eukaryotic kingdoms seven or nine? Biosystems., 14: 461–481. Dweck AC. A review of Zizyphus spina-.

  19. 22 CFR 208.1015 - Suspension.

    Science.gov (United States)

    2010-04-01

    ... this part that immediately prohibits a person from participating in covered transactions and transactions covered under the Federal Acquisition Regulation (48 CFR chapter 1) for a temporary period, pending completion of an agency investigation and any judicial or administrative proceedings that may...

  20. 5 CFR 551.208 - Learned professionals.

    Science.gov (United States)

    2010-01-01

    ... spends a considerable amount of time in extracurricular activities such as coaching athletic teams or... contributing to the educational development of the student. An instructor in an institution of higher education...

  1. 12 CFR 208.83 - Prohibited practices.

    Science.gov (United States)

    2010-01-01

    ...) of the Bank Holding Company Act Amendments of 1970 (12 U.S.C. 1972), is conditional upon either: (1... purchase the insurance product or annuity from another source. (c) Prohibition on domestic violence... product if the status of the applicant or insured as a victim of domestic violence or as a provider of...

  2. 31 CFR 545.208 - Exempt transactions.

    Science.gov (United States)

    2010-07-01

    ... other periodical publications); provision of services to market, produce or co-produce, create, or... articles, such as food, clothing, and medicine, intended to be used to relieve human suffering. ...

  3. SNG-log in borehole Ermelund-208

    DEFF Research Database (Denmark)

    Korsbech, Uffe C C

    1996-01-01

    A Spectral Natural Gamma-ray log has been run in a borehole in Ermelunden. The vertical distribution of Th, U, and K is similar to that observed in neighbouring boreholes. A new measuring and data processing technique was used and the probes own background signal was determined. Surprisingly...

  4. Statistical analysis of the mesospheric inversion layers over two symmetrical tropical sites: Réunion (20.8° S, 55.5° E) and Mauna Loa (19.5° N, 155.6° W)

    Science.gov (United States)

    Bègue, Nelson; Mbatha, Nkanyiso; Bencherif, Hassan; Tato Loua, René; Sivakumar, Venkataraman; Leblanc, Thierry

    2017-11-01

    In this investigation a statistical analysis of the characteristics of mesospheric inversion layers (MILs) over tropical regions is presented. This study involves the analysis of 16 years of lidar observations recorded at Réunion (20.8° S, 55.5° E) and 21 years of lidar observations recorded at Mauna Loa (19.5° N, 155.6° W) together with SABER observations at these two locations. MILs appear in 10 and 9.3 % of the observed temperature profiles recorded by Rayleigh lidar at Réunion and Mauna Loa, respectively. The parameters defining MILs show a semi-annual cycle over the two selected sites with maxima occurring near the equinoxes and minima occurring during the solstices. Over both sites, the maximum mean amplitude is observed in April and October, and this corresponds to a value greater than 35 K. According to lidar observations, the maximum and minimum mean of the base height ranged from 79 to 80.5 km and from 76 to 77.5 km, respectively. The MILs at Réunion appear on average ˜ 1 km thinner and ˜ 1 km lower, with an amplitude of ˜ 2 K higher than Mauna Loa. Generally, the statistical results for these two tropical locations as presented in this investigation are in fairly good agreement with previous studies. When compared to lidar measurements, on average SABER observations show MILs with greater amplitude, thickness and base altitudes of 4 K, 0.75 and 1.1 km, respectively. Taking into account the temperature error by SABER in the mesosphere, it can therefore be concluded that the measurements obtained from lidar and SABER observations are in significant agreement. The frequency spectrum analysis based on the lidar profiles and the 60-day averaged profile from SABER confirms the presence of the semi-annual oscillation where the magnitude maximum is found to coincide with the height range of the temperature inversion zone. This connection between increases in the semi-annual component close to the inversion zone is in agreement with most previously

  5. 49 CFR 571.208 - Standard No. 208; Occupant crash protection.

    Science.gov (United States)

    2010-10-01

    ... severity of injuries, by specifying vehicle crashworthiness requirements in terms of forces and... fixed collision barrier, while moving longitudinally forward at any speed up to and including 30 m.p.h... the seat in any position in which it can be occupied while the vehicle is in motion; or (ii) When the...

  6. Freeze-Out Parameters in Central 158 AGeV $^{208}Pb$ + $^{208}Pb$ Collisions

    CERN Document Server

    Aggarwal, M M; Ahammed, Z; Angelis, Aris L S; Antonenko, V G; Arefev, V; Astakhov, V A; Avdeichikov, V; Awes, T C; Baba, P V K S; Badyal, S K; Baldin, A; Barabuch, L; Barlag, C; Bathe, S; Batyunya, B; Bernier, T; Bhalla, K B; Bhatia, V S; Blume, C; Böck, R K; Bohne, E M; Böröcz, Z K; Bucher, D; Buijs, A; Büsching, H; Carlén, L; Chalyshev, V; Chattopadhyay, S; Cherbachev, R; Chujo, T; Claussen, A; Das, A C; Decowski, M P; Delagrange, H; Dzhordzhadze, V; Dönni, P; Dubovik, I; Dutt, S K; Dutta-Majumdar, M R; El-Chenawi, K F; Eliseev, S; Enosawa, K; Foka, P Y; Fokin, S L; Frolov, V; Ganti, M S; Garpman, S I A; Gavrishchuk, O P; Geurts, F J M; Ghosh, T K; Galow, R; Sen-Gupta, S K; Guskov, B; Gustafsson, Hans Åke; Gutbrod, H H; Higuchi, R; Hrivnacova, I; Ippolitov, M S; Kalechofsky, H; Kamermans, R; Kampert, K H; Karadzhev, K; Karpio, K; Kato, S; Kees, S; Kim, H; Kolb, B W; Kosarev, I G; Kucheryaev, I; Krümpel, T; Kugler, A; Kulinich, P A; Kurata, M; Kurita, K; Kuzmin, N A; Langbein, I; Lebedev, A; Lee, Y Y; Löhner, H; Luquin, Lionel; Mahapatra, D P; Man'ko, V I; Martin, M; Martínez, G; Maksimov, A; Mehdiyev, R; Mgebrishvili, G; Miake, Y; Mikhalev, D; Mir, M F; Mishra, G C; Miyamoto, Y; Morrison, D; Mukhopadhyay, D S; Myalkovskii, V; Naef, H; Nandi, B K; Nayak, S K; Nayak, T K; Neumaier, S; Nyanin, A; Nikitin, V A; Nikolaev, S; Nilsson, P O; Nishimura, S; Nomokonov, V P; Nystrand, J; Obenshain, F E; Oskarsson, A; Otterlund, I; Pachr, M; Parfenov, A; Pavlyuk, S; Peitzmann, Thomas; Petracek, V; Plasil, F; Pinganaud, W; Purschke, M L; Räven, B; Rak, J; Raniwala, R; Raniwala, S; Ramamurthy, V S; Rao, N K; Retière, F; Reygers, K; Roland, G; Rosselet, L; Rufanov, I A; Roy, C; Rubio, J M; Sako, H; Sambyal, S S; Santo, R; Sato, S; Schlagheck, H; Schmidt, H R; Schutz, Y; Shabratova, G; Shah, T H; Sibiryak, K; Siemiarczuk, T; Silvermyr, D; Sinha, B A; Slavin, N V; Solderstrom, K; Solomey, Nickolas; Sørensen, S P; Stankus, P; Stefanek, G; Steinberg, P; Stenlund, E; Stüken, D; Sumbera, M; Svensson, T; Trivedi, M D; Tsvetkov, A A; Tykarski, L; Urbahn, J; Van den Pijll, E C; van Eijndhoven, N; van Nieuwenhuizen, G J; Vinogradov, A; Viyogi, Y P; Vodopyanov, A S; Vörös, S; Wyslouch, B; Yagi, K; Yokota, Y; Young, G R

    1999-01-01

    Neutral pion production in central 158AGeV Pb+Pb collisions has been studied in the WA98 experiment at the CERN SPS. The pi0 transverse mass spectrum has been analyzed in terms of a thermal model with hydrodynamic expansion. The high accuracy and large kinematic coverage of the measurement allow to limit previously noted ambiguities in the extracted freeze-out parameters. The results are shown to be sensitive to the shape of the velocity distribution at freeze-out.

  7. Directed Flow in 158 A GeV $^{208}Pb$ + $^{208}Pb$ Collisions

    CERN Document Server

    Aggarwal, M.M.; Ahammed, Z.; Angelis, A.L.S.; Antonenko, V.; Arefev, V.; Astakhov, V.; Avdeitchikov, V.; Awes, T.C.; Baba, P.V.K.S.; Badyal, S.K.; Baldine, A.; Barabach, L.; Barlag, C.; Bathe, S.; Batiounia, B.; Bernier, T.; Bhalla, K.B.; Bhatia, V.S.; Blume, C.; Bock, R.; Bohne, E.M.; Borocz, Z.; Bucher, D.; Buijs, A.; Busching, H.; Carlen, L.; Chalyshev, V.; Chattopadhyay, S.; Cherbatchev, R.; Chujo, T.; Claussen, A.; Das, A.C.; Decowski, M.P.; Dzhordzhadze, V.; Donni, P.; Doubovik, I.; Dutta Majumdar, M.R.; El Chenawi, K.; Eliseev, S.; Enosawa, K.; Foka, P.; Fokin, S.; Frolov, V.; Ganti, M.S.; Garpman, S.; Gavrishchuk, O.; Geurts, F.J.M.; Ghosh, T.K.; Glasow, R.; Gupta, S.K.; Guskov, B.; Gustafsson, H.A.; Gutbrod, H.H.; Higuchi, R.; Hrivnacova, I.; Ippolitov, M.; Kalechofsky, H.; Kamermans, R.; Kampert, K.H.; Karadzhev, K.; Karpio, K.; Kato, S.; Kees, S.; Kim, H.; Kolb, B.W.; Kosarev, I.; Koutcheryaev, I.; Krumpel, T.; Kugler, A.; Kulinich, P.; Kurata, M.; Kurita, K.; Kuzmin, N.; Langbein, I.; Lebedev, A.; Lee, Y.Y.; Lohner, H.; Luquin, L.; Mahapatra, D.P.; Manko, V.; Martin, M.; Maximov, A.; Mehdiyev, Rashid R.; Mgebrichvili, G.; Miake, Y.; Mikhalev, D.; Mishra, G.C.; Miyamoto, Y.; Morrison, Douglas R.O.; Mukhopadhyay, D.S.; Myalkovsky, V.; Naef, H.; Nandi, B.K.; Nayak, S.K.; Nayak, T.K.; Neumaier, S.; Nianine, A.; Nikitin, V.; Nikolaev, S.; Nilsson, P.; Nishimura, S.; Nomokonov, P.; Nystrand, J.; Obenshain, F.E.; Oskarsson, A.; Otterlund, I.; Pachr, M.; Parfenov, A.; Pavliouk, S.; Peitzmann, T.; Petracek, V.; Plasil, F.; Pinanaud, W.; Purschke, M.L.; Raven, B.; Rak, J.; Raniwala, R.; Raniwala, S.; Ramamurthy, V.S.; Rao, N.K.; Retiere, F.; Reygers, K.; Roland, G.; Rosselet, L.; Roufanov, I.; Roy, C.; Rubio, J.M.; Sako, H.; Sambyal, S.S.; Santo, R.; Sato, S.; Schlagheck, H.; Schmidt, H.R.; Shabratova, G.; Sibiriak, I.; Siemiarczuk, T.; Silvermyr, D.; Sinha, B.C.; Slavin, N.; Soderstrom, K.; Solomey, N.; Sorensen, S.P.; Stankus, P.; Stefanek, G.; Steinberg, P.; Stenlund, E.; Stuken, D.; Sumbera, M.; Svensson, T.; Trivedi, M.D.; Tsvetkov, A.; Twenhofel, C.; Tykarski, L.; Urbahn, J.; Van Eijndhoven, N.; van Nieuwenhuizen, G.J.; Vinogradov, A.; Viyogi, Y.P.; Vodopianov, A.S.; Voros, S.; Wyslouch, B.; Yagi, K.; Yokota, Y.; Young, G.R.

    1998-01-01

    The directed flow of protons and positive pions have been studied in 158 A GeV Pb + Pb collisions. A directed flow analysis of the rapidity dependence of the average transverse momentum projected onto the reaction plane is presented for semi-central collisions with impact parameters of approximately 8 fm, where the flow effect is largest. The magnitude of the directed flow is found to be significantly smaller than observed at AGS energies and than RQMD model predictions.

  8. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  9. Contribution to construction and setup of a detection system for the focal plan of the BBS spectrometer. Application to study of the neutron emission decay of the resonant states populated by the reaction ({sup 4}He,{sup 3}He) at 42 MeV/u in nuclei {sup 208}Pb and {sup 209}Pb; Contribution a la construction et a la mise au point d'un systeme de detection pour le plan focal du spectrometre BBS. Application a l'etude de la decroissance par emission de neutrons d'etats resonants peuples par la reaction ({sup 4}He,{sup 3}He) a 42 MeV/u dans les noyaux {sup 208}Pb et {sup 209}Pb

    Energy Technology Data Exchange (ETDEWEB)

    Plankl-Chabib, Elke [Inst. de Physique Nucleaire, Paris-11 Univ., 91 - Orsay (France)

    1999-06-11

    In order to realizean experimental program dedicated to nuclear structure studies we have conceived and constructed at IPN Orsay a detection system for the focal plane of the magnetic spectrometer BBS, installed at the cryogenic cyclotron AGOR of the laboratory KVI (The Netherlands). Two detection units, consisting each of two localization plans of the Cathode Strip Chamber (CSC) type, measure the position and angle of particle trajectory. This information is used for the determination of the reaction parameters at the target by a backtracking procedure. The identification of the reaction products is done by the measurement of their time-of-flight and energy loss. For light ions this task is assumed by plastic scintillators, and for heavy ions by a parallel plan detector (PPAC) and an ionization chamber. This detection system is well adapted to the requirements given by the detection of a large range of ions (protons to {sup 36}Ar at energies of several tenths of MeV/nucleon) as well as the big acceptance, the small dispersion and the aberration of the BBS. The results of the test show the good performances of the detection system. In a first experiment the focal plane detection system was coupled to the neutron multidetector EVEN in order to study the decay of resonant high spin states at high excitation energies by the ({sup 4}He, {sup 3}He) reaction on {sup 207}Pb and {sup 208}Pb targets. The transfer spectra, inclusive and in coincidence, of the nuclei {sup 208}Pb and {sup 209}Pb show a striking resemblance except for an excitation energy shift which is due to the hole in the last neutron shell of {sup 207}Pb. The resonances at l 8 and l = 9 are clearly populated, in agreement with the predictions of the Bonaccorso-Brink model. A sizeable fraction of the decay of the l = 8 resonance is direct, but at excitation energies higher than 15 MeV (in {sup 208}Pb) the decay is mostly statistical.

  10. RCT: Module 2.08, Radiological Source Control, Course 8774

    Energy Technology Data Exchange (ETDEWEB)

    Hillmer, Kurt T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-08-10

    radioactive source is material used for its emitted radiation. Sources are sealed or unsealed and are classified as accountable or exempt. Radioactive sources are used for response checks, functional checks, and the calibration of instruments and monitors to traceable standards. To ensure the safety and welfare of all personnel, it is important to maintain control of radioactive sources to minimize the potential for the spread of contamination, unnecessary exposure to personnel, loss or theft, and improper disposal. This course will prepare the student with the skills necessary for RCT qualification by passing quizzes, tests, and the RCT Comprehensive Phase 1, Unit 2 Examination (TEST 27566) and will provide in-the-field skills.

  11. 21 CFR 208.1 - Scope and purpose.

    Science.gov (United States)

    2010-04-01

    ... sets forth requirements for patient labeling for human prescription drug products, including biological products, that the Food and Drug Administration (FDA) determines pose a serious and significant public.... (c) Patient labeling will be required if the FDA determines that one or more of the following...

  12. 47 CFR 25.208 - Power flux density limits.

    Science.gov (United States)

    2010-10-01

    ... reference antenna diameter, the limit consists of the complete curve on a plot which is linear in decibels... EPFDdown in decibels and a logarithmic scale for antenna diameter in meters. Note to paragraph (j): These... is linear in decibels for the EPFD levels and logarithmic for the time percentages, with straight...

  13. 19 CFR 201.208 - Tax refund offset.

    Science.gov (United States)

    2010-04-01

    ... Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Debt Collection... States from fees, leases, services, overpayments, civil and criminal penalties, damages, interest, fines..., organization or entity to Treasury for offset if the Commission's or the referring agency's rights of action...

  14. Dicty_cDB: AFK208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6. 1 Translated Amino Acid sequence PTGILFHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTILVNNQVLTL DG...ryeipyslxrtnxrtxsysrigik--- Frame C: PTGILFHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTILVNNQVLTL DG

  15. Dicty_cDB: SFL208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Arabidopsis thaliana unknown prote... 89 3e-16 FJ422582_1( FJ422582 |pid:none) Arabidopsis thaliana ABAP...1 (ABAP1)... 89 3e-16 DQ507278_1( DQ507278 |pid:none) Drosophila melanogaster roadk

  16. All projects related to | Page 208 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Known for its dense human population, diverse wild animal species, and large population of domestic animals, Sri Lanka derives both risks and benefits from its wildlife. Topic: Disease control, PUBLIC HEALTH, ANIMAL HEALTH, ANIMAL PROTECTION, RESEARCH NETWORKS, INTERDISCIPLINARY RESEARCH, ...

  17. Electromagnetic Dissociation of Target Nuclei by $^{208}$Pb Projectiles

    CERN Multimedia

    Petridis, A; Wohn, F K

    2002-01-01

    % NA53 \\\\ \\\\ The purpose of this experiment is to study the process of electromagnetic dissociation (ED) that occurs at impact parameters large enough so that there is no nuclear interaction. In these cases strong electromagnetic fields are produced for a short time at the nucleus. For large charges and ultrarelativistic energies, the intense electromagnetic pulse produces cross-sections much larger than the total hadronic cross-section. These effects place significant constraints on the storage times of the heavy ion beams planned for RHIC and LHC.\\\\ \\\\In this experiment we measure the cross-sections for the one- and two-neutron removal processes resulting from the interaction of 160 and 40~GeV/nucleon Pb beams on Au and Co targets. Thin Au targets were bombarded in the beam line of the NA50 experiment. Gamma rays from the residual nuclides produced in the bombardment were measured to determine the saturation activities of $^{196}$Au and $^{195}$Au resulting from ED of the Au target. This along with cross-se...

  18. 44 CFR 206.208 - Direct Federal assistance.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER ASSISTANCE Public Assistance Project... contained in Subpart H of these regulations. FEMA will reimburse other Federal agencies in accordance with... from such work; (iii) Provide reimbursement to FEMA for the nonFederal share of the cost of such work...

  19. 19 CFR 351.208 - Suspension of investigation.

    Science.gov (United States)

    2010-04-01

    ...) Opportunity for comment. The Secretary will provide all interested parties, an industrial user of the subject...), section 734(c), or section 734(l) of the Act (agreements to eliminate injurious effects or to restrict the... determinations in an investigation that has been continued, the suspension agreement will remain in effect in...

  20. Dicty_cDB: SSM208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore E Sequences producing significant alignments: (bits) Value N CF211492 |CF211492.1 CAB20007_Ia_Ra_H10 Cab...ernet Sauvignon Flower bloom - CAB2 Vitis vinifera cDNA clone CAB20007_Ia_Ra_H10 3', mRNA sequence. 64 1e-15

  1. Southern Forests: a Journal of Forest Science - Vol 208 (2006)

    African Journals Online (AJOL)

    In vitro shoot multiplication and rooting from seedling explants of Pterocarpus angolensis in Zambia · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Exildah Chisha-Kasumu, Adam H Price, Steve Woodward, 31-37 ...

  2. 44 CFR 208.12 - Maximum Pay Rate Table.

    Science.gov (United States)

    2010-10-01

    ... Force Physicians, Task Force Engineers, and Canine Handlers) and Backfill for Activated System Members... grade, middle step for each position, which demonstrates an experience level of five years. (2) The... parity with like specialties on a task force (canine handlers are equated with rescue specialists). The...

  3. 21 CFR 211.208 - Drug product salvaging.

    Science.gov (United States)

    2010-04-01

    ... (including animal feeding studies where applicable) that the drug products meet all applicable standards of identity, strength, quality, and purity and (b) evidence from inspection of the premises that the drug... that the drug products meet appropriate standards of identity, strength, quality, and purity. Records...

  4. 24 CFR 570.208 - Criteria for national objectives.

    Science.gov (United States)

    2010-04-01

    ... requirements of this section, HUD will assume that the distribution of income among the callers generally... determines that the survey was conducted in such a manner that the results meet standards of statistical... recently available decennial census information; (B) It does not include any portion of a central business...

  5. Page 1 208 W. SIVARAMAKRISHNAN the high pressure mercury ...

    Indian Academy of Sciences (India)

    amplifier was adjusted for maximum response at 100 cycles by the two filters. F, and F, which were high pass and Twin-T network filters respectively. The amplification was controlled by means of three variable controls and extensive screening was done in the earlier stages to avoid the interference and spurious pick-ups.

  6. 7 CFR 1160.208 - Powers of the Board.

    Science.gov (United States)

    2010-01-01

    ... plans or projects to educate consumers and promote the use of fluid milk products and to make...; the Board may establish working committees of persons other than Board members; (h) To recommend to...

  7. Zvaigžņotā Debess: 2010, Vasara (208)

    OpenAIRE

    Adgere, Kristīne; Latvijas Universitāte. Astronomijas institūts; Latvijas Zinātņu akadēmija

    2010-01-01

    Contents: N.Cimahoviča. Sun’s Researcher in the Far East ; A.Balklavs. A New Hypothesis on Formation of Galaxies ; A.Balklavs. Gravitation and Peculiar Galaxies ; A.Barzdis. First Population Stars and Galaxies ; Z.Alksne, A.Alksnis. Does Giant Planet Orbit Dwarf Star? ; A.Alksnis, Z.Alksne. Epsilon Aurigae Eclipsed by Dark Dust Disk ; M.Ābele, K.Adgere, E.Grabs, L.Osipova, E.Rutkovska, J.Vjaters, V.Veckalns. Latvian Students Take Part in the Project European Student Moon Orbiter ; Announceme...

  8. Dicty_cDB: CHQ208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 139 8e-95 9 AY954892 |AY954892.1 Cryptosporidium andersoni strain HenanZhzhca heat shock protein 70 gene...123 2e-86 8 DQ060426 |DQ060426.1 Cryptosporidium andersoni strain zzca heat shock protein 70-like gene,...121 3e-84 7 AY954894 |AY954894.1 Cryptosporidium andersoni strain bjcm heat shock protein 70 gene, partial...117 5e-84 8 AY954893 |AY954893.1 Cryptosporidium andersoni strain changchunca heat shock protein 70 gene

  9. Dicty_cDB: VSG208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lpnvtnvtnqvtspklaqktnpkikfen*LFSYHHNHSIRDMMNFCFCFCIKT--- ---RRLYNSREEFNKMSEIKEKSCYKCKEVGHISRNCPKNPEAGDRACYVCNVVGHLSRE ...cfvsv*kqlvnl nxivfiniphqnlxlkikk Frame B: xrlynsreefnkmseikekscykckevghisrncpknpeagdracyvcnvvghlsrecpq...akcykcnqpghiakacpenqsen*i*kliifiss*sfntrydeflflflykn--- ---RRLYNSREEFNKMSEIKEKSCYKCKEVGHISRNCPKNPEAGDRACYVCNVVGHLSRE

  10. Publications | Page 208 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Mahafaly (restricted access). Le projet ACCA Madagascar vise à améliorer la capacité des paysans à s''adapter aux changements climatiques de façon bénéfique pour les plus vulnérables. Le sud-ouest malgache qui possède un climat semi-aride est une zone réputée pour l''élevage des ruminants : bovin, caprin et ovin.

  11. 24 CFR 3280.208 - Smoke alarm requirements.

    Science.gov (United States)

    2010-04-01

    ... of 177 candela, except that when the visible notification appliance is wall-mounted or suspended more than 24 inches below the ceiling, a minimum rating of 110 candela is permitted. (3) A visible... candela. (f) Testing and maintenance. (1) Each required smoke alarm installed at the factory must be...

  12. 8 CFR 208.4 - Filing the application.

    Science.gov (United States)

    2010-01-01

    ... application, the loss of the spousal or parent-child relationship to the principal applicant through marriage... illness or mental or physical disability, including any effects of persecution or violent harm suffered in...

  13. 48 CFR 217.208-70 - Additional clauses.

    Science.gov (United States)

    2010-10-01

    ... stocks, or acquisitions made under DoD cooperative logistics support arrangements. (b) When a surge... represents in paragraph (a) of the clause to ensure adequate quantities are available to meet item...

  14. 12 CFR 208.1 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ..., 248(a), 248(c), 481-486, 601 and 611); sections 1814, 1816, 1818, 1831o, 1831p-1, 1831r-1 and 1835a of the Federal Deposit Insurance Act (FDI Act) (12 U.S.C. 1814, 1816, 1818, 1831o, 1831p-1, 1831r-1, and... banks organized under local laws, located in a dependency or insular possession or any part of the...

  15. 208 External Degree Programme Graduates' Perception of Students ...

    African Journals Online (AJOL)

    Nekky Umera

    1988-03-02

    Mar 2, 1988 ... Interest in establishing external degree courses however, did not die. ... the FES began to experience financial constraints which impacted negatively .... in the BEd course. The conceptualized relationship between the two personal characteristics and graduates' perception of the support services is shown ...

  16. Dicty_cDB: AHB208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AW622039 |AW622039.1 EST312837 tomato root during/after fruit set, Cornell University Lycopersicon esculentum...AW455290 |AW455290.1 EST311828 tomato root during/after fruit set, Cornell University Lycopersicon esculentum

  17. 48 CFR 208.7003-2 - Assignments under coordinated acquisition.

    Science.gov (United States)

    2010-10-01

    ... reliability of nuclear weapons. (1) This exception applies to all items designed for and peculiar to nuclear... development funds are used. (g) Items peculiar to nuclear ordnance material where design characteristics or... controlled by DoE or DoD. (2) This exception does not cover items used for both nuclear ordnance and other...

  18. 12 CFR 208.84 - What you must disclose.

    Science.gov (United States)

    2010-01-01

    ... mail within 3 business days beginning on the first business day after the sale, excluding Sundays and..., provided you mail it to the consumer within three days beginning the first business day after the... Signatures in Global and National Commerce Act (12 U.S.C. 7001(c)), you may provide the written disclosures...

  19. Dicty_cDB: CFJ208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available GPV IIAFIVIGIVFIPIGAAIINSSNKVLEHVIRYDDNPNCQLGQKCTINYTLPTEMESPVYL YYKLDNFYQNHRRYVKSRNDDQLRGIEVTDFSKLK...n*ngitslf vl*ig*llskps*ickikk**st*ry*snrfq*ikgl*tinyn*wf*rc**dfssmwfnc k*cf**fnfisrcfr*fnkfnqkrycmai...GPV IIAFIVIGIVFIPIGAAIINSSNKVLEHVIRYDDNPNCQLGQKCTINYTLPTEMESPVYL YYKLDNFYQNHRRYVKSRNDDQLRGIEVTDFSKLK

  20. Dicty_cDB: SFB208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EPISSNPFLQPPKKQRTASTGFNNNNGNNNNNNNLS TPLTIH*vfysr**yeyfivliithinfsffspkiys*scpxlxp Translated Amino Acid seq...SSNPFLQPPKKQRTASTGFNNNNGNNNNNNNLS TPLTIH*vfysr**yeyfivliithinfsffspkiys*scpxlxp Frame B: *lqiyl*iikdhyllvi*v

  1. 40 CFR 59.208 - Charcoal lighter material testing protocol.

    Science.gov (United States)

    2010-07-01

    ... velocity traverse ports. (iii) Fan—25-centimeter (10-inch) diameter axial fan (duct fan) capable of... rheostat for controlling voltage to the fan. (3) Test equipment and materials. The following test equipment... monoxide, carbon dioxide, methane, and non-methane organic carbon are analyzed by the TCA and TCA/Flame...

  2. Scaling of Particle and Transverse Energy Production in 208Pb+208Pb collisions at 158 A GeV

    CERN Document Server

    Aggarwal, M M; Ahammed, Z; Angelis, Aris L S; Antonenko, V G; Arefev, V; Astakhov, V A; Avdeichikov, V; Awes, T C; Baba, P V K S; Badyal, S K; Baldin, A; Barabash, L; Barlag, C; Bathe, S; Batyunya, B; Bernier, T; Bhalla, K B; Bhatia, V S; Blume, C; Bohne, E M; Böröcz, Z K; Bucher, D; Buijs, A; Büsching, H; Carlén, L; Chalyshev, V; Chattopadhyay, S; Cherbachev, R; Chujo, T; Claussen, A; Das, A C; Decowski, M P; Delagrange, H; Dzhordzhadze, V; Dönni, P; Dubovik, I; Dutt, S K; Dutta-Majumdar, M R; El-Chenawi, K F; Eliseev, S; Enosawa, K; Foka, P Y; Fokin, S L; Frolov, V; Ganti, M S; Garpman, S I A; Gavrishchuk, O P; Geurts, F J M; Ghosh, T K; Glasow, R; Sen-Gupta, S K; Guskov, B; Gustafsson, Hans Åke; Gutbrod, H H; Higuchi, R; Hrivnacova, I; Ippolitov, M S; Kalechofsky, H; Kamermans, R; Kampert, K H; Karadzhev, K; Karpio, K; Kato, S; Kees, S; Kim, H; Kolb, B W; Kosarev, I G; Kucheryaev, I; Krümpel, T; Kugler, A; Kulinich, P A; Kurata, M; Kurita, K; Kuzmin, N A; Langbein, I; Lebedev, A; Lee, Y Y; Löhner, H; Luquin, Lionel; Mahapatra, D P; Man'ko, V I; Martin, M; Martínez, G; Maksimov, A; Mehdiyev, R; Mgebrishvili, G; Miake, Y; Mikhalev, D; Mir, M F; Mishra, G C; Miyamoto, Y; Mohanty, B; Mora, M J; Morrison, D; Mukhopadhyay, D S; Myalkovskii, V; Naef, H; Nandi, B K; Nayak, S K; Nayak, T K; Neumaier, S; Nyanin, A; Nikitin, V A; Nikolaev, S; Nilsson, P O; Nishimura, S; Nomokonov, V P; Nystrand, J; Obenshain, F E; Oskarsson, A; Otterlund, I; Pachr, M; Parfenov, A; Pavlyuk, S; Peitzmann, Thomas; Petracek, V; Plasil, F; Pinganaud, W; Purschke, M L; Räven, B; Rak, J; Raniwala, R; Raniwala, S; Ramamurthy, V S; Rao, N K; Retière, F; Reygers, K; Roland, G; Rosselet, L; Rufanov, I A; Roy, C; Rubio, J M; Sako, H; Sambyal, S S; Santo, R; Sato, S; Schlagheck, H; Schmidt, H R; Schutz, Y; Shabratova, G; Shah, T H; Sibiryak, Yu; Siemiarczuk, T; Silvermyr, D; Sinha, B C; Slavin, N V; Söderström, K; Solomey, Nickolas; Sørensen, S P; Stankus, P; Stefanek, G; Steinberg, P; Stenlund, E; Stüken, D; Sumbera, M; Svensson, T; Trivedi, M D; Tsvetkov, A A; Tykarski, L; Urbahn, J; Van den Pijll, E C; van Eijndhoven, N; van Nieuwenhuizen, G J; Vinogradov, A; Viyogi, Y P; Vodopyanov, A S; Vörös, S; Wyslouch, B; Yagi, K; Yokota, Y; Young, G R

    2001-01-01

    Transverse energy, charged particle, and photon pseudorapidity distributions have been studied as a function of the number of participants (N_{part}) and the number of binary nucleon-nucleon collisions (N_{coll}) in 158 A GeV Pb+Pb collisions over a wide impact parameter range. A scaling of the transverse energy and charged particle pseudorapidity density at midrapidity as N_{part}^{1.08} and N_{coll}^{0.83} is observed. This faster than linear scaling with N_{part} indicates a violation of the naive Wounded Nucleon Model.

  3. Centrality Dependence of Neutral Pion Production in 158 A GeV $^{208}Pb +^{208}Pb$ Collisions

    CERN Document Server

    Aggarwal, M.M.; Ahammed, Z.; Angelis, A.L.S.; Antonenko, V.; Arefiev, V.; Astakhov, V.; Avdeitchikov, V.; Awes, T.C.; Baba, P.V.K.S.; Badyal, S.K.; Baldine, A.; Barabach, L.; Barlag, C.; Bathe, S.; Batiounia, B.; Bernier, T.; Bhalla, K.B.; Bhatia, V.S.; Blume, C.; Bock, R.; Bohne, E.-M.; Borocz, Z.K.; Bucher, D.; Buijs, A.; Busching, H.; Carlen, L.; Chalyshev, V.; Chattopadhyay, S.; Cherbatchev, R.; Chujo, T.; Claussen, A.; Das, A.C.; Decowski, M.P.; Djordjadze, V.; Donni, P.; Doubovik, I.; Dutta Majumdar, M.R.; El Chenawi, K.; Eliseev, S.; Enosawa, K.; Foka, P.; Fokin, S.; Frolov, V.; Ganti, M.S.; Garpman, S.; Gavrishchuk, O.; Geurts, F.J.M.; Ghosh, T.K.; Glasow, R.; Gupta, S.K.; Guskov, B.; Gustafsson, H.A.; Gutbrod, H.H.; Higuchi, R.; Hrivnacova, I.; Ippolitov, M.; Kalechofsky, H.; Kamermans, R.; Kampert, K.-H.; Karadjev, K.; Karpio, K.; Kato, S.; Kees, S.; Kim, H.; Kolb, B.W.; Kosarev, I.; Koutcheryaev, I.; Krumpel, T.; Kugler, A.; Kulinich, P.; Kurata, M.; Kurita, K.; Kuzmin, N.; Langbein, I.; Lebedev, A.; Lee, Y.Y.; Lohner, H.; Luquin, L.; Mahapatra, D.P.; Manko, V.; Martin, M.; Maximov, A.; Mehdiyev, R.; Mgebrichvili, G.; Miake, Y.; Mikhalev, D.; Mishra, G.C.; Miyamoto, Y.; Morrison, D.; Mukhopadhyay, D.S.; Myalkovski, V.; Naef, H.; Nandi, B.K.; Nayak, S.K.; Nayak, T.K.; Neumaier, S.; Nianine, A.; Nikitine, V.; Nikolaev, S.; Nilsson, P.; Nishimura, S.; Nomokonov, P.; Nystrand, J.; Obenshain, F.E.; Oskarsson, A.; Otterlund, I.; Pachr, M.; Parfenov, A.; Pavliouk, S.; Pietzmann, T.; Patracek, V.; Pinanaud, W.; Plasil, F.; Purschke, M.L.; Raeven, B.; Rak, J.; Raniwala, R.; Raniwala, S.; Ramamurthy, V.S.; Rao, N.K.; Retiere, F.; Reygers, K.; Roland, G.; Rosselet, L.; Roufanov, I.; Roy, C.; Rubio, J.M.; Sako, H.; Sambyal, S.S.; Santo, R.; Sato, S.; Schlagheck, H.; Schmidt, H.-R.; Shabratova, G.; Sibiriak, I.; Siemiarczuk, T.; Silvermyr, D.; Sinha, B.C.; Slavine, N.; Soderstrom, K.; Solomey, N.; Sorensen, S.P.; Stankus, P.; Stefanek, G.; Steinberg, P.; Stenlund, E.; Stuken, D.; Sumbera, M.; Svensson, T.; Trivedi, M.D.; Tsvetkov, A.; Twenhofel, C.; Tykarski, L.; Urbahn, J.; Eijndhoven, N.v.; Nieuwenhuizen, G.J.v.; Vinogradov, A.; Viyogi, Y.P.; Vodopianov, A.; Voros, S.; Wyslouch, B.; Yagi, K.; Yokota, Y.; Young, G.R.

    1998-01-01

    The production of neutral pions in 158AGeV Pb+Pb collisions has been studied in the WA98 experiment at the CERN SPS. Transverse momentum spectra are studied for the range 0.3 GeV/c < mT-m0 < 4.0 GeV/c. The results for central collisions are compared to various models. The centrality dependence of the neutral pion spectral shape and yield is investigated. An invariance of the spectral shape and a simple scaling of the yield with the number of participating nucleons is observed for centralities with greater than about 30 participating nucleons which is most naturally explained by assuming an equilibrated system.

  4. Interferometry of direct photons in central $^{208}$Pb+$^{208}$Pb collisions at 158A GeV

    CERN Document Server

    Aggarwal, M M; Angelis, A L S; Antonenko, V G; Arefev, V; Astakhov, V A; Avdeichikov, V; Awes, T C; Baba, P V K S; Badyal, S K; Bathe, S; Batyunya, B; Bernier, T; Bhalla, K B; Bhatia, V S; Blume, C; Bucher, D; Büsching, H; Carlén, L; Chattopadhyay, S; Decowski, M P; Delagrange, H; Dönni, P; Majumdar, M R D; Chenawi, K E; Dubey, A K; Enosawa, K; Fokin, S; Frolov, V; Ganti, M S; Garpman, S; Gavrishchuk, O P; Geurts, F J M; Ghosh, T K; Glasow, R; Guskov, B; Gustafsson, Hans Åke; Gutbrod, H H; Hrivnacova, I; Ippolitov, M S; Kalechofsky, H; Karadzhev, K; Karpio, K; Kolb, B W; Kosarev, I G; Kucheryaev, I; Kugler, A; Kulinich, P; Kurata, M; Lebedev, A; Löhner, H; Luquin, Lionel; Mahapatra, D P; Man'ko, V; Martin, M; Martínez, G; Maksimov, A; Miake, Y; Mishra, G C; Mohanty, B G; Mora, M J; Morrison, Douglas Robert Ogston; Moukhanova, T; Mukhopadhyay, D S; Naef, H; Nandi, B K; Nayak, S K; Nayak, T K; Nyanin, A; Nikitin, V; Nikolaev, S; Nilsson, P; Nishimura, S; Nomokonov, V P; Nystrand, J; Oskarsson, A; Otterlund, I; Peitzmann, T; Peressounko, D Yu; Petracek, V; Phatak, S C; Pinganaud, W; Plasil, F; Purschke, M L; Rak, J; Raniwala, R; Raniwala, S; Rao, N K; Retière, F; Reygers, K; Roland, G; Rosselet, L; Rufanov, I A; Roy, C; Rubio, J M; Sambyal, S S; Santo, R; Sato, S; Schlagheck, H; Schmidt, H R; Schutz, Y; Shabratova, G; Shah, T H; Sibiryak, Yu; Siemiarczuk, T; Silvermyr, D; Sinha, B C; Slavin, N V; Söderström, K; Sood, G; Srensen, S P; Stankus, P; Stefanek, G; Steinberg, P; Stenlund, E; Sumbera, M; Svensson, T; Tsvetkov, A A; Tykarski, L; Van den Pijll, E C; van Eijndhoven, N; van Nieuwenhuizen, G J; Vinogradov, A; Viyogi, Y P; Vodopyanov, A S; Vörös, S; Wyslouch, B; Young, G R

    2004-01-01

    Two-particle correlations of direct photons were measured in central /sup 208208/Pb+Pb collisions at 158A GeV. The invariant interferometric radii were extracted for 100

  5. Statistical analysis of the mesospheric inversion layers over two symmetrical tropical sites: Réunion (20.8° S, 55.5° E and Mauna Loa (19.5° N, 155.6° W

    Directory of Open Access Journals (Sweden)

    N. Bègue

    2017-11-01

    Full Text Available In this investigation a statistical analysis of the characteristics of mesospheric inversion layers (MILs over tropical regions is presented. This study involves the analysis of 16 years of lidar observations recorded at Réunion (20.8° S, 55.5° E and 21 years of lidar observations recorded at Mauna Loa (19.5° N, 155.6° W together with SABER observations at these two locations. MILs appear in 10 and 9.3 % of the observed temperature profiles recorded by Rayleigh lidar at Réunion and Mauna Loa, respectively. The parameters defining MILs show a semi-annual cycle over the two selected sites with maxima occurring near the equinoxes and minima occurring during the solstices. Over both sites, the maximum mean amplitude is observed in April and October, and this corresponds to a value greater than 35 K. According to lidar observations, the maximum and minimum mean of the base height ranged from 79 to 80.5 km and from 76 to 77.5 km, respectively. The MILs at Réunion appear on average ∼ 1 km thinner and ∼ 1 km lower, with an amplitude of ∼ 2 K higher than Mauna Loa. Generally, the statistical results for these two tropical locations as presented in this investigation are in fairly good agreement with previous studies. When compared to lidar measurements, on average SABER observations show MILs with greater amplitude, thickness and base altitudes of 4 K, 0.75 and 1.1 km, respectively. Taking into account the temperature error by SABER in the mesosphere, it can therefore be concluded that the measurements obtained from lidar and SABER observations are in significant agreement. The frequency spectrum analysis based on the lidar profiles and the 60-day averaged profile from SABER confirms the presence of the semi-annual oscillation where the magnitude maximum is found to coincide with the height range of the temperature inversion zone. This connection between increases in the semi-annual component close to the

  6. 22 CFR 208.860 - What factors may influence the debarring official's decision?

    Science.gov (United States)

    2010-04-01

    ... wrongdoing. (c) Whether there is a pattern or prior history of wrongdoing. For example, if you have been... that you have a pattern or prior history of wrongdoing. (d) Whether you are or have been excluded or... corrective action or remedial measures, such as establishing ethics training and implementing programs to...

  7. 45 CFR 680.20 - Exemptions under 18 U.S.C. 208(b).

    Science.gov (United States)

    2010-10-01

    ... financial interests are too inconsequential to affect the integrity of an employee's services to the..., such as a mutual fund, that owns a financial interest in a second institution. If the owning institution's financial interest consists of securities or other evidences of debt of the second institution...

  8. 33 CFR 208.22 - Twin Buttes Dam and Reservoir, Middle and South Concho Rivers, Tex.

    Science.gov (United States)

    2010-07-01

    ...) Whenever the Twin Buttes Reservoir level is between elevations 1,940.2 (top of conservation pool) and... Angelo, Tex. (river mile 60.9); or a 22.8-foot stage (25,000 c.f.s.) on the USGS gage near Paint Rock...

  9. Lun Afr J Tradit Complement Altern Med. (2014) 11(1):205-208

    African Journals Online (AJOL)

    cadewumi

    depressive degree is closely related to the factors such as whether the personality is introverted, whether the physical constitution is weak. Clinically, depression is treated by soothing-liver, regulating qi, and relieving liver depression in TCM, accompanied by therapies such as heart and spleen invigoration, liver and kidney ...

  10. 12 CFR 208.82 - Definitions for purposes of this subpart.

    Science.gov (United States)

    2010-01-01

    ... SYSTEM MEMBERSHIP OF STATE BANKING INSTITUTIONS IN THE FEDERAL RESERVE SYSTEM (REGULATION H) Consumer...)(10)). (d) Consumer means an individual who purchases, applies to purchase, or is solicited to... attempt to control the behavior of another person. (g) Electronic media includes any means for...

  11. 42 CFR 412.208 - Puerto Rico rates for Federal fiscal year 1988.

    Science.gov (United States)

    2010-10-01

    ... medical education costs; (3) Adjusting for area variations in hospital wage levels; and (4) Excluding an... weighting factor determined under § 412.60(b) for that DRG. (i) Adjusting for different area wage levels... paragraph (h) of this section that are attributable to wages and labor-related costs, for area differences...

  12. 23 CFR 973.208 - Indian lands pavement management system (PMS).

    Science.gov (United States)

    2010-04-01

    ... PMS shall be designed to fit the BIA's or tribes' goals, policies, criteria, and needs using the..., rehabilitation, and preventive maintenance. If some of the inventory or historic data is difficult to establish... including volumes and vehicle classification (as appropriate); and (v) Data for estimating the costs of...

  13. 23 CFR 971.208 - Federal lands pavement management system (PMS).

    Science.gov (United States)

    2010-04-01

    ... shall be designed to fit the FH program goals, policies, criteria, and needs using the following... preventive maintenance. If some of the inventory or historic data is difficult to establish, it may be... vehicle classification (as appropriate); and (v) Data for estimating the costs of actions. (2) A system...

  14. 23 CFR 972.208 - Federal lands pavement management system (PMS).

    Science.gov (United States)

    2010-04-01

    ... designed to fit the FWS goals, policies, criteria, and needs using the following components, at a minimum... maintenance. If some of the inventory or historic data are difficult to establish, it may be collected when..., rutting, and surface friction (as appropriate); (iv) Traffic information including volumes and vehicle...

  15. 23 CFR 970.208 - Federal lands pavement management system (PMS).

    Science.gov (United States)

    2010-04-01

    ..., surface type, or other criteria the NPS deems appropriate. (c) The PMS shall be designed to fit the NPS... construction, reconstruction, rehabilitation, and preventive maintenance. If some of the inventory or historic... appropriate); (iv) Traffic information including volumes and vehicle classification (as appropriate); and (v...

  16. 48 CFR 15.208 - Submission, modification, revision, and withdrawal of proposals.

    Science.gov (United States)

    2010-10-01

    ..., electronic commerce, or facsimile). If no time is specified in the solicitation, the time for receipt is 4:30... not unduly delay the acquisition; and— (i) If it was transmitted through an electronic commerce method...

  17. 33 CFR 208.10 - Local flood protection works; maintenance and operation of structures and facilities.

    Science.gov (United States)

    2010-07-01

    ... object which might prevent closure of the gate shall be removed. Automatic gates shall be closely... covered with paint; (iii) All movable parts are in satisfactory working order; (iv) Proper closure can be... machines, fuel for gasoline or diesel powered equipment, and flash lights or lanterns for emergency...

  18. 44 CFR 208.2 - Definitions of terms used in this part.

    Science.gov (United States)

    2010-10-01

    ... performance of the contemplated activity. Daily Cost Estimate means a Sponsoring Agency's estimate of Task..., volcanic eruption, landslide, mudslide, snowstorm, or drought), or regardless of cause, any fire, flood, or... sufficient severity and magnitude to warrant major disaster assistance under the Stafford Act to supplement...

  19. Tank 241-AP-105, cores 208, 209 and 210, analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Nuzum, J.L.

    1997-10-24

    This document is the final laboratory report for Tank 241-AP-105. Push mode core segments were removed from Risers 24 and 28 between July 2, 1997, and July 14, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-AP-105 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997) and Tank Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT), differential scanning calorimetry (DSC) analysis, or total organic carbon (TOC) analysis exceeded the notification limits as stated in TSAP and DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report. Appearance and Sample Handling Two cores, each consisting of four segments, were expected from Tank 241-AP-105. Three cores were sampled, and complete cores were not obtained. TSAP states core samples should be transported to the laboratory within three calendar days from the time each segment is removed from the tank. This requirement was not met for all cores. Attachment 1 illustrates subsamples generated in the laboratory for analysis and identifies their sources. This reference also relates tank farm identification numbers to their corresponding 222-S Laboratory sample numbers.

  20. Page 1 208 N. Krishna Rao R O M ORE MULTI SAGE CRUSHING 6 ...

    Indian Academy of Sciences (India)

    zinnwaldite mica (11%) and topaz (9%) were the major minerals in the ore, Ore minerals identified, besides wolframite are, pyrrhotite, pyrite, chalcopyrite, ilmenite, magnetite, hematite, cassiterite, bismuthinite and native bismuth. Minor fluorite and trace monazite and zircon are also present. A trimodal grain size distribution ...

  1. Yeast Interacting Proteins Database: YGL115W, YGL208W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available nine protein kinase complex involved in the response to glucose starvation; null mutants exhibit accelerated...serine/threonine protein kinase complex involved in the response to glucose starvation; null mutants exhibit accelerated

  2. 8 CFR 208.18 - Implementation of the Convention Against Torture.

    Science.gov (United States)

    2010-01-01

    ... Service has made a final administrative determination about the applicability of Article 3 of the... create a private right of action or to authorize the consideration or issuance of administrative or... the definition of torture contained in Article 1 of the Convention Against Torture, subject to the...

  3. FCJ-208 This Machine Could Bite: On the Role of Non-Benign Art Robots

    Directory of Open Access Journals (Sweden)

    Paul Granjon

    2016-12-01

    Full Text Available The social robot's current and anticipated roles as butler, teacher, receptionist or carer for the elderly share a fundamental anthropocentric bias: they are designed to be benign, to facilitate a transaction that aims to be both useful to and simple for the human. At a time when intelligent machines are becoming a tangible prospect, such a bias does not leave much room for exploring and understanding the ongoing changes affecting the relation between humans and our technological environment. Can art robots – robots invented by artists – offer a non-benign-by-default perspective that opens the field for a machine to express its machinic potential beyond the limits imposed by an anthropocentric and market-driven approach? The paper addresses these questions by considering and contextualising early cybernetic machines, current developments in social robotics, and art robots by the author and other artists.

  4. Yeast Interacting Proteins Database: YLR208W, YDL195W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available complex (Sar1p, Sec13p, Sec16p, Sec23p, Sec24p, Sec31p, Sfb2p, and Sfb3p) which is important for the format...clear pore sub-complex and of the COPII complex (Sar1p, Sec13p, Sec16p, Sec23p, Sec24p, Sec31p, Sfb2p, and Sfb3p) which is important

  5. Lun Afr J Tradit Complement Altern Med. (2014) 11(1):205-208

    African Journals Online (AJOL)

    cadewumi

    Background: Danzhi Xiaoyao Powder is used for regulating qi and blood, soothing liver-qi stagnation and adjusting the function of internal organs in the clinical. The objective of this paper ... container 30 cm in diameter and 20 cm in height with bottom divided into 19 equal sections. The walking routes and the number of ...

  6. 12 CFR 208.40 - Authority, purpose, scope, other supervisory authority, and disclosure of capital categories.

    Science.gov (United States)

    2010-01-01

    ... section 38 (section 38) of the FDI Act as added by section 131 of the Federal Deposit Insurance... determining the supervisory actions authorized under section 38 of the FDI Act. (Section 38 of the FDI Act... FDI Act and this subpart may be taken independently of, in conjunction with, or in addition to any...

  7. 40 CFR 141.208 - Special notice for exceedance of the SMCL for fluoride.

    Science.gov (United States)

    2010-07-01

    ... water and a cosmetic dental problem that might affect children under nine years of age. At low levels... (mg/l) of fluoride may develop cosmetic discoloration of their permanent teeth (dental fluorosis). The... because of this cosmetic dental problem. For more information, please call of at . Some home water...

  8. Gene expression studies in cells from primary ciliary dyskinesia patients identify 208 potential ciliary genes

    NARCIS (Netherlands)

    Geremek, Maciej; Bruinenberg, Marcel; Zietkiewicz, Ewa; Pogorzelski, Andrzej; Wijmenga, Cisca; Witt, Michal

    Cilia are small cellular projections that either act as sensors (primary cilia) or propel fluid over the epithelia of various organs (motile cilia). The organellum has gained much attention lately because of its involvement in a group of human diseases called ciliopathies. Primary ciliary dyskinesia

  9. 22 CFR 208.215 - Which nonprocurement transactions are not covered transactions?

    Science.gov (United States)

    2010-04-01

    ... individual's present responsibility (but benefits received in an individual's business capacity are not excepted). For example, if a person receives social security benefits under the Supplemental Security Income provisions of the Social Security Act, 42 U.S.C. 1301 et seq., those benefits are not covered...

  10. 24 CFR 1003.208 - Criteria for compliance with the primary objective.

    Science.gov (United States)

    2010-04-01

    ... census tract (or block numbering area) which meets the Federal Empowerment Zone or Enterprise Community... experience or education beyond high school are not a prerequisite to fill such jobs, or the business agrees...

  11. 34 CFR 682.208 - Due diligence in servicing a loan.

    Science.gov (United States)

    2010-07-01

    ... by, or on behalf of, the borrower, or discharged by reason of the borrower's death, bankruptcy, or... accepting payments; and (vii) The date on which the new loan servicer will begin accepting payments. (2) If...

  12. 5 CFR 792.208 - What is the definition of executive agency?

    Science.gov (United States)

    2010-01-01

    ... SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES' HEALTH AND COUNSELING PROGRAMS Agency Use of Appropriated Funds for Child Care Costs for Lower Income Employees-What Is the Child Care Subsidy Program... Accounting Office. ...

  13. : tous les projets | Page 208 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: TAXATION, CONSUMER DEMAND, Fiscal policy, ECONOMETRIC ANALYSIS, SMOKING, TOBACCO INDUSTRY. Région: North and Central America, South America, Guatemala, Honduras. Programme: Alimentation, environnement et santé. Financement total : CA$ 128,000.00. Taxes sur le tabac, contrebande et ...

  14. SU-E-T-208: Incidence Cancer Risk From the Radiation Treatment for Acoustic Neuroma Patient

    Energy Technology Data Exchange (ETDEWEB)

    Kim, D [Kyung Hee University International Med. Serv., Seoul (Korea, Republic of); Chung, W [Kyung Hee University Hospital at Gangdong, Seoul, Seoul (Korea, Republic of); Shin, D [Kyung Hee University Hospital, Seoul, Seoul (Korea, Republic of); Yoon, M [Korea University, Seoul (Korea, Republic of)

    2014-06-01

    Purpose: The present study aimed to compare the incidence risk of a secondary cancer from therapeutic doses in patients receiving intensitymodulated radiotherapy (IMRT), volumetric modulated arc therapy (VMAT), and stereotactic radiosurgery (SRS). Methods: Four acoustic neuroma patients were treated with IMRT, VMAT, or SRS. Their incidnece excess relative risk (ERR), excess absolute risk (EAR), and lifetime attributable risk (LAR) were estimated using the corresponding therapeutic doses measured at various organs by radio-photoluminescence glass dosimeters (RPLGD) placed inside a humanoid phantom. Results: When a prescription dose was delivered in the planning target volume of the 4 patients, the average organ equivalent doses (OED) at the thyroid, lung, normal liver, colon, bladder, prostate (or ovary), and rectum were measured. The OED decreased as the distance from the primary beam increased. The thyroid received the highest OED compared to other organs. A LAR were estimated that more than 0.03% of AN patients would get radiation-induced cancer. Conclusion: The tyroid was highest radiation-induced cancer risk after radiation treatment for AN. We found that LAR can be increased by the transmitted dose from the primary beam. No modality-specific difference in radiation-induced cancer risk was observed in our study.

  15. 41 CFR 101-39.208 - Vehicles removed from defined areas.

    Science.gov (United States)

    2010-07-01

    ... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services... operated outside the geographical area served by the issuing GSA IFMS fleet management center. However... shall notify the issuing GSA IFMS fleet management center of the following: (1) The location at which...

  16. 42 CFR 422.208 - Physician incentive plans: requirements and limitations.

    Science.gov (United States)

    2010-10-01

    ... that are not based on use of referrals, such as quality of care furnished, patient satisfaction or... dollar payment per patient per unit of time (usually per month) paid to a physician or physician group to... have either aggregate or per-patient stop-loss protection in accordance with paragraph (f) of this...

  17. 12 CFR 208.72 - What activities may a financial subsidiary conduct?

    Science.gov (United States)

    2010-01-01

    ... Internal Revenue Code of 1986 (26 U.S.C. 72); (3) Real estate development or real estate investment, unless... activities: (1) Any financial activity listed in § 225.86(a), (b), or (c) of the Board's Regulation Y (12 CFR... insurance company investment activity permitted for financial holding companies by section 4(k)(4)(H) or (I...

  18. The epigenetic modifier Fam208a is required to maintain epiblast cell fitness

    Czech Academy of Sciences Publication Activity Database

    Bhargava, Shohag; Cox, B.; Polydorou, Christiana; Grešáková, Veronika; Kořínek, Vladimír; Strnad, Hynek; Sedláček, Radislav; Epp, Trevor Allan; Chawengsaksophak, Kallayanee

    2017-01-01

    Roč. 7 (2017), č. článku 9322. ISSN 2045-2322 R&D Projects: GA ČR GA15-23165S; GA MŠk LO1419; GA MŠk(CZ) ED1.1.00/02.0109; GA MŠk ED2.1.00/19.0395; GA MŠk(CZ) LM2011032; GA MŠk(CZ) LM2015040; GA MŠk(CZ) LQ1604 Institutional support: RVO:68378050 Keywords : bone morphogenetic protein-4 * position-effect variegation * gastrulating mouse embryo * anterior-posterior axis * mesoderm differentiation * expression pattern * mice lacking * postimplantation development * definitive endoderm * primitive streak Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.259, year: 2016

  19. 12 CFR Appendix D-1 to Part 208 - Interagency Guidelines Establishing Standards for Safety and Soundness

    Science.gov (United States)

    2010-01-01

    ... and operations; 3. Assess the source, volatility, and sustainability of earnings, including the effect... exposure. F. Asset growth. G. Asset quality. H. Earnings. I. Compensation, fees and benefits. III... standards; (2) compensation standards; and (3) such standards relating to asset quality, earnings, and stock...

  20. 18 CFR 157.208 - Construction, acquisition, operation, replacement, and miscellaneous rearrangement of facilities.

    Science.gov (United States)

    2010-04-01

    ... requires the approval of the project; (8) For acquisitions of facilities: (i) A statement referencing the... accumulated provisions for depreciation, depletion, and amortization; (9) A concise analysis discussing the relevant issues outlined in § 380.12 of this chapter. The analysis must identify the existing environmental...

  1. 12 CFR 208.3 - Application and conditions for membership in the Federal Reserve System.

    Science.gov (United States)

    2010-01-01

    ...: (1) Financial condition and management. The financial history and condition of the applying bank and the general character of its management. (2) Capital. The adequacy of the bank's capital in accordance... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Application and conditions for membership in...

  2. 12 CFR Appendix D-2 to Part 208 - Interagency Guidelines Establishing Information Security Standards

    Science.gov (United States)

    2010-01-01

    ... (banks) and their nonbank subsidiaries, except for brokers, dealers, persons providing insurance... company controlled by a bank, except a broker, dealer, person providing insurance, investment company... light of any relevant changes in technology, the sensitivity of its customer information, internal or...

  3. 42 CFR 402.208 - Factors considered in determining whether to exclude, and the length of exclusion.

    Science.gov (United States)

    2010-10-01

    .... (v) The wrongful conduct had an adverse impact on the financial integrity of the Medicare program or... financial condition of the person presenting the claims. (3) The total number of acts in which the violation... financial loss to the Medicare program of at least $5,000. (viii) The number of instances for which full...

  4. 9 CFR 205.208 - Distribution of portions of master list-registration-information to non-registrants on request.

    Science.gov (United States)

    2010-01-01

    ...), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM PRODUCTS Interpretive Opinions § 205... registrants, registrants would not be subject to that security interest. These conclusions are based on the... question arises as to the length of time for which a registration is effective, and whether a registrant...

  5. Transverse mass distributions of neutral pions from 208Pb-induced reactions at 158 A GeV

    NARCIS (Netherlands)

    Aggarwal, M.M.; Agnihotri, A.; Ahammed, Z.A.; Angelis, A.L.S.; Antonenko, V.; Arefiev, V.; Astakhov, V.; Avdeitchikov, V.; Awes, T.C.; Baba, P.V.K.S.; Badyal, S.K.; Barlag, C.; Bathe, S.; Batiounia, B.; Bernier, T.; Bhalla, K.B.; Bhatia, V.S.; Blume, C.; Bock, R.; Bohne, E.-M.; Böröcz, Z.K.; Bucher, D.; Buijs, A.; Büsching, H.; Carlén, L.; Chalyshev, V.; Chattopadhyay, S.; Cherbatchev, R.; Chujo, T.; Claussen, A.; Das, A.C.; Decowski, M.P.; Delagrange, H.; Djordjadze, V.; Donni, P.; Doubovik, I.; Dubey, A.K.; Dutt, S.; Dutta Majumdar, M.R.; El Chenawi, K.; Eliseev, S.; Enosawa, K.; Foka, P.; Fokin, S.; Ganti, M.S.; Garpmann, S.; Gavrishchuk, O.; Geurts, F.; Ghosh, T.K.; Glasow, R.; Gupta, S.K.; Guskov, B.; Gustafsson, H.-A.; Gutbrod, H.H.; Higuchi, R.; Hrivnacova, I.; Ippolitov, M.; Kalechofsky, H.; Kamermans, R.; Kampert, K.-H.; Karadjev, K.; Karpio, K.; Kato, S.; Kees, S.; Klein-Bösing, C.; Knoche, S.; Kolb, B.; Kosarev, I.; Koutcheryaev, I.; Krümpel, T.; Kugler, A.; Kulinich, P.; Kurata, M.; Kurita, K.; Kuzmin, N.; Langbein, I.; Bevedev, A.; Lee, Y.Y.; Löhner, H.; Luquin, L.; Mahapatra, D.P.; Manko, V.; Martin, M.; Martinez, G.; Maximov, A.; Mgebrichvili, G.; Miake, Y.; Mir, Md.F.; Mishra, G.C.; Mitamoto, Y.; Mohanti, B.; Mora, M.-J.; Morrison, D.; Mukhopadhyay, D.S.; Naef, H.; Nandi, B.K.; Nayak, S.K.; Nayak, T.K.; Neumaier, S.

    Results on transverse mass spectra of neutral pious measured at central rapidity are presented for impact parameter selected 158-A GeV Pb + Pb-1 and Pb + Nb collisions. The distributions cover the range 0.5 GeV/c(2) less than or equal to MT - Mo less than or equal to 4 GeV/c(2). The change of the

  6. Paleontology and physical stratigraphy of the USGS-Pregnall No. 1 core (DOR-208), Dorchester County, South Carolina

    Science.gov (United States)

    Edwards, L.E.; Bybell, L.M.; Gohn, G.S.; Frederiksen, N.O.

    1997-01-01

    Pregnall No. 1, a 346-ft-deep corehole in northern Dorchester County, South Carolina, recovered sediments of late Paleocene, middle and late Eocene, and late Oligocene age. The core bottomed in the Chicora Member of the Williamsburg Formation (Black Mingo Group) of late Paleocene age (calcareous nannofossil Zones NP 7/8 (?) and NP 9). The Chicora (346 to 258 ft depth) consists of two contrasting lithologic units, a lower siliciclastic section of terrigenous sand, silt, and clay, and an upper carbonate section of moldic pelecypod limestone. The Chicora is overlain unconformably by the middle Eocene Moultrie Member of the Santee Limestone (Orangeburg Group). The Moultrie (258.0 to 189.4 ft) consists primarily of bryozoan-pelecypod-peloid packstones and grainstones, which are assigned to calcareous nannofossil Zone NP 16. Unconformably above the Moultrie are the locally shelly, microfossiliferous limestones of the Cross Member of the Santee Limestone (Orangeburg Group), which are assigned to middle Eocene Zone NP 17 and upper Eocene Zone NP 18. The Cross Member (189.4 to 90.9 ft) is unconformably overlain by a very thin, basal section of the upper Eocene Harleyville Formation (Cooper Group). The thin Harleyville section consists of fossiliferous limestone, primarily pelecypod-foraminifer-peloid packstones (90.9 to 85.8 ft), and is assigned to Zone NP 18, although samples from thicker Harleyville sections in the region typically are assigned to upper Eocene Zone NP 19/20. The Harleyville is overlain unconformably by the upper Oligocene Ashley Formation (Cooper Group). The Ashley Formation (85.8 to 30.0 ft) consists of a relatively homogeneous section of calcareous, microfossiliferous, silty and sandy clays assigned to Zones NP 24 and NP 25 (?). Neogene and (or) Quaternary deposits present in the upper 30 ft of the Pregnall section are assigned provisionally to an unnamed unit (30 to 22 ft) and to the Waccamaw Formation(?)(22 to 0 ft).

  7. Diverse Mafic Influences on the Magmatic System of the 2.08 Ma Huckleberry Ridge Eruption, Yellowstone

    Science.gov (United States)

    Wilson, C. J. N.; Swallow, E. J.; Charlier, B. L. A.; Gamble, J. A.

    2016-12-01

    The Yellowstone Plateau Volcanic Field (YPVF) is the youngest, currently active focus of the long-lived Yellowstone-Snake River Plain (YSRP) volcanic province. This province is traditionally considered to be bimodal1, with mantle-derived olivine tholeiites providing the thermal and volatile fluxes to generate the voluminous rhyolitic volcanism that forms the initial stages at each caldera focus2. There are also lesser volumes of alkalic compositions, which define a Craters of the Moon (COM) trend1. These eruptives, dominantly trachy-basalts and -andesites but continuous to high-Ba rhyolites, are often found at the margins of the YSRP and are believed to represent small-volume magma batches derived by extreme mid-crustal fractionation of a tholeiitic parent3,4. The 2,500 km3 Huckleberry Ridge Tuff (HRT), the first of three caldera-forming eruptions at the YPVF, consists of minor fall deposits followed by three voluminous ignimbrite members: A, B and C4. The HRT was preceded and followed by the eruption of YSRP olivine tholeiites within and around the inferred caldera4. Previously identified4 aphyric scoria in HRT member B, and a newly identified juvenile mafic component in HRT member A, are however more extreme in composition than the COM magma type with SiO2 of 49.3- 59.0 wt %, Na2O+K2O 4.5-6.6 wt %, Ba to 3500 ppm, Zr to 1850 ppm and P2O5 to 1.8 wt %. This `HRT-COM' trend is parallel to but offset to higher Ba from that defined by younger surficial COM-type lava flows west of the HRT caldera. We here summarise major, trace and isotopic data from these three mafic lineages, which temporally encompass the HRT. We compare them with other data of the COM suite and evaluate interpretations for their source which range from extreme fractional crystallisation to melts from metasomatised mantle. We highlight the close spatial and temporal association of the mafic lineages, despite their distinct chemical signatures, indicating the presence of complex root zones underplating the large-scale YSRP rhyolitic body or bodies during the onset of voluminous rhyolitic volcanism in the YPVF. 1Christiansen EH, McCurry M 2009: Bull Volc 70, 251; 2Leeman WP 2008: Geol Soc Lond Spec Pub 304, 235; 3Whitaker ML et al. 2008: Bull Volc 70, 417; 4Putirka KD et al. 2009: J Petrol 50, 1639; 5Christiansen RL 2001: USGS Prof Paper 729-G.

  8. Neutron production in neutron-induced reactions at 96 MeV on 56Fe and 208Pb

    Science.gov (United States)

    Sagrado García, I. C.; Lecolley, J. F.; Lecolley, F. R.; Blideanu, V.; Ban, G.; Fontbonne, J. M.; Itis, G.; Lecouey, J. L.; Lefort, T.; Marie, N.; Steckmeyer, J. C.; Le Brun, C.; Blomgren, J.; Johansson, C.; Klug, J.; Orhn, A.; Mermod, P.; Olsson, N.; Pomp, S.; Osterlund, M.; Tippawan, U.; Prokofiev, A. V.; Nadel-Turonski, P.; Fallot, M.; Foucher, Y.; Guertin, A.; Haddad, F.; Vatre, M.

    2011-10-01

    Double-differential cross sections for neutron production were measured in 96-MeV neutron-induced reactions at The Svedberg Laboratory in Uppsala, Sweden. Measurements for Fe and Pb targets were performed using two independent setups: DECOI-DEMON, time-of-flight telescope dedicated to the detection of emitted neutrons with energies between a few and 50MeV and CLODIA-SCANDAL device devoted to measuring emitted neutrons with energies above 40MeV. Double-differential cross sections were measured for an angular range between 15 and 98 deg and with low-energy thresholds (≈2 MeV). Angular and energy distributions and total neutron emission cross sections have been obtained from those measurements. Results have been compared with predictions given by different models included in several transport codes (MCNPX, GEANT, TALYS, PHITS, and DYWAN) and with other experimental data (the EXFOR database).

  9. SU-E-J-208: Fast and Accurate Auto-Segmentation of Abdominal Organs at Risk for Online Adaptive Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, V; Wang, Y; Romero, A; Heijmen, B; Hoogeman, M [Erasmus MC Cancer Institute, Rotterdam (Netherlands); Myronenko, A; Jordan, P [Accuray Incorporated, Sunnyvale, United States. (United States)

    2014-06-01

    Purpose: Various studies have demonstrated that online adaptive radiotherapy by real-time re-optimization of the treatment plan can improve organs-at-risk (OARs) sparing in the abdominal region. Its clinical implementation, however, requires fast and accurate auto-segmentation of OARs in CT scans acquired just before each treatment fraction. Autosegmentation is particularly challenging in the abdominal region due to the frequently observed large deformations. We present a clinical validation of a new auto-segmentation method that uses fully automated non-rigid registration for propagating abdominal OAR contours from planning to daily treatment CT scans. Methods: OARs were manually contoured by an expert panel to obtain ground truth contours for repeat CT scans (3 per patient) of 10 patients. For the non-rigid alignment, we used a new non-rigid registration method that estimates the deformation field by optimizing local normalized correlation coefficient with smoothness regularization. This field was used to propagate planning contours to repeat CTs. To quantify the performance of the auto-segmentation, we compared the propagated and ground truth contours using two widely used metrics- Dice coefficient (Dc) and Hausdorff distance (Hd). The proposed method was benchmarked against translation and rigid alignment based auto-segmentation. Results: For all organs, the auto-segmentation performed better than the baseline (translation) with an average processing time of 15 s per fraction CT. The overall improvements ranged from 2% (heart) to 32% (pancreas) in Dc, and 27% (heart) to 62% (spinal cord) in Hd. For liver, kidneys, gall bladder, stomach, spinal cord and heart, Dc above 0.85 was achieved. Duodenum and pancreas were the most challenging organs with both showing relatively larger spreads and medians of 0.79 and 2.1 mm for Dc and Hd, respectively. Conclusion: Based on the achieved accuracy and computational time we conclude that the investigated auto-segmentation method overcomes an important hurdle to the clinical implementation of online adaptive radiotherapy. Partial funding for this work was provided by Accuray Incorporated as part of a research collaboration with Erasmus MC Cancer Institute.

  10. Oahu Photomosaic 2000 (208-209-0516) - Orthorectification and Mosaicing of Color Aerial Photography Main Eight Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....

  11. 12 CFR Appendix E to Part 208 - Capital Adequacy Guidelines for State Member Banks; Market Risk Measure

    Science.gov (United States)

    2010-01-01

    ... management and is independent from business trading units. (2) The bank's internal risk measurement model.... A bank subject to this appendix must have a risk management system that meets the following minimum... its risk measurement and risk management systems at least annually. (c) Market risk factors. The bank...

  12. Reaction study of {sup 11}Li on {sup 208}Pb target at energies close the Coulomb barrier

    Energy Technology Data Exchange (ETDEWEB)

    Cubero, Mario; Jose Borge, Maria; Tengblad, Olof; Alcorta, Martin; Madurga, Miguel [Instituto de Estructura de la Materia, Madrid (Spain); Camacho, Joaquin [Departamento de Fisica Atomica, Molecular y Nuclear, Universidad de Sevilla, Sevilla (Spain); Martel, Ismael [Departamento de Fisica Aplicada, Universidad de Huelva, Huelva (Spain); Walden, Pat [TRI-University Meson Facilities, University of British Columbia, Vancouver (Canada)

    2009-07-01

    In the past 20 years there has been interest among the nuclear physics community to study the exotic properties observed in halo nuclei such as {sup 11}Li. Recent theoretical calculations predicted a deviation of the elastic cross section from the standard Rutherford formula, expected due to the dipole structure formed by the {sup 9}Li core and the halo neutrons when passing near the strong Coulomb produced by the Pb target. To explore this effect, the scattering and breakup reactions of the two-neutron halo nucleus {sup 11}Li were measured at ISACII-TRIUMF. Data was obtained at energies around, below and above the Coulomb barrier, 2.7 MeV/u. We used a set of four telescopes with PAD silicon detectors behind in order to clearly identified all fragments in the full detection angles covering 10-140 degree.In this contribution we present the analysis of the {sup 9}Li scattering data that it is needed to understand the effect on the {sup 11}Li cross sections. We also present preliminary results of the {sup 11}Li scattering.

  13. Transverse mass distributions of neutral pions from $^{208}$Pb-induced reactions at 158$\\cdot A$ GeV

    CERN Document Server

    Aggarwal, M.M.; Antonenko, V.; Arefiev, V.; Astakhov, V.; Avdeitchikov, V.; Awes, T.C.; Baba, P.V.K.S.; Badyal, S.K.; Bathe, S.; Batiounia, B.; Bernier, T.; Bhalla, K.B.; Bhatia, V.S.; Blume, C.; Bucher, D.; Busching, H.; Carlen, L.; Chattopadhyay, S.; Decowski, M.P.; Delagrange, H.; Donni, P.; Dutta Majumdar, M.R.; El Chenawi, K.; Enosawa, K.; Fokin, S.; Frolov, V.; Ganti, M.S.; Garpman, S.; Gavrishchuk, O.; Geurts, F.J.M.; Ghosh, T.K.; Glasow, R.; Guskov, B.; Gustafsson, H.A.; Gutbrod, H.H.; Hrivnacova, I.; Ippolitov, M.; Kalechofsky, H.; Kamermans, R.; Karadjev, K.; Karpio, K.; Kolb, B.W.; Kosarev, I.; Koutcheryaev, I.; Kugler, A.; Kulinich, P.; Kurata, M.; Lebedev, A.; Lohner, H.; Mahapatra, D.P.; Manko, V.; Martin, M.; Martinez, G.; Maximov, A.; Miake, Y.; Mishra, G.C.; Mohanty, B.; Mora, M.J.; Morrison, Douglas R.O.; Mukhanova, T.; Mukhopadhyay, D.S.; Naef, H.; Nandi, B.K.; Nayak, S.K.; Nayak, T.K.; Nianine, A.; Nikitine, V.; Nikolaev, S.; Nilsson, P.; Nishimura, S.; Nomokonov, P.; Nystrand, J.; Oskarsson, A.; Otterlund, I.; Peitzmann, T.; Peressounko, D.; Petracek, V.; Plasil, F.; Purschke, M.L.; Rak, J.; Raniwala, R.; Raniwala, S.; Rao, N.K.; Reygers, K.; Roland, G.; Rosselet, L.; Roufanov, I.; Rubio, J.M.; Sambyal, S.S.; Santo, R.; Sato, S.; Schlagheck, H.; Schmidt, H.R.; Schutz, Y.; Shabratova, G.; Shah, T.H.; Sibiriak, I.; Siemiarczuk, T.; Silvermyr, D.; Sinha, B.C.; Slavine, N.; Soderstrom, K.; Sood, G.; Sorensen, S.P.; Stankus, P.; Stefanek, G.; Steinberg, P.; Stenlund, E.; Sumbera, M.; Svensson, T.; Tsvetkov, A.; Tykarski, L.; Van den Pijll, E.C.; Van Eijndhoven, N.; Van Nieuwenhuizen, G.J.; Vinogradov, A.; Viyogi, Y.P.; Vodopianov, A.S.; Voros, S.; Wyslouch, B.; Young, G.R.

    2002-01-01

    Results on transverse mass spectra of neutral pions measured at central rapidity are presented for impact parameter selected 158$\\cdot A$ GeV Pb + Pb, and Pb + Nb collisions. The distributions cover the range $0.5 \\mathrm{GeV}/c^{2} \\le m_{T} - m_{0} \\le 4 \\mathrm{GeV}/c^{2}$. The change of the spectral shape with centrality is studied in detail. In going from peripheral to medium central collisions there is a nuclear enhancement increasing with transverse mass similar to the well known Cronin effect, while for very central collisions this enhancement appears to be weaker than expected.

  14. SU-G-JeP2-08: Image-Guided Radiation Therapy Using Synthetic CTs in Brain Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Price, R.G.; Glide-Hurst, C. [Wayne State School of Medicine, Detroit, MI (United States); Henry Ford Health System, Detroit, MI (United States); Kim, J.; Zheng, W.; Chetty, I.J. [Henry Ford Health System, Detroit, MI (United States)

    2016-06-15

    Purpose: Synthetic-CTs(synCTs) are essential for MR-only treatment planning. However, the performance of synCT for IGRT must be carefully assessed. This work evaluated the accuracy of synCT and synCT-generated DRRs and determined their performance for IGRT in brain cancer radiation therapy. Methods: MR-SIM and CT-SIM images were acquired of a novel anthropomorphic phantom and a cohort of 12 patients. SynCTs were generated by combining an ultra-short echo time (UTE) sequence with other MRI datasets using voxel-based weighted summation. For the phantom, DRRs from synCT and CT were compared via bounding box and landmark analysis. Planar (MV/KV) and volumetric (CBCT) IGRT performance were evaluated across several platforms. In patients, retrospective analysis was conducted to register CBCTs (n=34) to synCTs and CTs using automated rigid registration in the treatment planning system using whole brain and local registration techniques. A semi-automatic registration program was developed and validated to rigidly register planar MV/KV images (n=37) to synCT and CT DRRs. Registration reproducibility was assessed and margin differences were characterized using the van Herk formalism. Results: Bounding box and landmark analysis of phantom synCT DRRs were within 1mm of CT DRRs. Absolute 2D/2D registration shift differences ranged from 0.0–0.7mm for phantom DRRs on all treatment platforms and 0.0–0.4mm for volumetric registrations. For patient planar registrations, mean shift differences were 0.4±0.5mm (range: −0.6–1.6mm), 0.0±0.5mm, (range: −0.9–1.2mm), and 0.1±0.3mm (range: −0.7–0.6mm) for the superior-inferior(S-I), left-right(L–R), and anterior-posterior(A-P) axes, respectively. Mean shift differences in volumetric registrations were 0.6±0.4mm (range: −0.2–1.6mm), 0.2±0.4mm (range: −0.3–1.2mm), and 0.2±0.3mm (range: −0.2–1.2mm) for S-I, L–R, and A–P axes, respectively. CT-SIM and synCT derived margins were within 0.3mm. Conclusion: DRRs generated via synCT agreed well with CT-SIM. Planar and volumetric registrations to synCT-derived targets were comparable to CT. This validation is the next step toward clinical implementation of MR-only planning for the brain. The submitting institution has research agreements with Philips Healthcare. Research sponsored by a Henry Ford Health System Internal Mentored Grant.

  15. Dollar Summary of Federal Supply Classification and Service Category by Company, FY 85. Part 3 (R212-S208).

    Science.gov (United States)

    1985-01-01

    n) U )0 g u’I wIn’w u & Li w w w w WLS w In 0 O - I I LL. In cc xn I) In InI n U nn I n ) Wn U n U In acn -j 0 00 00 0 00 00 0 0 000 0 000 0 In 0...t- w. w Sf n m~ N q& tv000 IPl CM CI N O0) 04 IN 0I -4 A 44 0 m I I () 0 I " 1-I- > >a W I= w w n w zII = GIIIw w w w w w W w W L (Al Ill ZZZzzzzz

  16. 12 CFR Appendix F to Part 208 - Capital Adequacy Guidelines for Banks: Internal-Ratings-Based and Advanced Measurement Approaches

    Science.gov (United States)

    2010-01-01

    ... regional development bank in which the U.S. government is a shareholder or contributing member or which the... model development. In this context, backtesting is one form of out-of-sample testing. Bank holding... (Farmer Mac), a multilateral development bank, a depository institution, a bank holding company, a savings...

  17. [Follow-up with the assistance of TB-info software of 208 tuberculosis patients who were treated in 2004].

    Science.gov (United States)

    Bourgarit, A; Mallet, H-P; Keshtmand, H; De Castro, N; Rambeloarisoa, J; Fain, O; Antoun, F; Picard, C; Rocher, G; Che, D; Farge, D

    2009-10-01

    The impact of the TB-info software was assessed on the care of patients treated with antituberculosis regimen (ATT). Cohort study of patients with tuberculosis who received an ATT in 2004 in two hospitals and five medical centres in Paris. Follow-up was implemented with the TB-info software. Data were compared to those of the 1999-2003 cohort. Two hundred and nine ATT were initiated in 2004, with a mean duration of 7.2 months. Demographic and clinical data reflected this population precariousness: 79% were foreign-born, 25% lived in institutions and half of them had no or unusual health insurance. Compared to the previous cohort, viral co-infections were tested in more than 80% cases and showed association with HIV, HBV or HCV in 11, 10 and 5% of the patients, respectively. Twenty-one patients were lost for follow-up (11%) and 76% of the smear-positive pulmonary tuberculosis therapies were declared successful but only 34% were declared cured with the WHO criteria. Analysis of the data obtained with TB-info software showed an improvement of tuberculosis patients care with more co-infection tested and less lost for follow-up. These results confirm the usefulness of this software for patients care and assessment of physicians practice in France.

  18. Faropenem medoxomil: A0026, BAY 56-6854, BAY 566854, faropenem daloxate, SUN 208, SUN A0026.

    Science.gov (United States)

    2008-01-01

    Replidyne is developing faropenem medoxomil, the ester-type prodrug of faropenem, for the treatment of bacterial infections and respiratory tract infections, including acute exacerbations of chronic bronchitis (AECB), acute bacterial sinusitis (ABS) and community-acquired pneumonia (CAP). Faropenem medoxomil is also being developed for the treatment of tonsillitis, pharyngitis and otitis media in children. Faronpenem medoxomil was discovered by scientists at Suntory Institute for Biomedical Research (now Asubio Pharma). The compound has significantly improved oral bioavailability and is dehydropeptidase-I stable. Following absorption, faropenem medoxomil is rapidly hydrolysed to the active drug faropenem. An NDA was filed in the US but was deemed not approvable by the US authorities. Following the termination of the license agreement between Replidyne and Forest Laboratories, Replidyne is now exploring other partnering opportunities for faropenem medoxomil. Daiichi Suntory Pharma (now Asubio Pharma) has granted Replidyne the exclusive rights to faropenem medoxomil for the US and Canada and an exclusive option to develop and commercialize the compound in the rest of the world, excluding Japan. Replidyne has rights to the preclinical and clinical data generated up to the time of the agreement (August 2004) and will complete clinical development of the drug. Replidyne is also developing a paediatric formulation for the treatment of common bacterial infections. In February 2006, Replidyne sublicensed development, commercialization and distribution rights of faropenem medoxomil in the US to Forest Laboratories Holdings (Forest Laboratories). However, the agreement was terminated in February 2007, following the US FDA's non-approvable letter for the product. Replidyne re-acquired all US adult and paediatric rights previously granted to Forest. Bayer AG previously licensed exclusive worldwide rights to develop faropenem medoxomil from Suntory (now Asubio Pharma) and conducted a number of phase III clinical trials. This agreement appears to have been superseded by the agreement with Replidyne in 2004. In April 2007, Daiichi Asubio Pharma was renamed as Asubio Pharma Co., Ltd. Daiichi Asubio Pharma was the name used by Daiichi Suntory Pharma after it became a wholly owned subsidiary of Daiichi Pharmaceutical in September 2005. Daiichi Suntory Pharma was the joint venture company owned by Daiichi Pharmaceutical and Suntory. In April 2006, Daiichi Pharmaceutical merged with Sankyo to form Daiichi Sankyo Inc. The FDA issued a non-approvable letter in October 2006 for faropenem medoxomil in the treatment of ABS, CAP, AECB and uncomplicated skin and skin structure infections. Consequently, drug development has reverted back to phase III in the US. The agency has indicated that four phase III trials in three adult respiratory indications, ABS, CAP and AECB, will be required for a US marketing application. According to this advice, Replidyne may be required to conduct one superiority study (versus placebo) each for the ABS and AECB indications and two non-inferiority, active-controlled studies for the treatment of CAP. The required dose of faropenem medoxomil in future trials will be 600 mg, administered twice daily, and trials will involve approximately 1500 patients to ensure an acceptable database of safety information for review. Replidyne is continuing to work with the FDA on further trial details. Replidyne first filed the NDA seeking approval for faropenem medoxomil in December 2005. This submission marked the first marketing approval application for faropenem medoxomil worldwide. The NDA, which was accepted in February 2006, was primarily based on data from 11 phase III trials in patients with respiratory tract and skin infections; the safety data included information from more than 5000 patients treated with the drug. The proposed commercial name for faropenem medoxomil, Orapemtrade mark, was not approved by the FDA due to its similarity to another commercially approved drug. Replidyne and the FDA are working together to identify a suitable alternative. Two phase III trials have been conducted that demonstrated faropenem medoxomil was non-inferio o azithromycin and clarithromycin in the treatment of AECB. Replidyne's phase II trial evaluating an oral liquid formulation of faropenem medoxomil (7.5-40 mg/kg) in paediatric patients with acute otitis media (AOM), met its primary endpoint. The trial was completed in March 2007 and enrolled approximately 310 patients in Costa Rica and Israel. Replidyne intends to meet with the US authorities to discuss the design of the planned phase III trial in paediatric AOM. In addition to 5 years of Hatch-Waxman exclusivity granted upon approval, faropenem medoxomil is protected by an issued US composition of matter patent, which expires in 2015. Extension of exclusivity under Hatch-Waxman legislation is expected.

  19. 12 CFR Appendix A to Part 208 - Capital Adequacy Guidelines for State Member Banks: Risk-Based Measure

    Science.gov (United States)

    2010-01-01

    ... and effect of these guidelines in relation to domestic and international developments in the banking... framework is described in a paper prepared by the BSC entitled “International Convergence of Capital... foreign currency translation, net of any treasury stock; less net unrealized holding losses on available...

  20. Page 1 208 P. V. SUBBA RAJU where RQ = Qro°/v. Equations (5.1 ...

    Indian Academy of Sciences (India)

    k and hence the magnetic field and suction do not influence the shear stress and moment coefficient directly. From Tables I, IV and VI, it is evident that the transverse shear stress and dimensionless moment coefficient increase with the increase in magnetic field and suction. With increasing. Suction, the radial shear stress ...

  1. 12 CFR 208.100 - Sale of bank's money orders off premises as establishment of branch office.

    Science.gov (United States)

    2010-01-01

    ... bank, branch office, branch agency, additional office, or any branch place of business * * * at which... money orders by an agent amounts to the receipt of deposits at a branch place of business within the... bear a strong resemblance to traveler's checks that are issued by banks and sold off premises. In both...

  2. 33 CFR 208.19 - Marshall Ford Dam and Reservoir (Mansfield Dam and Lake Travis), Colorado River, Tex.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Marshall Ford Dam and Reservoir... Marshall Ford Dam and Reservoir (Mansfield Dam and Lake Travis), Colorado River, Tex. The Secretary of the Interior, through his agent, the Lower Colorado River Authority (LCRA) shall operate the Marshall Ford Dam...

  3. 20 CFR 652.208 - How are core services and intensive services related to the methods of service delivery described...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How are core services and intensive services... applicable three methods of service delivery described in § 652.207(b)(2). These methods are: (a) Self-service; (b) Facilitated self-help service; and (c) Staff-assisted service. ...

  4. 49 CFR 571.208a - Optional test procedures for vehicles manufactured between January 27, 2004 and August 31, 2004.

    Science.gov (United States)

    2010-10-01

    ... shoulder bolt (part 880105-527 in drawing 880105-528R & 528L, sliding knee assy. w/o pot). S16.3.1.11.2 Leg... drawing 880105-660, ankle assembly) and the knee pivot shoulder bolt (part 880105-527 in drawing 880105... with the floor pan. Let the thighs rest on the seat cushion to the extent permitted by the foot...

  5. 29 CFR 778.208 - Inclusion and exclusion of bonuses in computing the “regular rate.”

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Inclusion and exclusion of bonuses in computing the... Inclusion and exclusion of bonuses in computing the “regular rate.” Section 7(e) of the Act requires the inclusion in the regular rate of all remuneration for employment except seven specified types of payments...

  6. Coleópteros de Colombia: 50 Especies llamativas (Insecta: Coleoptera Un Manual Educativo. Pág. 205-208

    Directory of Open Access Journals (Sweden)

    Maritza Yurieth García Montes

    2013-03-01

    Full Text Available Coleópteros de Colombia- 50 especies llamativas (Insecta: Coleoptera un manual educativo, se presenta como requisito parcial para optar al título de Licenciada en Biología de la UPN, y surge de la necesidad de iniciar programas de sensibilización y movilización frente a la Biota Colombiana, debido a la alta biodiversidad de Colombia, alto grado de amenaza y bajo conocimiento de las especies (Humboldt, 1995. Como docentes, sabemos que la conservación de la biodiversidad es un desafío para la comunidad educativa, y que se requieren más trabajos, que promuevan conocimientos y valores apropiados frente a los recursos naturales. De allí, que el manual educativo, busque acercar a estudiantes, profesores de secundaria y público en general, al conocimiento, importancia y utilidad de los Coleópteros (Insecta: Coleoptera. Estableciéndose como una opción, en el proceso de enseñanza- aprendizaje de la biología, al combinar la investigación biológica y pedagógica alrededor de la escuela.

  7. 12 CFR 208.34 - Recordkeeping and confirmation of certain securities transactions effected by State member banks.

    Science.gov (United States)

    2010-01-01

    ... banks having an average of less than 200 securities transactions per year for customers over the prior.... (4) Crossing of buy and sell orders shall mean a security transaction in which the same bank acts as... indebtedness incurred in the ordinary course of business, currency, any note, draft, bill of exchange, or...

  8. Orthorectification and Mosaicing of Color Aerial Photographyfor the Main Eight Hawaiian Islands: Oahu (208-209-0516)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  9. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  10. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  11. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  12. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  13. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  14. Temperature variability and trend estimates at tropopause and UT-LS over a subtropical site: Reunion (20.8_ S, 55.5_ E)

    CSIR Research Space (South Africa)

    B`egue, N

    2010-04-01

    Full Text Available and the ROZA project on the FRROI (Fe´de´ration de Recherche Re´union – Oce´an Indien) programme of Reunion Island University. Co-authors are5 grateful to the LACy/OPAR radiosounding team (especially to Franc¸oise Posny and Jean-Marc Metzger... of the Indian Ocean Dipole on the Southern Oscilla-20 tion, Journal of Meteorological Society of Japan, 81(1), 169–177, 2002. Bencherif, H., Portafaix, T., Baray, J. L., Morel, B., Baldy, S., Leveau,J., Moorgawa, A., Michaelis, M. M., Hauchecorne, A., Keckhut...

  15. Determination of $\\alpha_s$ from Hadronic Event Shapes in $e^+ e^-$ Annihilation at $192 \\le \\sqrt{s} \\le 208$ GeV

    CERN Document Server

    Achard, P.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Anderhub, H.; Andreev, Valery P.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, G.; Baksay, L.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Biasini, M.; Biglietti, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bottai, S.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.; Casaus, J.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Chamizo, M.; Chang, Y.H.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; de la Cruz, B.; Cucciarelli, S.; van Dalen, J.A.; de Asmundis, R.; Deglon, P.; Debreczeni, J.; Degre, A.; Deiters, K.; Della Volpe, D.; Delmeire, E.; Denes, P.; De Notaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; Dionisi, C.; Dittmar, M.; Doria, A.; Dova, M.T.; Duchesneau, D.; Echenard, B.; Eline, A.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Ewers, A.; Extermann, P.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisher, W.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gentile, S.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hakobian, R.Sh.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hirschfelder, J.; Hofer, H.; Hohlmann, M.; Holzner, G.; Hou, S.R.; Hu, Y.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, J.K.; Kirkby, Jasper; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Le Goff, J.M.; Leiste, R.; Levtchenko, M.; Levchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luminari, L.; Lustermann, W.; Ma, W.G.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Mans, J.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Nagy, S.; Natale, S.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Palomares, C.; Pandoulas, D.; Paolucci, P.; Paramatti, R.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pioppi, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pozhidaev, V.; Pothier, J.; Prokofev, D.O.; Prokofev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Roux, B.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Sakharov, A.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Schafer, C.; Shchegelsky, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Tang, X.W.; Tarjan, P.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, S.C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Ulbricht, J.; Valente, E.; Van de Walle, R.T.; Veszpremi, V.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopyanov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Wadhwa, M.; Wallraff, W.; Wang, X.L.; Wang, Z.M.; Weber, M.; Wienemann, P.; Wilkens, H.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhao, J.; Zhu, G.Y.; Zhu, R.Y.; Zhuang, H.L.; Zichichi, A.; Zilizi, G.; Zimmermann, B.; Zoller, M.

    2002-01-01

    Results are presented from a study of the structure of high energy hadronic events recorded by the L3 detector at sqrt(s)>192 GeV. The distributions of several event shape variables are compared to resummed O(alphaS^2) QCD calculations. We determine the strong coupling constant at three average centre-of-mass energies: 194.4, 200.2 and 206.2 GeV. These measurements, combined with previous L3 measurements at lower energies demonstrate the running of alphaS as expected in QCD and yield alphaS(mZ) = 0.1227 +- 0.0012 +- 0.0058, where the first uncertainty is experimental and the second is theoretical.

  16. Strain Hardening Cement Composites Structural Design and Performance State-of-the-Art Report of the RILEM Technical Committee 208-HFC, SC3

    CERN Document Server

    Kanda, Tetsushi

    2013-01-01

    Strain Hardening Cement Composites, SHCC hereafter, demonstrate excellent mechanical behavior showing tensile strain hardening and multiple fine cracks. This strain hardening behavior improves the durability of concrete structures employing SHCC and the multiple fine cracks enhance structural performance. Reliable tensile performance of SHCC enables us to design structures explicitly accounting for SHCC’s tensile properties. Reinforced SHCC elements (R/SHCC) indicate large energy absorbing performance under large seismic excitation. Against various types of loads, R/SHCC elements can be designed by superimposing re-bar performance and SHCC’s tensile performance.  This report focuses on flexural design, shear design, FE modeling and anti-seismic design of R/SHCC elements as well as application examples.  Establishing design methods for new materials usually leads to exploring application areas and this trend should be demonstrated by collecting actual application examples of SHCC in structures.

  17. 8 CFR 208.16 - Withholding of removal under section 241(b)(3)(B) of the Act and withholding of removal under the...

    Science.gov (United States)

    2010-01-01

    ... social and cultural constraints, such as age, gender, health, and social and familial ties. These factors..., membership in a particular social group, or political opinion. The testimony of the applicant, if credible..., membership in a particular social group, or political opinion, it shall be presumed that the applicant's life...

  18. Hemoglobin A1c as a tool for the diagnosis of type 2 diabetes in 208 premenopausal women with polycystic ovary syndrome

    DEFF Research Database (Denmark)

    Magnussen, Line Velling; Mumm, Hanne; Andersen, Marianne

    2011-01-01

    To study hemoglobin A1c (HbA1c) as a tool for diagnosing diabetes and to study HbA1c as a cardiovascular risk marker in patients with polycystic ovary syndrome (PCOS).......To study hemoglobin A1c (HbA1c) as a tool for diagnosing diabetes and to study HbA1c as a cardiovascular risk marker in patients with polycystic ovary syndrome (PCOS)....

  19. Fusion-fission studies on 19F+206,208Pb and 11B,19F+238U reactions around barrier energies at IUAC facility

    Science.gov (United States)

    Pullanhiotan, Sugathan; Dubey, Rakesh; Yadav, Chandrabhan; Jhingan, Akhil; Komalan Satheedas, Golda; Nedumbally, Saneesh; Kumar, Mohit

    2017-11-01

    Fission process is strongly influenced by entrance channel dynamical variables. Among these, the nuclear charge product, mass asymmetry and deformation play important role in fission dynamics. Reaction characteristics are distinguished by investigating the properties of fission mass and angular distributions. Experiments using actinide targets are challenging due to many conflicting results making unambiguous identification of quasi-fission difficult. At IUAC accelerator facility many experiments have been performed to make a systematic study of fission mechanism and role of entrance channel parameters and deformation. Fragment mass distribution, angular distribution and neutron multiplicity measurements are performed to study reactions using spherical and deformed targets.

  20. MicroRNAs 33, 122, and 208: a potential novel targets in the treatment of obesity, diabetes, and heart-related diseases.

    Science.gov (United States)

    Alrob, Osama Abo; Khatib, Said; Naser, Saleh A

    2017-05-01

    Despite decades of research, obesity and diabetes remain major health problems in the USA and worldwide. Among the many complications associated with diabetes is an increased risk of cardiovascular diseases, including myocardial infarction and heart failure. Recently, microRNAs have emerged as important players in heart disease and energy regulation. However, little work has investigated the role of microRNAs in cardiac energy regulation. Both human and animal studies have reported a significant increase in circulating free fatty acids and triacylglycerol, increased cardiac reliance on fatty acid oxidation, and subsequent decrease in glucose oxidation which all contributes to insulin resistance and lipotoxicity seen in obesity and diabetes. Importantly, MED13 was initially identified as a negative regulator of lipid accumulation in Drosophilia. Various metabolic genes were downregulated in MED13 transgenic heart, including sterol regulatory element-binding protein. Moreover, miR-33 and miR-122 have recently revealed as key regulators of lipid metabolism. In this review, we will focus on the role of microRNAs in regulation of cardiac and total body energy metabolism. We will also discuss the pharmacological and non-pharmacological interventions that target microRNAs for the treatment of obesity and diabetes.

  1. Cardiovascular responses to an exercise test in subjects with intermittent claudication. DOI: 10.5007/1980-0037.2011v13n3p208

    Directory of Open Access Journals (Sweden)

    Gabriel Grizzo Cucato

    2011-04-01

    Full Text Available Studies suggest that patients with intermittent claudication (IC present abnormal cardiovascular responses during treadmill exercise. However, it remains unclear whether this response is influenced by the severity of the disease. The objective of this study was to analyze the impact of IC severity on cardiovascular responses to an exercise test in subjects with peripheral arterial obstructive disease. Forty-seven men and women with IC, with a mean age of 65±9 years, participated in the study. The subjects underwent an exercise test on a treadmill using a specific protocol for this population. The subjects were divided into three groups according to the distance walked in the test: 1st tertile, walked from 210 to 420 m; 2nd tertile, walked from 450 to 700 m, and 3rd tertile, walked from 740 to 1060 m. Systolic (SBP and diastolic blood pressure (DBP, heart rate (HR and rate-pressure product (RPP were measured at rest, in the first stage of the treadmill test, and during peak exercise. SBP and DBP increased along the exercise test in the three tertiles. HR and RPP increased along the test in the three tertiles, and these increases were higher in the 1st tertile than in the other tertiles in the first stage. However, similar HR and RPP were observed for the three tertiles during peak exercise. In conclusion, the severity of IC did not affect blood pressure responses during treadmill exercise. However, HR and RPP were higher during submaximal exercise in subjects with more severe IC.

  2. Does arthrodesis of the first metatarsophalangeal joint correct the intermetatarsal M1M2 angle? Analysis of a continuous series of 208 arthrodeses fixed with plates

    National Research Council Canada - National Science Library

    Dalat, F; Cottalorda, F; Fessy, M-H; Besse, J-L

    2015-01-01

    ...). All the patients were operated on by a senior surgeon with the same technique: spherical avivement of the joint surfaces using reamers, osteosynthesis with an anatomic plate (Fyxis-Biotech™) in Ti.6Al...

  3. SU-G-TeP2-08: Evaluation of Plastic Scintillator Detector for Small Field Stereotactic Patient-Specific Quality Assurance

    Energy Technology Data Exchange (ETDEWEB)

    Qin, Y; Gardner, S; Huang, Y; Kim, J; Wen, N; Chetty, I [Henry Ford Health System, Detroit, MI (United States)

    2016-06-15

    Purpose: To evaluate the performance of a commercial plastic scintillator detector (PSD) for small-field stereotactic patient-specific quality assurance using flattening-filter-free (FFF) beams. Methods: A total of ten spherical targets (volume range:[0.03cc–2cc]) were planned using Dynamic Conformal Arc(DCA-10 plans) and Volumetric Modulated Arc Therapy(VMAT-10 plans) techniques in Eclipse(AAA v.11, 1mm dose calculation grid size). Additionally, 15 previously-treated cranial and spine SRS plans were evaluated (6 DCA, 9 VMAT, volume range:[0.04cc–119.02cc]). All measurements were acquired using Varian Edge equipped with HDMLC. Three detectors were used: PinPoint ion chamber (PTW;active volume 0.015cc), Exradin W1 PSD (Standard Imaging;active volume 0.002cc), and Gafchromic EBT3 film (Ashland). PinPoint and PSD were positioned perpendicular to beam axis in a Lucy phantom (Standard Imaging). Films were placed at isocenter in solid water. Calibration films were delivered for absolute dose analysis. Results: For large spherical targets(>1.5cc) with DCA, all detectors agreed within 1% of AAA calculations. As target volume decreased, PSD measured higher doses than AAA (maximum difference: 3.3% at 0.03cc target), while PinPoint chamber measured lower doses (maximum difference:-3.8% at 0.03cc target). Inter-detector differences between pinpoint and PSD increased with decreasing target size; differences>5% were observed for targets<0.09cc. Similar trends for inter-detector behavior were observed for clinical plans. For target sizes<0.08cc, PSD measured>5% higher dose than PinPoint chamber (maximum difference: 9.25% at 0.04cc target). Film demonstrated agreement of −0.19±1.47% with PSD for all spherical targets, and agreement within −0.98±2.25% for all 15 clinical targets. Unlike DCA, VMAT plans did not show improved AAA-to-detector agreements for large targets. Conclusion: For all targets, the PSD measurements agreed with film within 1.0%, on average. For small volume targets (<0.10cc), PSD agreed with film but measured significantly higher doses (>5%) compared with the pin point ion chamber. The plastic scintillator detector appears to be suitable for accurate measurements of small SRS targets.

  4. Generalized event shape and energy flow studies in $e^+ e^-$ annihilation at $\\sqrt{s}$ = 91.2-208.0 GeV

    CERN Document Server

    Achard, P; Aguilar-Benitez, M; Alcaraz, J; Alemanni, G; Allaby, J; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefiev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillere, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, G J; Bohm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, M; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Romeo, G Cara; Carlino, G; Cartacci, A; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, L; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; Cruz, B; Cucciarelli, S; de Asmundis, R; Deglon, P; Debreczeni, J; Degre, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; DeNotaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Echenard, B; Eline, A; El Hage, A; Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagan, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H; Fiandrini, E; Field, J H; Filthaut, F; Fisher, P H; Fisher, W; Forconi, G; Freudenreich, K; Furetta, C; Galaktionov, Yu; Ganguli, S N; Garcia-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Gruenewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Herve, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Jin, B N; Jindal, P; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, J; Kittel, W; Klimentov, A; Konig, A C; Kopal, M; Koutsenko, V; Kraber, M; Kraemer, R W; Kruger, A; Kunin, A; Ladron de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levtchenko, P; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, F L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, Y S; Luci, C; Luminari, L; Lustermann, W; Ma, W G; Malgeri, L; Malinin, A; Mana, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novak, T; Nowak, H; Ofierzynski, R; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, F; Pedace, M; Pensotti, S; Perret-Gallix, D; Piccolo, D; Pierella, F; Pieri, M; Pioppi, M; Piroue, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pojidaev, V; Pothier, J; Prokofiev, D; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A; Razis, P; Rembeczki, S; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, S; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sanchez, E; Schafer, C; Schegelsky, V; Schopper, H; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Straessner, A; Sudhakar, K; Sultanov, G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillasi, Z; Tang, X W; Tarjan, P; Tauscher, L; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Toth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vasquez, R; Vesztergombi, G; Vetlitsky, I; Viertel, G; Vivargent, M; Vlachos, S; Vodopianov, I; Vogel, H; Vogt, H; Vorobiev, I; Vorobyov, A A; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, An; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zoller, M

    2011-01-01

    We present results from a study of hadronic event structure in high energy e(+)e(-') interactions using the L3 detector at LEP. A new class of event shape distributions are measured at and above the Z boson pole for light quark (u, d, s, c) flavours. Energy flow correlations are studied for all hadronic events. Next-to-leading-log QCD calculations and QCD models with improved leading-log approximations are compared to data and good agreement is found at the Z-pole whereas some discrepancies are observed at higher centre-of-mass energies.

  5. Writing your thesis Paul Oliver Writing your thesis Publisher: Sage No. of pages: 208 £16.99 0761942998 0761942998 [Formula: see text].

    Science.gov (United States)

    2004-10-01

    So you need to write a thesis and want some succinct, practical guidance. You don't want to plough through hundreds of pages or follow up a list of references to other material. Both of these activities use up your precious study time and divert your attention from the subject material of the thesis.

  6. Temperature-(208–318 K and pressure-(18–696 Torr dependent rate coefficients for the reaction between OH and HNO3

    Directory of Open Access Journals (Sweden)

    K. Dulitz

    2018-02-01

    Full Text Available Rate coefficients (k5 for the title reaction were obtained using pulsed laser photolytic generation of OH coupled to its detection by laser-induced fluorescence (PLP–LIF. More than 80 determinations of k5 were carried out in nitrogen or air bath gas at various temperatures and pressures. The accuracy of the rate coefficients obtained was enhanced by in situ measurement of the concentrations of both HNO3 reactant and NO2 impurity. The rate coefficients show both temperature and pressure dependence with a rapid increase in k5 at low temperatures. The pressure dependence was weak at room temperature but increased significantly at low temperatures. The entire data set was combined with selected literature values of k5 and parameterised using a combination of pressure-dependent and -independent terms to give an expression that covers the relevant pressure and temperature range for the atmosphere. A global model, using the new parameterisation for k5 rather than those presently accepted, indicated small but significant latitude- and altitude-dependent changes in the HNO3 ∕ NOx ratio of between −6 and +6 %. Effective HNO3 absorption cross sections (184.95 and 213.86 nm, units of cm2 molecule−1 were obtained as part of this work: σ213.86  =  4.52−0.12+0.23  ×  10−19 and σ184.95  =  1.61−0.04+0.08  ×  10−17.

  7. SPIN DETERMINATION OF VALENCE AND INNER HOLE STATES VIA THE PB-208((D)OVER-RIGHT-ARROW,T)PB-207 REACTION AT ED=200 MEV

    NARCIS (Netherlands)

    LANGEVINJOLIOT, H; VANDEWIELE, J; GUILLOT, J; GERLIC, E; ROSIER, LH; WILLIS, A; MORLET, M; DUHAMELCHRETIEN, G; TOMASIGUSTAFSSON, E; BLASI, N; MICHELETTI, S; VANDERWERF, SY

    Highly excited neutron hole states in Pb-207 have been studied via the (d, over arrow pointing right, t) reaction at E(d) = 200 MeV using for the first time a polarized beam, with both vector and tensor components. The determination of overlapping neutron hole response functions takes advantage of

  8. Association between TSH-Receptor Autoimmunity, Hyperthyroidism, Goitre, and Orbitopathy in 208 Patients Included in the Remission Induction and Sustenance in Graves' Disease Study

    DEFF Research Database (Denmark)

    Laurberg, Peter; Nygaard, Birte; Andersen, Stig

    2014-01-01

    Background. Graves' disease may have a number of clinical manifestations with varying degrees of activity that may not always run in parallel. Objectives. To study associations between serum levels of TSH-receptor autoantibodies and the three main manifestations of Graves' disease (hyperthyroidism...... and Sustenance in Graves' Disease (RISG)." Patients were systematically tested for degree of biochemical hyperthyroidism, enlarged thyroid volume by ultrasonography, and the presence of orbitopathy. Results. Positive correlations were found between the levels of TSH-receptor autoantibodies in serum and the three...... manifestations of Graves' disease: severeness of hyperthyroidism, presence of enlarged thyroid, and presence of orbitopathy, as well as between the different types of manifestations. Only around half of patients had enlarged thyroid gland at the time of diagnosis of hyperthyroidism, whereas 25-30% had...

  9. Beam losses from ultra-peripheral nuclear collisions between $^{208}$Pb$^{82+}$ ions in the Large Hadron Collider and their alleviation

    CERN Document Server

    Bruce, R.; Jowett, J.M.; Bocian, D.; CERN. Geneva. BE Department

    2009-01-01

    Electromagnetic interactions between colliding heavy ions at the Large Hadron Collider (LHC) at CERN will give rise to localized beam losses that may quench superconducting magnets, apart from contributing significantly to the luminosity decay. To quantify their impact on the operation of the collider, we have used a three-step simulation approach, which consists of optical tracking, a Monte-Carlo shower simulation and a thermal network model of the heat flow inside a magnet. We present simulation results for the case of Pb ion operation in the LHC, with focus on the ALICE interaction region, and show that the expected heat load during nominal Pb operation is 40% above the quench level. This limits the maximum achievable luminosity. Furthermore, we discuss methods of monitoring the losses and possible ways to alleviate their effect.

  10. SU-F-T-208: An Efficient Planning Approach to Posterior Fossa Tumor Bed Boosts Using Proton Pencil Beam Scanning in Fixed-Beam Room

    Energy Technology Data Exchange (ETDEWEB)

    Ju, N; Chen, C; Gans, S; Hug, E; Cahlon, O; Chon, B; Tsai, H; Sine, K; Mah, D [Procure Treatment Center, Somerset, New Jersey (United States); Wolden, S [Memorial Sloan Kettering Cancer Center, New York, NY (United States); Yeh, B [Mount Sinai Hospital, New York, NY (United States)

    2016-06-15

    Purpose: A fixed-beam room could be underutilized in a multi-room proton center. We investigated the use of proton pencil beam scanning (PBS) on a fixed-beam as an alternative for posterior fossa tumor bed (PF-TB) boost treatments which were usually treating on a gantry with uniform scanning. Methods: Five patients were treated with craniospinal irradiation (CSI, 23.4 or 36.0 Gy(RBE)) followed by a PF-TB boost to 54 Gy(RBE) with proton beams. Three PF-TB boost plans were generated for each patient: (1) a uniform scanning (US) gantry plan with 4–7 posterior fields shaped with apertures and compensators (2) a PBS plan using bi-lateral and vertex fields with a 3-mm planning organ-at-risk volume (PRV) expansion around the brainstem and (3) PBS fields using same beam arrangement but replacing the PRV with robust optimization considering a 3-mm setup uncertainty. Results: A concave 54-Gy(RBE) isodose line surrounding the brainstem could be achieved using all three techniques. The mean V95% of the PTV was 99.7% (range: 97.6% to 100%) while the V100% of the PTV ranged from 56.3% to 93.1% depending on the involvement of the brainstem with the PTV. The mean doses received by 0.05 cm{sup 3} of the brainstem were effectively identical: 54.0 Gy(RBE), 53.4 Gy(RBE) and 53.3 Gy(RBE) for US, PBS optimized with PRV, and PBS optimized with robustness plans respectively. The cochlea mean dose increased by 23% of the prescribed boost dose in average from the bi-lateral fields used in the PBS plan. Planning time for the PBS plan with PRV was 5–10 times less than the US plan and the robustly optimized PBS plan. Conclusion: We have demonstrated that a fixed-beam with PBS can deliver a dose distribution comparable to a gantry plan using uniform scanning. Planning time can be reduced substantially using a PRV around the brainstem instead of robust optimization.

  11. Informed consent: still a useful tool in research ethics - DOI: 10.3395/reciis.v2.Sup1.208en

    Directory of Open Access Journals (Sweden)

    Florencia Luna

    2008-12-01

    Full Text Available This article dicusses informed consent (IC: its evolution, its main challenges, and its theoretical assumptions. This process involves the interrelation of IC with the history and evolution of research ethics, and with some abuses committed in biomedical research. The article also presents the objections to IC, especially those related to its implementation in developing countries. It also approaches the epistemological problems and those related to the capacity of acting, given the background conditions in which IC is obtained. Furthermore, the article exposes the traditional justification of IC as conveyed by the Belmont Report, as well as a frequent simplification of this justification that focuses only on the deliberative aspect of IC, in which the emphasis on the autonomy or deliberation supposes an inadequate view of research subjects.

  12. 33 CFR 208.11 - Regulations for use of storage allocated for flood control or navigation and/or project operation...

    Science.gov (United States)

    2010-07-01

    ... regulations as the Commission may from time to time prescribe for the protection of life, health, and property... prescribe for the protection of life, health, and property, * * * and the Licensee shall release water from... Dam & Res VA Campbell Pttsylvnia Roanoke R EQ 37.8 613.0 600.0 3235 2400 Fed Pwr Act Appl Pwr. Lemon...

  13. Search for supersymmetric particles assuming R-parity non-conservation in e(+)e(-) collisions at root s=192 to 208 GeV

    NARCIS (Netherlands)

    Abdallah, J.; Blom, M.R.; Drees, J.; Siebel, M.; van Dam, P.A.; Zupan, M.

    2004-01-01

    Searches for pair-production of supersymmetric particles under the assumption of non-conservation of R-parity with a dominant LLĒ or ŪD̄D̄ term have been performed using the data collected by the DELPHI experiment at LEP in e

  14. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  15. EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2015. Scientific Opinion on Flavouring Group Evaluation 208 Revision 1 (FGE.208Rev1): Consideration of genotoxicity data on representatives for 10 alicyclic aldehydes with the a,b-unsaturation in ring / side-chain and precursors from chemical subgroup 2.2 of FGE.19

    DEFF Research Database (Denmark)

    Beltoft, Vibe Meister; Nørby, Karin Kristiane

    genotoxicity studies on p-mentha-1,8-dien-7-al [FL-no: 05.117], the representative substance for FGE.19 subgroup 2.2. This substance was tested in vivo in a combined micronucleus assay in bone marrow and Comet assay in liver and duodenum. It did not induce any increase in micronucleated polychromatic...... erythrocytes of the bone marrow of male rats in the micronucleus test and it did not induce DNA damage in duodenum of the same animals as analysed by the Comet assay. The Comet assay performed in liver shows a positive result and therefore the Panel concluded that p-mentha-1,8-dien-7-al [FL-no: 05.......117] is genotoxic in vivo and that, accordingly, there is a safety concern for its use as flavouring substance. Since p-mentha-1,8-dien-7-al [FL-no: 05.117] is representative for the nine remaining substances of this subgroup 2.2 (p-mentha-1,8-dien-7-ol [FL-no: 02.060], myrtenol [FL-no: 02.091], myrtenal [FL-no: 05...

  16. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  17. Rayleigh LIDAR and satellite (HALOE, SABER, CHAMP and COSMIC) measurements of stratosphere-mesosphere temperature over a southern sub-tropical site, Reunion (20.8° S; 55.5° E): climatology and comparison study

    CSIR Research Space (South Africa)

    Sivakumar, V

    2011-01-01

    Full Text Available , M.: Rayleigh-Mie Lidar measurements over Re- union Island : Validation and preliminary results, 18th Interna- tional Laser Radar Conference, Berlin, Germany, 1996. Bencherif, H., Moorgawa, A., Morel, B., Michaelis, M., Leavue, J., Hauchecorne, A...

  18. INFLUENCE OF SINTERING TEMPERATURE ON THE POLARIZATION RESISTANCE OF LaO20.6SrO20.4CoO20.2FeO20.8O3-δ - SDC CARBONATE COMPOSITE CATHODE

    Directory of Open Access Journals (Sweden)

    Nurul Akidah Baharuddin

    2016-05-01

    Full Text Available The effects of sintering temperature of an LSCF-samarium-doped ceria carbonate (SDCC cathode composite film on its polarization resistance (Rp were evaluated in this study. An LSCF-SDCC composite cathode was prepared for cathode film development by electrophoretic deposition (EPD. The LSCF-SDCC composite cathode was prepared at 50:50 weight percentage ratio. An EPD suspension which is based on an organic aqueous solution was used, and a mixture of ethanol and deionized water was used as medium with poly diallyl dimethyl ammonium chloride (PDADMAC as a dispersing agent. SDCC substrate was used, and EPD was performed on both sides. A symmetrical cell with cathode composite LSCF-SDCC films on both sides of the substrate was subjected to sintering at five different temperatures (from 550°C to 750°C. A symmetrical cell was painted using silver paste before undergoing electrochemical performance test (air condition, in which the impedance, Z data, was measured. The effects of sintering temperature change on element content and film porosity were first investigated by energy-dispersive X-ray spectroscopy, field emission scanning electron microscopy, and J-image analysis. Ceramic-based cathode LSCF-SDCC that was sintered at 600°C exhibited the lowest Rp at a value of 0.68 Ω when operated at 650°C. This study proved that EPD has potential in developing IT-LT solid oxide fuel cell cathode components with high electrochemical performance in terms of Rp values.

  19. Review Plan Using the NWD Model Review Plan for Continuing Authorities Program Section 14, 107, 111, 204, 206, 208, 1135 and Projects Directed by Guidance to Use CAP Procedures: Sheridan, Wyoming, Section 1135 Project

    Science.gov (United States)

    2014-12-19

    Approval Status HEC - RAS 4.1 HEC - RAS is designed to perform one-dimensional hydraulic calculations for a full network of natural and constructed...channels. The HEC - RAS system contains four one-dimensional river analysis components for: (1) steady flow water surface profile computations; (2

  20. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific, 100 Miles North of Oahu, Hawaii for cruises HOT208-217 during 2009 (NCEI Accession 0069501)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  1. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0069177)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  2. Visual diagnosis in emergency and critical care medicine Christopher Holstege Visual diagnosis in emergency and critical care medicine Wiley Blackwell £54.99 208pp 9781444333473 144433347X [Formula: see text].

    Science.gov (United States)

    2011-12-07

    IT IS said that a picture is worth a thousand words and the proverb is endorsed by this lavishly produced book. It presents illustrations of 101 cases, ranging from a neonate with fever and rash to an older woman with groin swelling, to represent the range of patients who may present at an emergency department (ED).

  3. Nurses and Nursing: The Person and the Profession Lúanaigh Pádraig Ó Nurses and Nursing: The Person and the Profession 208pp £29.99 Routledge 781138189201 1138189200 [Formula: see text].

    Science.gov (United States)

    2017-08-23

    This textbook is unique, engaging and excellently written by a broad range of experienced international contributors, and is referenced appropriately throughout. Each chapter encourages the reader to reflect deeply on their profession and unique identity as a nurse.

  4. Essential Amino Acids Increase MicroRNA-499, -208b, and -23a and Downregulate Myostatin and Myocyte Enhancer Factor 2C mRNA Expression in Human Skeletal Muscle12

    OpenAIRE

    Drummond, Micah J.; Glynn, Erin L.; Fry, Christopher S.; Dhanani, Shaheen; Volpi, Elena; Rasmussen, Blake B

    2009-01-01

    Essential amino acids (EAA) stimulate muscle protein synthesis in humans. However, little is known about whether microRNAs (miRNA) and genes associated with muscle growth are expressed differently following EAA ingestion. Our purpose in this experiment was to determine whether miRNA and growth-related mRNA expressed in skeletal muscle are up- or downregulated in humans following the ingestion of EAA. We hypothesized that EAA would alter miRNA expression in skeletal muscle as well as select gr...

  5. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0068957)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  6. The Importance of Outdoor Activity and Place Attachment to Adolescent Development in Coös County, New Hampshire. Paper 208. New Hampshire and New England Issue Brief No. 37

    Science.gov (United States)

    Seaman, Jayson; McLaughlin, Sean

    2013-01-01

    This brief discusses the rates of participation in structured and unstructured outdoor activities as Coös County youth age, along with the relationship between outdoor activity involvement and indicators of place attachment throughout this period. The analysis is based on data collected between 2008 and 2013 as part of the Carsey Institute's Panel…

  7. AcEST: DK960887 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tein, putative OS=Arabidops... 48 5e-04 tr|Q208N7|Q208N7_ARATH Peroxisomal small heat shock protein Acd3... ...SPNLQKE 168 >tr|Q208N7|Q208N7_ARATH Peroxisomal small heat shock protein Acd31.2 (At1g06460) OS=Arabidopsis

  8. ABSOLUTE MEASUREMENT OF THE GANIL BEAM ENERGY

    NARCIS (Netherlands)

    CASANDJIAN, JM; MITTIG, W; BEUNARD, R; GAUDARD, L; LEPINESZILY, A; VILLARI, ACC; AUGER, G; BIANCHI, L; CUNSOLO, A; FOTI, A; LICHTENTHALER, R; PLAGNOL, E; SCHUTZ, Y; SIEMSSEN, RH; WIELECZKO, JP

    1993-01-01

    The energy of the GANIL cyclotron beam was measured on-line during the Pb-208 + Pb-208 elastic scattering experiment ''Search for Color van der Waals Force in the Pb-208 + Pb-208 Mott scattering'' with an absolute precision of 7 x 10(-5) at approximately 1.0 GeV, which represents an improvement of

  9. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  10. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  11. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  12. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  13. Hábitos alimentares e sobreposição trófica das raias Potamotrygon falkneri e Potamotrygon motoro (Chondrichthyes, Potamotrygonidae na planície alagável do alto rio Paraná, Brasil - DOI: 10.4025/actascibiolsci.v28i3.208 Feeding habitats and trophic overlap of the freshwater stingrays Potamotrygon falkneri e Potamotrygon motoro (Chondrichthyes, Potamotrygonidae in the upper Paraná river floodplain, Brazil - DOI: 10.4025/actascibiolsci.v28i3.208

    Directory of Open Access Journals (Sweden)

    Edson Fontes de Oliveira

    2007-11-01

    Full Text Available As raias Potamotrygon falkneri e Potamotrygon motoro foram avaliadas em relação à composição de suas dietas e a sobreposição do nicho trófico nos períodos de seca (agosto/2004 e cheia (janeiro/2005 na planície alagável do alto rio Paraná, em três estações de coleta próximas à ilha Mutum. Foram analisados 49 conteúdos estomacais de P. falkneri e 16 de P. motoro, obtidos de espécimes capturados através de pesca com anzol, fisga (arpão e espinhel. Os conteúdos estomacais foram analisados de acordo com os métodos de freqüência volumétrica e de ocorrência. A similaridade da dieta foi quantificada pelo índice de sobreposição de Pianka. As espécies revelaram flexibilidade alimentar, com ambas consumindo predominantemente moluscos na cheia, enquanto na seca a dieta de P. falkneri foi composta principalmente por peixes e a de P. motoro por insetos aquáticos. Os valores do índice de sobreposição de nicho variaram entre 0,38 na seca (moderado e 0,94 na cheia (acentuado. A variação da composição das dietas foi atribuída à s oscilações na disponibilidade dos recursos alimentares no ambiente.Feeding habits and trophic overlap of freshwater stingrays Potamotrygon falkneri e Potamotrygon motoro were evaluated in the upper Paraná river floodplain. Samples were collected during periods of drought (August/2004 and flood (January/2005 near Mutum island. Fishhook, harpoon and long line were used to capture the individuals and a total of 49 stomach contents of P. falkneri and 16 of P. motoro were analyzed. Diet composition was analyzed by the relative occurrence and volumetric frequencies. The trophic overlap was quantified by the index of niche overlap of Pianka. Results indicated that both species predominantly consumed mollusks during the flood season, while in the drought season the diet of P. falkneri was composed mainly by fish and P. motoro for aquatic insects. The values of the index of niche overlap varied from 0.38, in drought (moderate, to 0.94 in flood (accentuated. The seasonal variation of the composition of the diets was attributed to fluctuations in the availability of food resources in the floodplain.

  14. 75 FR 47259 - Northern New Mexico Resource Advisory Committee Meeting

    Science.gov (United States)

    2010-08-05

    ... Peralta, Carson National Forest, 208 Cruz Alta Road, Taos, NM 87571. Comments may also be sent via e-mail... CONTACT: RAC Coordinator USDA, Carson National Forest: Ignacio Peralta, 575-758-6344, 208 Cruz Alta Rd...

  15. 75 FR 29717 - Northern New Mexico Resource Advisory Committee Meeting

    Science.gov (United States)

    2010-05-27

    ..., New Mexico. Written comments should be sent to Ignacio Peralta, Carson National Forest, 208 Cruz Alta... Forest: Ignacio Peralta, 575-758-6344, 208 Cruz Alta Rd., Taos, NM 87571. E-mail: [email protected

  16. 75 FR 80788 - Northern New Mexico Resource Advisory Committee Meeting

    Science.gov (United States)

    2010-12-23

    .... Written comments should be sent to Ignacio Peralta, Carson National Forest, 208 Cruz Alta Road, Taos, NM... Peralta, 575-758-6344, 208 Cruz Alta Rd., Taos, NM 87571. E-mail: [email protected] . RAC Coordinator...

  17. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Aircraft source noise measurement studies summary of measurements, data and analysis for the : Cessna 182 Skylane, Cessna 208B Caravan I, Dornier 228-202, Dornier 328-100, Piper PA-42 Cheyenne III, Bell 407, Robinson R44 Raven, Schweizer 300C

    Science.gov (United States)

    2010-10-01

    The U.S. Department of Transportation, John A. Volpe National Transportation Systems Center (Volpe Center), Environmental Measurement and Modeling Division, is providing technical support to the Federal Aviation Administration (FAA), with the coopera...

  19. Tapis d’Iran, Tissage et techniques d’aujourd’hui. Préface de Sophie Desrosiers, photographies de René Ghilini. Paris, Éditions de l’Amateur, 2007, 208 p., 350 photos couleurs, bibl., glossaire.

    OpenAIRE

    Digard, Jean-Pierre

    2010-01-01

    Aucun aspect de la culture iranienne n’a suscité autant de livres, ni autant de mauvais livres, que le tapis. Le présent ouvrage fait exception par son originalité à plus d’un titre. À la différence de ses homologues qui, des tapis, ne voient que les motifs décoratifs, que l’extérieur, celui-ci les étudie de l’intérieur, pourrait-on dire, par les techniques de leur fabrication et par le travail de ceux qui les mettent en œuvre. Les auteurs sont d’autant mieux placés pour adopter ce point de v...

  20. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC208 (Link to dictyBase) - - - Contig-U16239-1 VFC208P (Link... to Original site) VFC208F 521 VFC208Z 507 VFC208P 1028 - - Show VFC208 Library VF (Link to library) Clone ID VFC208 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16239-1 Original site URL http://dict...Sequences producing significant alignments: (bits) Value N AC116989 |AC116989.2 Dictyostelium discoideum chr...nce 7 from patent US 6346406. 38 0.99 2 U90946 |U90946.1 Dictyostelium discoideum myosin heavy chain kinase

  1. ORF Alignment: NC_006270 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Bacillus licheniformis DSM 13] ... Length = 208 ... Query: 1 ... MNAIIYTRVSTAKEQQETSLKRQEEELKSLAAEHGMNVVSVISEQASGYEMDR...DGVFDLL 60 ... MNAIIYTRVSTAKEQQETSLKRQEEELKSLAAEHGMNVVSVISEQASGYEMDRDGVFDLL Sb...jct: 1 ... MNAIIYTRVSTAKEQQETSLKRQEEELKSLAAEHGMNVVSVISEQASGYEMDRDGVFDLL 60 ... Query:

  2. ORF Alignment: NC_006322 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Bacillus licheniformis DSM 13] ... Length = 208 ... Query: 1 ... MNAIIYTRVSTAKEQQETSLKRQEEELKSLAAEHGMNVVSVISEQASGYEMDR...DGVFDLL 60 ... MNAIIYTRVSTAKEQQETSLKRQEEELKSLAAEHGMNVVSVISEQASGYEMDRDGVFDLL Sb...jct: 1 ... MNAIIYTRVSTAKEQQETSLKRQEEELKSLAAEHGMNVVSVISEQASGYEMDRDGVFDLL 60 ... Query:

  3. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available y protein ... [Bradyrhizobium japonicum USDA 110] ... Length = 108 ... Query: 208 DIAILHRASRFIDQN...LGRNDLSVATICREIGVSRSVLYRVFAPLAGVADYIRGRRLEAIH 267 ... DIAILHRASRFIDQNLGRND...LSVATICREIGVSRSVLYRVFAPLAGVADYIRGRRLEAIH Sbjct: 1 ... DIAILHRASRFIDQNLGRNDLSVATICREIGVSRSVLYRVFAPLAGVADYIRGRRLEAIH 60 ...

  4. 42 CFR Appendix A to Part 81 - Glossary of ICD-9 Codes and Their Cancer Descriptions 1

    Science.gov (United States)

    2010-10-01

    ... leukemia 205 Myeloid leukemia. 206 Monocytic leukemia. 207 Other specified leukemia. 208 Leukemia of unspecified cell type. 1 The International Classification of Diseases Clinical Modification (9th Revision...

  5. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  6. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  7. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  8. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  9. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  10. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  11. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  12. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  13. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  14. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  15. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  16. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  17. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  18. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  19. A Read on Gender Inequality in China through the Perspective of Marriage and Real-estate Wealth

    DEFF Research Database (Denmark)

    Wang, Cancan

    2015-01-01

    Book review of: Leta Hong Fincher: Leftover Women: The Resurgence of Gender Inequality in China. Zed Books Ldt, 2014, 208 pages.......Book review of: Leta Hong Fincher: Leftover Women: The Resurgence of Gender Inequality in China. Zed Books Ldt, 2014, 208 pages....

  20. 40 CFR 403.9 - POTW pretreatment programs and/or authorization to revise pretreatment standards: Submission for...

    Science.gov (United States)

    2010-07-01

    ... acting in a comparable capacity (or the attorney for those POTWs which have independent legal counsel... solicit the review and comment of the appropriate 208 Planning Agency during the public comment period... nevertheless solicit the review and comment of the appropriate 208 planning agency. ...

  1. 76 FR 9540 - South Central Idaho Resource Advisory Committee; Meeting

    Science.gov (United States)

    2011-02-18

    ... Game, 319 S 417 E, Jerome, Idaho 83338. Written comments should be sent to the Sawtooth National Forest..., Idaho 83301. Visitors are encouraged to call ahead to 208-737-3200 to facilitate entry into the building..., 208-737-3200. Individuals who use telecommunication devices for the deaf (TDD) may call the Federal...

  2. 77 FR 48951 - Inviting Applications for Value-Added Producer Grants

    Science.gov (United States)

    2012-08-15

    ...) Connecticut (see Massachusetts) Delaware-Maryland USDA Rural Development State Office, 1221 College Park Drive..., (208) 378-5600/TDD (208) 378-5644. Illinois USDA Rural Development State Office, 2118 West Park Court... majority of the raw agricultural commodity that will be transformed into the proposed value-added product...

  3. Dentofacial injuries in commercial motorcycle accidents in Cameroon

    African Journals Online (AJOL)

    Department of Dentistry Faculte des sciences de la Sante, Université des Montagnes BP 208, Bangangté ... Faculty of dentistry. Universite des Montagnes. B P. 208 bagante- Cameroon. Email:agborasm@yahoo.com increased utilization of motorcycle transportation is ..... Pattern of paediatric maxillofacial fractures in La-.

  4. AcEST: DK951644 [AcEST

    Lifescience Database Archive (English)

    Full Text Available small heat shock protein Acd3... 75 5e-12 tr|A7VJH1|A7VJH1_ARATH 26-kD peroxisomal membrane protein OS=Ara....NDIRVEVDNTNLTV 222 >tr|Q208N7|Q208N7_ARATH Peroxisomal small heat shock protein Acd31.2 (At1g06460) OS=Arabi

  5. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 208 of 208 ... Vol 3, No 2 (2001): (Zoology), Valve movement behaviour and byssal formation of the mussel, Mytilus edulis in relation to environmental toxins, Abstract. Nahla S El-Shenawy, Richard Greenwood, Zohour I Nabil, Ismail M Abdel-Nabi, Raafat A Hanna. Vol 5 (2003), Variation of seed protein of Alkanna ...

  6. A Decision for War: The Formulation of English Foreign Policy from September 1754 to July 1755.

    Science.gov (United States)

    1981-07-31

    night. 48 Ibid., f. 208, Newcastle to Walpole, Claremont, 26 October 1754. 4 9Ibid., f. 208. 50William Cobbett and J. Wright, eds., The Parliamentary...Clarendon Press, 1965. Cobbett , William, and Wright, John, eds. The Parliamentary History of England, from the Earliest Period to the Year 1803. 36 vols

  7. Corrosion of carbon-alloyed iron aluminides

    Indian Academy of Sciences (India)

    Unknown

    Corrosion of carbon-alloyed iron aluminides. M SEN, R BALASUBRAMANIAM* and A V RAMESH KUMAR†. Department of Materials and Metallurgical Engineering, Indian Institute of Technology, Kanpur 208 016, India. †Defence Materials Stores and Research Development Establishment, Kanpur 208 013, India.

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 208 ... JKA Nyerere, FQ Gravenir, GS Mse. Vol 16 (2014), Detection and Quantification of Oestrogenic Endocrine Disruptors in Water in Mwanza Gulf in the Lake Victoria Basin, Tanzania, Abstract. R H Mdegela, F Mabiki, S Msigala, J Mwesongo, M P Mhina, K Waweru, P Mbuthia, D K Byarugaba. 1 - 50 of 208 ...

  9. h-p Spectral element methods for three dimensional elliptic ...

    Indian Academy of Sciences (India)

    ... Kanpur 208 016, India; Department of Mathematics, The LNM Institute of Information Technology, Jaipur 302 031, India; TIFR Centre For Applicable Mathematics, Tata Institute of Fundamental Research, Bangalore 560 065, India; Department of Aerospace Engineering, Indian Institute of Technology, Kanpur 208 016, ...

  10. Integral Experiment Request 209 CED-3a Summary Report.

    Energy Technology Data Exchange (ETDEWEB)

    Harms, Gary A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Zerkle, Michael L. [Naval Nuclear Lab., Pittsburgh, PA (United States); Miller, Thomas M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Heinrichs, David P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-07-01

    Under IER-209, critical experiments like those done under IER-208 will be performed. The difference between the two sets of experiments is that, while the IER-208 experiments were done in the 0.800 cm pitch 7uPCX hardware, the IER-209 experiments will be done in the 0.855 cm pitch 7uPCX hardware.

  11. EST Table: AV398468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398468 NV021845 10/09/28 40 %/208 aa ref|XP_001998750.1| GI23457 [Drosophila mojav...ensis] gb|EDW14211.1| GI23457 [Drosophila mojavensis] 10/08/28 40 %/208 aa FBpp0172674|DmojGI23457-PA 10/08

  12. Theoretical study on production of heavy neutron-rich isotopes around the N=126 shell closure in radioactive beam induced transfer reactions

    Directory of Open Access Journals (Sweden)

    Long Zhu

    2017-04-01

    Full Text Available In order to produce more unknown neutron-rich nuclei around N=126, the transfer reactions 136Xe + 198Pt, 136–144Xe + 208Pb, and 132Sn + 208Pb are investigated within the framework of the dinuclear system (DNS model. The influence of neutron excess of projectile on production cross sections of target-like products is studied through the reactions 136,144Xe + 208Pb. We find that the radioactive projectile 144Xe with much larger neutron excess is favorable to produce neutron-rich nuclei with charge number less than the target rather than produce transtarget nuclei. The incident energy dependence of yield distributions of fragments in the reaction 132Sn + 208Pb are also studied. The production cross sections of neutron-rich nuclei with Z=72–77 are predicted in the reactions 136–144Xe + 208Pb and 132Sn + 208Pb. It is noticed that the production cross sections of unknown neutron-rich nuclei in the reaction 144Xe + 208Pb are at least two orders of magnitude larger than those in the reaction 136Xe + 208Pb. The radioactive beam induced transfer reactions 139,144Xe + 208Pb, considering beam intensities proposed in SPIRAL2 (Production System of Radioactive Ion and Acceleration On-Line project as well, for production of neutron-rich nuclei around the N=126 shell closure are investigated for the first time. It is found that, in comparison to the stable beam 136Xe, the radioactive beam 144Xe shows great advantages for producing neutron-rich nuclei with N=126 and the advantages get more obvious for producing nuclei with less charge number.

  13. 12 CFR 222.83 - Disposal of consumer information.

    Science.gov (United States)

    2010-01-01

    ... RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Duties of Users of Consumer Reports Regarding Identity... required under sections 208.3(d) (Regulation H), 211.5(l) and 211.24(i) (Regulation K) of this chapter, to...

  14. INNOVATION: A NECESSARY PROCESS FOR SMALL AND MEDIUM COMPANIES OF SAN JOSE DE CUCUTA MUNICIPALITY, NORTE DE SANTANDER (COLOMBIA)

    National Research Council Canada - National Science Library

    William R Avendaño C

    2012-01-01

      AVENDANO C., William R.. INNOVATION: A NECESSARY PROCESS FOR SMALL AND MEDIUM COMPANIES OF SAN JOSE DE CUCUTA MUNICIPALITY, NORTE DE SANTANDER (COLOMBIA). Semest. Econ. [online]. 2012, vol.15, n.31, pp. 187-208. ISSN 0120-6346...

  15. 1983 Coalinga, USA Images

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Location: Central California, 20.8 kilometers from Coalinga. Affected area: 205,000 square kilometers. Damage: $31 million. The most serious damage occurred in the...

  16. Handbook of knotting and splicing

    CERN Document Server

    Hasluck, Paul N

    2005-01-01

    Clearly written and amply illustrated with 208 figures, this classic guide ranges from simple and useful knots to complex varieties. Additional topics include rope splicing, working cordage, hammock making, more.

  17. Apparatus for converting hydrocarbon fuel into hydrogen gas and carbon dioxide

    Science.gov (United States)

    Clawson, Lawrence G.; Mitchell, William L.; Bentley, Jeffrey M.; Thijssen, Johannes H. J.

    2001-01-01

    A hydrocarbon fuel reformer (200) is disclosed suitable for producing synthesis hydrogen gas from reactions with hydrocarbons fuels, oxygen, and steam. The reformer (200) comprises first and second tubes (208,218). The first tube (208) includes a first catalyst (214) and receives a first mixture of steam and a first fuel. The second tube (218) is annularly disposed about the first tube (208) and receives a second mixture of an oxygen-containing gas and a second fuel. In one embodiment, a third tube (224) is annularly disposed about the second tube (218) and receives a first reaction reformate from the first tube (208) and a second reaction reformate from the second tube (218). A catalyst reforming zone (260) annularly disposed about the third tube (224) may be provided to subject reformate constituents to a shift reaction. In another embodiment, a fractionator is provided to distill first and second fuels from a fuel supply source.

  18. 75 FR 54216 - CSX Transportation, Inc.-Abandonment Exemption―in Clay County, KY

    Science.gov (United States)

    2010-09-03

    ... (Sub-No. 704X)] CSX Transportation, Inc.--Abandonment Exemption[horbar]in Clay County, KY CSX... Manchester, Clay County, KY. The following stations are located on the line: (1) Claymont, milepost 0CF208...

  19. Associateship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    , Dr Manindra. Date of birth: 20 May 1966. Specialization: Computer Science and Engineering Address during Associateship: Dept. of Computer Science & Engg., Indian Institute of Technology, Kanpur 208 016. YouTube; Twitter; Facebook ...

  20. Chaos-Introduction to Chaos

    Indian Academy of Sciences (India)

    Author Affiliations. K Krishan1 Manu2 R Ramaswamy2. Department of Physics, Indian Institute of Technology, Kanpur 208 016, India. School of Physical Sciences, Jawaharlal Nehru University, New Delhi 110 067, India ...