WorldWideScience

Sample records for astatine 201

  1. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  2. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  3. Adsorption interaction of astatine species with quartz and gold surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Serov, A. [Paul Scherrer Institute, Villigen (Switzerland). Lab. for Radiochemistry and Environmental Chemistry; Bern Univ. (Switzerland). Dept. for Chemistry and Biochemistry; Aksenov, N.; Bozhikov, G. [Joint Institute for Nuclear Research, Dubna (RU). Flerov Lab. of Nuclear Reactions] (and others)

    2011-07-01

    The adsorption interaction of various astatine species with quartz and gold surfaces was investigated by gas chromatography methods. Due to variations of the redox potential of the carrier gas elemental astatine, astatine oxide and hypo-astatic acid have been produced. The identification of the astatine compounds is based on the analogy assumption to the gas phase chemistry of the closest homologues in group 17 of the periodic table, iodine and bromine. The deposition temperatures as well as enthalpies of adsorption have been determined for the astatine species. The enhancement of the metallic character within group 17 towards higher Z is clearly confirmed. Macroscopic properties (sublimation enthalpy) of previously unstudied AtO{sub 2} and HAtO were estimated. The determined data for elemental astatine were compared to available literature data. Based on the obtained experimental results possible designs of experiments for studying of chemical properties of the recently discovered element 117 can be suggested. (orig.)

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  7. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  9. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom;

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...

  12. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  13. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  14. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  15. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  16. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  17. Main: SAD201 [AT Atlas

    Lifescience Database Archive (English)

    Full Text Available SAD201 SAD2 Diversification of protein structural analysis technologies by the SAIL... method Diversification of protein structural analysis technologies by the SAIL method Masatsune Kainosho Graduate School of Science, Nagoya University SAD201.csml ...

  18. 21 CFR 201.71 - Magnesium labeling.

    Science.gov (United States)

    2010-04-01

    ...-restricted diet”. The warnings in §§ 201.64(c), 201.70(c), 201.71(c), and 201.72(c) may be combined, if...-restricted diet. 1 See § 201.66(b)(4) of this chapter for definition of bullet symbol. (d) Any...

  19. 21 CFR 201.72 - Potassium labeling.

    Science.gov (United States)

    2010-04-01

    ...-restricted diet”. The warnings in §§ 201.64(c), 201.70(c), 201.71(c), and 201.72(c) may be combined, if...-restricted diet. 1 See § 201.66(b)(4) of this chapter for definition of bullet symbol. (d) Any...

  20. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  1. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  2. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  3. 7 CFR 201.42 - Small containers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Small containers. 201.42 Section 201.42 Agriculture... REGULATIONS Sampling in the Administration of the Act § 201.42 Small containers. In sampling seed in small containers that it is not practical to sample as required in § 201.41, a portion of one unopened container...

  4. 21 CFR 201.70 - Calcium labeling.

    Science.gov (United States)

    2010-04-01

    ... diet”. The warnings in §§ 201.64(c), 201.70(c), 201.71(c), and 201.72(c) may be combined, if applicable, provided the ingredients are listed in alphabetical order, e.g., a calcium or sodium restricted diet. 1...

  5. Main: PPD201 [AT Atlas

    Lifescience Database Archive (English)

    Full Text Available roaki Kato Graduate School of Pharmaceutical Sciences, Kyoto University Nat Protoc (2006)|Protein Expr. Purif. (2009)|Biotechnol. Prog. (1996) 17406338|8845106|18984054 PPD201.csml ...

  6. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  7. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  8. Production of Thallium 201 for medical applications

    International Nuclear Information System (INIS)

    With the purpose of producing high purity carrier-free 201Tl, for medical use, a production and separation method was developed using the CV-28 Cyclotron of the Nuclear Engineering Institute in Rio de Janeiro, Brazil. 201Pb was produced by 24 MeV proton bombardment of natural Tl and allowed to decay to 201Tl. In the separation process the target is dissolved in HNO3, the 201Pb produced is separated by Fe(OH)3 coprecipitation, and the Fe is latter separated by anion exchange. The 201Pb is permited to decay during 32 hrs. 201Tl is then separated from remaining Pb by anion exchange. The chemical separation is done in a remote processing cell using manipulators, tongs, electric and pneumatic systems. The thick target yield of 201Pb is 1.7 mCi/μAhr. At the moment the production is restricted to 4 mCi of 201Tl for each irradiation. (Author)

  9. 48 CFR 841.201 - Policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Policy. 841.201 Section 841.201 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS SPECIAL CATEGORIES OF... legal review....

  10. Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death

    Energy Technology Data Exchange (ETDEWEB)

    Claesson, Kristina

    2011-05-15

    In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At

  11. 44 CFR 201.1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Purpose. 201.1 Section 201.1 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE MITIGATION PLANNING § 201.1 Purpose. (a) The purpose of this part is to...

  12. 7 CFR 1206.201 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... INFORMATION Rules and Regulations § 1206.201 Definitions. Organic Act means section 2103 of the Organic Foods... 7 Agriculture 10 2010-01-01 2010-01-01 false Definitions. 1206.201 Section 1206.201 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING...

  13. 5 CFR 891.201 - Election.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Election. 891.201 Section 891.201... FEDERAL EMPLOYEES HEALTH BENEFITS Election and Change of Election § 891.201 Election. (a) The original period for election by each eligible retired employee was during the months of March and April...

  14. 48 CFR 2131.201-5 - Credits.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Credits. 2131.201-5 Section... PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 2131.201-5 Credits. The provisions of FAR 31.201-5 shall apply to income, rebates and other credits resulting from benefit payments...

  15. 48 CFR 1631.201-70 - Credits.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Credits. 1631.201-70... AND PROCEDURES Contracts With Commercial Organizations 1631.201-70 Credits. The provisions of FAR 31.201-5 shall apply to income, rebates, allowances, and other credits resulting from benefit...

  16. 7 CFR 201.3 - Administrator.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Administrator. 201.3 Section 201.3 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS Administration § 201.3 Administrator. The Administrator of the Agricultural Marketing Service...

  17. 43 CFR 20.201 - Ethics officials.

    Science.gov (United States)

    2010-10-01

    ... Department Ethics Program § 20.201 Ethics officials. (a) Designated Agency Ethics Official refers to the official designated under 5 CFR 2638.201 to coordinate and manage the Department's ethics program. (b) The... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Ethics officials. 20.201 Section...

  18. 23 CFR 620.201 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Purpose. 620.201 Section 620.201 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS ENGINEERING Relinquishment of Highway Facilities § 620.201 Purpose. To prescribe Federal Highway Administration...

  19. 17 CFR 201.58 - Judicial review.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Judicial review. 201.58 Section 201.58 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Regulations Pertaining to the Equal Access to Justice Act § 201.58 Judicial review. Judicial review of...

  20. 17 CFR 201.57 - Commission review.

    Science.gov (United States)

    2010-04-01

    ... Regulations Pertaining to the Equal Access to Justice Act § 201.57 Commission review. In accordance with the procedures set forth in 17 CFR 201.410 and 201.411, either the applicant or counsel for the Office or... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Commission review....

  1. 7 CFR 22.201 - Coordination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Coordination. 22.201 Section 22.201 Agriculture Office of the Secretary of Agriculture RURAL DEVELOPMENT COORDINATION Roles and Responsibilities of Federal Government § 22.201 Coordination. The following identifies types and levels of coordination: (a)...

  2. 19 CFR 201.0 - Seal.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Seal. 201.0 Section 201.0 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION § 201.0 Seal. (a) Pursuant to... Trade Commission has adopted an official seal, the depiction of which follows: EC05OC91.026 (b)...

  3. 4 CFR 201.13 - Business information.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Business information. 201.13 Section 201.13 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.13 Business information. (a) In general. Business information obtained by the Board from a submitter shall be...

  4. 44 CFR 201.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Definitions. 201.2 Section 201.2 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE MITIGATION PLANNING § 201.2 Definitions. Administrator means the head of...

  5. 7 CFR 718.201 - Farm constitution.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Farm constitution. 718.201 Section 718.201 Agriculture... Reconstitution of Farms, Allotments, Quotas, and Bases § 718.201 Farm constitution. (a) In order to implement... this section. The constitution and identification of land as a farm for the first time and...

  6. 14 CFR 1214.201 - Definition.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Definition. 1214.201 Section 1214.201... the STS Program § 1214.201 Definition. For the purpose of this subpart, the term users means: (a) For... observer nations participating in Spacelab development, and Canada, when conducting experimental science...

  7. 48 CFR 201.403 - Individual deviations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Individual deviations. 201.403 Section 201.403 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Individual deviations. (1) Individual deviations, except those described in 201.402(1) and paragraph (2)...

  8. 40 CFR 243.201 - Safety.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety....

  9. 40 CFR 240.201-1 - Requirement.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirement. 240.201-1 Section 240.201-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.201-1...

  10. 7 CFR 1260.201 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1260.201 Section 1260.201 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... Promotion and Research Order Reports, Books and Records § 1260.201 Reports. Each importer, person...

  11. 48 CFR 201.105-3 - Copies.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Copies. 201.105-3 Section 201.105-3 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL FEDERAL ACQUISITION REGULATIONS SYSTEM Purpose, Authority, Issuance 201.105-3 Copies....

  12. 28 CFR 20.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Purpose. 20.1 Section 20.1 Judicial Administration DEPARTMENT OF JUSTICE CRIMINAL JUSTICE INFORMATION SYSTEMS General Provisions § 20.1 Purpose. It is the purpose of these regulations to assure that criminal history record information wherever...

  13. 50 CFR 300.201 - Definition.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Definition. 300.201 Section 300.201 Wildlife and Fisheries INTERNATIONAL FISHING AND RELATED ACTIVITIES INTERNATIONAL FISHERIES REGULATIONS Definition of Illegal, Unreported, or Unregulated Fishing § 300.201 Definition. Illegal, unreported,...

  14. 7 CFR 201.50 - Weed seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seed. 201.50 Section 201.50 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.50 Weed seed. Seeds (including bulblets...

  15. 40 CFR 88.201-94 - Scope.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Scope. 88.201-94 Section 88.201-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CLEAN-FUEL VEHICLES California Pilot Test Program § 88.201-94 Scope. Applicability. The requirements of this...

  16. 49 CFR 377.201 - Scope.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Scope. 377.201 Section 377.201 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION... Forwarders § 377.201 Scope. (a) General. These regulations apply to the extension of credit in...

  17. 5 CFR 731.201 - Standard.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Standard. 731.201 Section 731.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) SUITABILITY Suitability Determinations and Actions § 731.201 Standard. The standard for a suitability...

  18. 7 CFR 201.19 - Inert matter.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Inert matter. 201.19 Section 201.19 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.19 Inert matter. The label shall show the percentage by weight of inert matter....

  19. 49 CFR 382.201 - Alcohol concentration.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Alcohol concentration. 382.201 Section 382.201... ALCOHOL USE AND TESTING Prohibitions § 382.201 Alcohol concentration. No driver shall report for duty or... concentration of 0.04 or greater. No employer having actual knowledge that a driver has an alcohol...

  20. 5 CFR 300.201 - Examinations.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Examinations. 300.201 Section 300.201...) Examinations and Related Subjects § 300.201 Examinations. (a) The Office makes available information that will... examinations. This includes the types of questions and the categories of knowledge or skill pertinent to...

  1. 31 CFR 800.201 - Business day.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Business day. 800.201 Section 800.201 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.201 Business day. The term business day means Monday through...

  2. 7 CFR 201.21 - Hard seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seed. 201.21 Section 201.21 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.21 Hard seed. The label shall show the percentage of hard seed... percentage of hard seed shall not be included as part of the germination percentage....

  3. 7 CFR 201.57 - Hard seeds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seeds. 201.57 Section 201.57 Agriculture... REGULATIONS Germination Tests in the Administration of the Act § 201.57 Hard seeds. Seeds which remain hard at..., are to be counted as “hard seed.” If at the end of the germination period provided for legumes,...

  4. 7 CFR 201.30 - Hard seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seed. 201.30 Section 201.30 Agriculture... REGULATIONS Labeling Vegetable Seeds § 201.30 Hard seed. The label shall show the percentage of hard seed, if... percentage of hard seed shall not be included as part of the germination percentage....

  5. 7 CFR 201.63 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.63 Section 201.63 Agriculture... REGULATIONS Tolerances § 201.63 Germination. The following tolerances are applicable to the percentage of germination and also to the sum of the germination plus the hard seed when 400 or more seeds are tested....

  6. 7 CFR 201.6 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.6 Section 201.6 Agriculture... REGULATIONS Records for Agricultural and Vegetable Seeds § 201.6 Germination. The complete record shall include the records of all laboratory tests for germination and hard seed for each lot of seed offered...

  7. 7 CFR 201.20 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.20 Section 201.20 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.20 Germination. The label shall show the percentage of germination each kind, or kind and variety, or kind and type, or kind and hybrid of agricultural seed...

  8. 17 CFR 201.104 - Business hours.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Business hours. 201.104 Section 201.104 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice General Rules § 201.104 Business hours. The Headquarters office of the Commission,...

  9. 7 CFR 765.201 - General policy.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false General policy. 765.201 Section 765.201 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS DIRECT LOAN SERVICING-REGULAR Protecting the Agency's Security Interest § 765.201...

  10. 28 CFR 31.201 - Audit.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Audit. 31.201 Section 31.201 Judicial Administration DEPARTMENT OF JUSTICE OJJDP GRANT PROGRAMS Formula Grants General Requirements § 31.201 Audit. The State must assure that it adheres to the audit requirements enumerated in the “Financial...

  11. Dicty_cDB: CHR201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR201 (Link to dictyBase) - - - Contig-U16427-1 CHR201P (Link to Original site) CHR...201F 614 CHR201Z 157 CHR201P 751 - - Show CHR201 Library CH (Link to library) Clone ID CHR... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHR2-A/CHR201Q.Seq.d/ Representative seq. ID CHR...201P (Link to Original site) Representative DNA sequence >CHR201 (CHR201Q) /CSM/CH/CHR2-A/CHR2...xr*i*ric*kx Frame B: fncvivlcvyfg*ytlyiyiiq*nviffrtdfrkdgfhr*ry*ihgns*sck*irkryf*

  12. 7 CFR 201.11a - Hybrid.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hybrid. 201.11a Section 201.11a Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.11a Hybrid. If any one kind or kind and variety of seed present in excess of 5 percent is “hybrid” seed, it shall be designated “hybrid” on the label. The...

  13. 48 CFR 31.201-5 - Credits.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Credits. 31.201-5 Section... REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 31.201-5 Credits. The applicable portion of any income, rebate, allowance, or other credit relating to any...

  14. 9 CFR 205.201 - System operator.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false System operator. 205.201 Section 205.201 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM...

  15. 5 CFR 412.201 - Management succession.

    Science.gov (United States)

    2010-01-01

    ..., MANAGEMENT, AND EXECUTIVE DEVELOPMENT Succession Planning § 412.201 Management succession. The head of each agency, in consultation with OPM, must develop a comprehensive management succession program, based on... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Management succession. 412.201...

  16. 44 CFR 201.3 - Responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Responsibilities. 201.3... HOMELAND SECURITY DISASTER ASSISTANCE MITIGATION PLANNING § 201.3 Responsibilities. (a) General. This section identifies the key responsibilities of FEMA, States, and local/tribal governments in carrying...

  17. Brain SPECT with Tl-201 DDC

    International Nuclear Information System (INIS)

    The development, animal and human experiments and the first clinical results of a new blood flow tracer thallium-201 diethyldithiocarbamate (Tl-201 DDC) are discussed for functional brain imaging with single-photon emission computed tomography (SPECT). 325 refs.; 43 figs.; 22 tabs

  18. 27 CFR 24.201 - Formula required.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Formula required. 24.201... OF THE TREASURY LIQUORS WINE Production of Agricultural Wine § 24.201 Formula required. Before producing any agricultural wine, the proprietor shall obtain an approval of the formula and process by...

  19. 48 CFR 1419.201 - General policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false General policy. 1419.201... SMALL BUSINESS PROGRAMS Policies 1419.201 General policy. HCAs, without the power of redelegation, shall... by August 15th for the next fiscal year. To the greatest extent possible, the goals shall be based...

  20. 48 CFR 1519.201 - Policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Policy. 1519.201 Section... SMALL BUSINESS PROGRAMS Policies 1519.201 Policy. Each program's Assistant or Associate Administrator shall be responsible for developing its socioeconomic goals on a fiscal year basis. The goals shall...

  1. 48 CFR 819.201 - General policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false General policy. 819.201... PROGRAMS SMALL BUSINESS PROGRAMS Policies 819.201 General policy. The Secretary shall establish goals for each fiscal year for participation in Department contracts by SDVOSBs and VOSBs. In order to...

  2. 5 CFR 179.201 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... the Office of Personnel Management (OPM) on July 3, 1984 (49 FR 27470) in 5 CFR part 550, subpart K. ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Purpose. 179.201 Section 179.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION...

  3. 24 CFR 201.31 - Insurance charge.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance charge. 201.31 Section... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Insurance of Loans § 201.31 Insurance charge....

  4. 46 CFR 199.201 - Survival craft.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft. 199.201 Section 199.201 Shipping COAST... craft. (a) Each survival craft must be approved and equipped as follows: (1) Each lifeboat must be... addition to the survival craft required in paragraph (b)(1) of this section, additional liferafts must...

  5. 7 CFR 1430.201 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1430.201 Section 1430.201 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... Administration. (a) This program is administered under the general supervision of the Executive Vice...

  6. 27 CFR 40.201 - Inventories.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Inventories. 40.201... PROCESSED TOBACCO Operations by Manufacturers of Tobacco Products Inventories and Reports § 40.201 Inventories. Every manufacturer of tobacco products shall make true and accurate inventories on Form...

  7. 48 CFR 201.170 - Peer Reviews.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Peer Reviews. 201.170... OF DEFENSE GENERAL FEDERAL ACQUISITION REGULATIONS SYSTEM Purpose, Authority, Issuance 201.170 Peer... Procurement and Acquisition Policy, will organize teams of reviewers and facilitate Peer Reviews...

  8. 29 CFR 1952.201 - Developmental schedule.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Developmental schedule. 1952.201 Section 1952.201 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... schedule. (a) Retraining of present occupational safety and health personnel during March-May 1973;...

  9. Dicty_cDB: VFG201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFG201 (Link to dictyBase) - - - Contig-U16455-1 VFG201P (Link to Original site) VFG20...1F 186 VFG201Z 594 VFG201P 780 - - Show VFG201 Library VF (Link to library) Clone ID VFG20... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFG2-A/VFG201Q.Seq.d/ Representative seq. ID VFG20...1P (Link to Original site) Representative DNA sequence >VFG201 (VFG201Q) /CSM/VF/VFG2-A/VFG20...KAPGKAG DKKGAAAPSKKK*ii*kkfy Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VFG201 (VFG20

  10. 48 CFR 30.201-3 - Solicitation provisions.

    Science.gov (United States)

    2010-10-01

    ... Development Center (FFRDC) (see 48 CFR 9903.201-2(c)(5) (FAR appendix)), or the provision at 48 CFR 9903.201-2... Accounting Practice Changes, in solicitations for contracts subject to CAS as specified in 48 CFR 9903.201... specified in 48 CFR 9903.201 (FAR appendix). (b) If an award to an educational institution is...

  11. Dicty_cDB: VHO201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT

  12. Excitation functions of reactions of production of radioisotopes 201Tl, 201Pb, 201Bi (experimental and theoretical data)

    International Nuclear Information System (INIS)

    The results of calculations of charged particle induced reactions for the production of neutron deficient radioisotopes 201Tl, 201Pb, 201Bi and concomitant ones are discussed. The excitation functions for reactions 202Hg(p,xn), 197Au(a,xn), 203,205Tl(p,xn), 203,205Tl(d,xn), 203,205Tl(p,pxn), 204Pb(p,xn), 204Pb(p,p3n), 206Pb(p,6n), 206Pb(p,p5n), 207Pb(p,7n), 207Pb(p,p6n), 208Pb(p,xn) and 208Pb(p,p7n) are calculated on the base of statistical model in energy range up to 80 MeV. For the most reactions producing 201Tl the data on the calculated and practical yields under optimum conditions are given and the main admixture levels are pointed out. 30 refs., 9 figs

  13. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  14. 7 CFR 1219.201 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., AND INFORMATION Rules and Regulations § 1219.201 Definitions. Organic Act means section 2103 of the Organic Foods Production Act of 1990 (7 U.S.C. 6502). ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING...

  15. 23 CFR 230.201 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL PROGRAMS Supportive Services for Minority, Disadvantaged, and Women Business Enterprises § 230.201 Purpose. To prescribe the... programs for minority, disadvantaged, and women business enterprises....

  16. 48 CFR 1341.201 - Policy.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTING ACQUISITION OF UTILITY SERVICES Acquiring Utility Services 1341.201 Policy. The designee authorized to enter into a contract pursuant to 42 U.S.C. 8287 (regarding shared energy savings,...

  17. 14 CFR 171.201 - Scope.

    Science.gov (United States)

    2010-01-01

    ... FACILITIES NON-FEDERAL NAVIGATION FACILITIES VHF Marker Beacons § 171.201 Scope. (a) This subpart sets forth minimum requirements for the approval and operation of non-Federal VHF marker beacon facilities that...

  18. Studies on 201Th myocardial scintiscanning

    International Nuclear Information System (INIS)

    The diagnostical evidence of myocardial scintiscanning with thallium-201 was tested on 98 patients with coronary heart disease. 2 mCi thallium-201 were injected into an arm vene and then scintigrams of the heart were registered partly with a scanner, partly with a gamma camera in several views. The healthy myocardium was found in the thallium-201-scintigram to be a rather homogeneous, horeshoe-shaped activity pattern with intramyocardial activity differences of up to 20% of the maximal thallium-201-activity above the myocard which can be declared to be physiological. In dependency on the local blood flow conditions, thallium-201 is stored only in the healthy, but not in the ischaemic or infarcted myocardium. In the scintigram, these regions are seen as regions with reduced radioactivity. A comparison of the localisation of the infarction in the scintigram with those in the electrocardiagram and coronary angiogram showed a good congrucucy. Scintigrams taken at different times after the infarction brought a decrease in the number of diagnosed storage failures, from 90% to 68% in infarctions older than 6 weeks. A scintigraphical differentiation between fresh and old infarctions was not possible. In cases of angiographically established coronary heart disease without infarction, pathological storage reductions were observed. By comparing the findings obtained by scintiscanning with the results of laevocardiography it was seen that hypokinetic regions in the thallium-201-myocardial scintigram showed in only 6% of the cases a pathological storage defect; akinetic, dyskinetic, and aneurysmatic regions, however, were seen in 65% of the cases as clear activity reductions or failures. (orig./MG)

  19. 44 CFR 201.5 - Enhanced State Mitigation Plans.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Enhanced State Mitigation Plans. 201.5 Section 201.5 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE MITIGATION PLANNING § 201.5 Enhanced State...

  20. 44 CFR 201.4 - Standard State Mitigation Plans.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Standard State Mitigation Plans. 201.4 Section 201.4 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE MITIGATION PLANNING § 201.4 Standard State...

  1. 44 CFR 201.7 - Tribal Mitigation Plans.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Tribal Mitigation Plans. 201.7 Section 201.7 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE MITIGATION PLANNING § 201.7 Tribal Mitigation Plans....

  2. 46 CFR 201.20 - Attorneys at law.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Attorneys at law. 201.20 Section 201.20 Shipping... PROCEDURE Appearance and Practice Before the Administration (Rule 2) § 201.20 Attorneys at law. Attorneys at law who are admitted to practice before the Federal courts or before the courts of any State...

  3. 9 CFR 201.72 - Scales; testing of.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Scales; testing of. 201.72 Section 201.72 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND... § 201.72 Scales; testing of. (a) Each stockyard owner, market agency, dealer, packer, or live...

  4. 46 CFR 108.201 - Size of sleeping spaces.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Size of sleeping spaces. 108.201 Section 108.201... AND EQUIPMENT Construction and Arrangement Accommodation Spaces § 108.201 Size of sleeping spaces. (a) No sleeping space may berth more than four persons, except that a sleeping space for personnel...

  5. 21 CFR 201.6 - Drugs; misleading statements.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs; misleading statements. 201.6 Section 201.6 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING General Labeling Provisions § 201.6 Drugs; misleading statements. (a)...

  6. 48 CFR 3036.201 - Evaluation of contractor performance.

    Science.gov (United States)

    2010-10-01

    ...) 48 CFR 36.201. Access to reports is through the CPS or the government-wide system, Past Performance... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Evaluation of contractor performance. 3036.201 Section 3036.201 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND...

  7. 48 CFR 2936.201 - Evaluation of contractor performance.

    Science.gov (United States)

    2010-10-01

    ... Construction 2936.201 Evaluation of contractor performance. The HCA must establish procedures to evaluate... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Evaluation of contractor performance. 2936.201 Section 2936.201 Federal Acquisition Regulations System DEPARTMENT OF LABOR...

  8. Thallium-201 uptake in Langerhans` cell histiocytosis of bone

    Energy Technology Data Exchange (ETDEWEB)

    Bar-Sever, Z. [Division of Nuclear Medicine, Department of Radiology, Children`s Hospital and Harvard Medical School, Boston, MA (United States); Connolly, L.P. [Division of Nuclear Medicine, Department of Radiology, Children`s Hospital and Harvard Medical School, Boston, MA (United States); Jaramillo, D. [Division of Nuclear Medicine, Department of Radiology, Children`s Hospital and Harvard Medical School, Boston, MA (United States); Treves, S.T. [Division of Nuclear Medicine, Department of Radiology, Children`s Hospital and Harvard Medical School, Boston, MA (United States)

    1996-10-01

    A case in which there was thallium-201 ({sup 201}Tl) uptake in Langerhans` cell histiocytosis (LCH) of the left femoral diaphysis is presented. The authors propose that {sup 201}Tl scintigraphy is potentially useful in the diagnosis and follow-up of patients with LCH. (orig.). With 4 figs.

  9. 30 CFR 77.201 - Methane content in surface installations.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Methane content in surface installations. 77.201 Section 77.201 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL... UNDERGROUND COAL MINES Surface Installations § 77.201 Methane content in surface installations. The...

  10. 10 CFR 63.201 - Purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Purpose and scope. 63.201 Section 63.201 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC REPOSITORY AT YUCCA MOUNTAIN, NEVADA Preclosure Public Health and Environmental Standards § 63.201 Purpose and scope....

  11. 7 CFR 868.201 - Definition of rough rice.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of rough rice. 868.201 Section 868.201... FOR CERTAIN AGRICULTURAL COMMODITIES United States Standards for Rough Rice Terms Defined § 868.201 Definition of rough rice. Rice (Oryza sativa L.) which consists of 50 percent or more of paddy kernels...

  12. Thallium-201 uptake in Langerhans' cell histiocytosis of bone

    International Nuclear Information System (INIS)

    A case in which there was thallium-201 (201Tl) uptake in Langerhans' cell histiocytosis (LCH) of the left femoral diaphysis is presented. The authors propose that 201Tl scintigraphy is potentially useful in the diagnosis and follow-up of patients with LCH. (orig.). With 4 figs

  13. 46 CFR 201.131 - Presentation of evidence.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Presentation of evidence. 201.131 Section 201.131... PRACTICE AND PROCEDURE Hearing Procedures (Rule 13) § 201.131 Presentation of evidence. (a) Testimony... specifically encouraged to cooperate with each other in joint presentations particularly in such items as...

  14. 14 CFR 1203.201 - Information security objectives.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Information security objectives. 1203.201 Section 1203.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INFORMATION SECURITY PROGRAM NASA Information Security Program § 1203.201 Information security objectives. The objectives...

  15. 40 CFR 1065.201 - Overview and general provisions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Overview and general provisions. 1065.201 Section 1065.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS ENGINE-TESTING PROCEDURES Measurement Instruments § 1065.201 Overview and...

  16. Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Tonami, N.; Matsuda, H.; Ooba, H.; Yokoyama, K.; Hisada, K.; Ikeda, K.; Yamashita, J. (Kanazawa Univ. (Japan))

    1990-06-01

    The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared.

  17. 7 CFR 1437.201 - Prevented planting acreage.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Prevented planting acreage. 1437.201 Section 1437.201... Determining Coverage for Prevented Planted Acreage § 1437.201 Prevented planting acreage. (a) In addition to... determining losses under this section: (1) Producers must be prevented from planting more than 35 percent...

  18. 19 CFR 201.40 - Records-retention requirements.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Records-retention requirements. 201.40 Section 201.40 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Opening Commission Meetings to Public Observation Pursuant to 5 U.S.C. 552b § 201.40...

  19. 37 CFR 201.1 - Communication with the Copyright Office.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Communication with the Copyright Office. 201.1 Section 201.1 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.1 Communication with the Copyright...

  20. 46 CFR 201.117 - Inclusion in record.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part...

  1. 21 CFR 201.61 - Statement of identity.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.61 Section 201.61 Food...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.61 Statement of identity. (a) The... features a statement of the identity of the commodity. (b) Such statement of identity shall be in terms...

  2. 7 CFR 201.64 - Pure live seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Pure live seed. 201.64 Section 201.64 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.64 Pure live seed. The tolerance for pure live seed shall be determined...

  3. 7 CFR 201.24a - Inoculated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Inoculated seed. 201.24a Section 201.24a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.24a Inoculated seed. Seed claimed to be inoculated shall...

  4. 7 CFR 201.7a - Treated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Treated seed. 201.7a Section 201.7a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Records for Agricultural and Vegetable Seeds § 201.7a Treated seed. The complete record for...

  5. 7 CFR 201.69 - Classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Classes of certified seed. 201.69 Section 201.69..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.69 Classes of certified seed. (a) Classes of certified seed are as...

  6. 7 CFR 201.49 - Other crop seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Other crop seed. 201.49 Section 201.49 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.49 Other crop seed. (a) Seeds of...

  7. 40 CFR 246.201-4 - Recommended procedures: Market study.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Market study. 246.201-4 Section 246.201-4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 246.201-4 Recommended procedures: Market study. An investigation of markets should be made for...

  8. Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT

    International Nuclear Information System (INIS)

    The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared

  9. 46 CFR 201.8 - Use of gender and number.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Use of gender and number. 201.8 Section 201.8 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE General Information (Rule 1) § 201.8 Use of gender and number. Words importing the singular...

  10. 46 CFR 201.6 - Documents in foreign languages.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Documents in foreign languages. 201.6 Section 201.6... PRACTICE AND PROCEDURE General Information (Rule 1) § 201.6 Documents in foreign languages. Every document, exhibit, or other paper written in a language other than English and filed with the Administration...

  11. 14 CFR 23.201 - Wings level stall.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Wings level stall. 23.201 Section 23.201... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Flight Stalls § 23.201 Wings level... airplane stalls. (b) The wings level stall characteristics must be demonstrated in flight as...

  12. 14 CFR 1206.201 - Records which have been published.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Records which have been published. 1206.201 Section 1206.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION AVAILABILITY OF AGENCY RECORDS TO MEMBERS OF THE PUBLIC Records Available § 1206.201 Records which have been...

  13. 21 CFR 201.116 - Drugs having commonly known directions.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs having commonly known directions. 201.116 Section 201.116 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.116 Drugs...

  14. 7 CFR 201.54 - Number of seeds for germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Number of seeds for germination. 201.54 Section 201.54... REGULATIONS Germination Tests in the Administration of the Act § 201.54 Number of seeds for germination. At least 400 seeds shall be tested for germination; except that in mixtures, 200 seeds of each of...

  15. 21 CFR 201.127 - Drugs; expiration of exemptions.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs; expiration of exemptions. 201.127 Section 201.127 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.127 Drugs;...

  16. 22 CFR 201.41 - Audit and inspection.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Audit and inspection. 201.41 Section 201.41...-Related Services § 201.41 Audit and inspection. The borrower/grantee shall maintain records adequate to... to identify the importer (or the first purchaser or transferee if the commodity is imported by...

  17. 49 CFR 179.201-3 - Lined tanks.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Lined tanks. 179.201-3 Section 179.201-3... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.201-3 Lined tanks. (a)...

  18. Clinical features and applications of thallium-201

    International Nuclear Information System (INIS)

    Thallium-201 is not only used widely in myocardial imaging but also has a great potential in other various nuclear medicine imaging studies. This paper presents clinical features and applications of thallium-201, focusing on clinical trials with thallium-201 at the Shinshu University School of Medicine. Thallium-201 myocardial scintigraphy offers information on 1) ventricular position and morphology, 2) hypertrophy or dilatation of the left ventricle, 3) hypertrophy or dilatation of the right ventricle, 4) site and extent of myocardial ischemia and infarct, 5) myocardial blood flow, 6) pulmonary congestion or interstitial pulmonary edema, and 7) pericardial effusion. It can be used in the following evaluation or diagnosis: 1) acute or old myocardial infarction, 2) angina pectoris, 3) treatment strategy or prognosis of ischemic heart disease, 4) treatment strategy or observation of bypass graft or drug therapy, 5) hypertrophic or dilated idiopathic cardiomyopathy, 6) myocardial lesions induced by sarcoidosis, collagen disease, and neuro-muscular disease, 7) ventricular hypertrophy and pulmonary edema, and 9) pericarditis, pericardial effusion, and systolic pericarditis associated with underlying disease. The significance of tumor, liver, bone marrow scintigraphies is also referred to. (Namekawa, K) 69 refs

  19. 40 CFR 61.201 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... phosphate mines or other sites that are used for the disposal of phosphogypsum. ... Phosphogypsum Stacks § 61.201 Definitions. As used in this subpart, all terms not defined here have the meaning... specific meanings: (a) Inactive stack means a stack to which no further routine additions of...

  20. 48 CFR 3019.201 - General policy.

    Science.gov (United States)

    2010-10-01

    ... Director, Office of Small and Disadvantaged Business Utilization, is responsible for the implementation and execution of programs to assist small businesses, veteran owned small businesses, service-disabled veteran... ACQUISITION REGULATION (HSAR) SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 3019.201 General...

  1. Standardization of Tl-201 radioactive solution

    International Nuclear Information System (INIS)

    The standardization of 201Tl, using the 4π(PC)-NaI(Tl) coincidence system, is presented. The disintegration rate was determined by the extrapolation technique, using two methods: electronic discrimination and external absorbers. A Monte Carlo simulation program, developed in our laboratory, which predicts the behavior of the extrapolation curve, was applied and the results were compared with experimental values. (author)

  2. 11 CFR 201.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Elections FEDERAL ELECTION COMMISSION ADMINISTRATIVE REGULATIONS EX PARTE COMMUNICATIONS § 201.2 Definitions. As used in this part: (a) Ex parte communication means any written or oral communication by any... opinion request. (b) Ex parte communications does not include the following communications. (1)...

  3. 48 CFR 9903.201-5 - Waiver

    Science.gov (United States)

    2010-10-01

    ...), Disclosure and Consistency of Cost Accounting Practices, with respect to a contract subject to the Cost... 9903.201-5 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING...

  4. 21 CFR 155.201 - Canned mushrooms.

    Science.gov (United States)

    2010-04-01

    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CANNED VEGETABLES Requirements for Specific Standardized Canned Vegetables § 155.201 Canned... provisions of § 172.530 of this chapter. (v) Hydrolyzed vegetable protein. (vi) Autolyzed yeast extract....

  5. Tank 241-U-201 tank characterization plan

    Energy Technology Data Exchange (ETDEWEB)

    Schreiber, R.D.

    1995-02-21

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, and WHC 22-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-U-201.

  6. 19 CFR 201.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Miscellaneous § 201.2 Definitions. As used in this chapter— (a) Commission means the United States International Trade Commission... Act of 1930, 19 U.S.C. 1202-1677j, 1677m-n; (d) Trade Expansion Act means the Trade Expansion Act...

  7. 42 CFR 56.201 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES Grants for Planning and Developing Migrant Health Centers § 56.201 Applicability. The regulations of this... pursuant to section 319(c)(1)(A) of the Act for projects for planning and developing migrant health...

  8. 7 CFR 201.26 - Kind, variety, and hybrid.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Kind, variety, and hybrid. 201.26 Section 201.26... REGULATIONS Labeling Vegetable Seeds § 201.26 Kind, variety, and hybrid. The label shall bear the name of each... kind or variety named on the label is “hybrid” seed, it shall be so designated on the label. If two...

  9. 7 CFR 62.201 - Availability of service.

    Science.gov (United States)

    2010-01-01

    ... Definitions Service § 62.201 Availability of service. QSVP services under these regulations are available to international and domestic government agencies, private agricultural businesses and any finically...

  10. 29 CFR 18.201 - Official notice of adjudicative facts.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Official notice of adjudicative facts. 18.201 Section 18.201... of adjudicative facts. (a) Scope of rule. This rule governs only official notice of adjudicative facts. (b) Kinds of facts. An officially noticed fact must be one not subject to reasonable dispute...

  11. 48 CFR 871.201-4 - Letter contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Letter contracts. 871.201... Rehabilitation and Employment Service 871.201-4 Letter contracts. Letter contracts are authorized for use in... formal contract with an approved educational institution before the enrollment of eligible veterans...

  12. 29 CFR 530.201 - Conflict with State law.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Conflict with State law. 530.201 Section 530.201 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS EMPLOYMENT... Conflict with State law. No certificate will be issued pursuant to § 530.101 of subpart B above...

  13. 5 CFR 250.201 - Coverage and purpose.

    Science.gov (United States)

    2010-01-01

    ....201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERSONNEL MANAGEMENT IN AGENCIES Strategic Human Capital Management § 250.201 Coverage and purpose. The Chief Human... the strategic management of the Federal civil service, and pursuant to 5 U.S.C. 1103, OPM...

  14. 50 CFR 223.201 - Guadalupe fur seal.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Guadalupe fur seal. 223.201 Section 223... Applicable to Threatened Marine and Anadromous Species § 223.201 Guadalupe fur seal. (a) Prohibitions. The... seal except as provided in paragraph (b) of this section. (b) Exceptions. (1) The...

  15. 41 CFR 50-201.603 - Full administrative exemptions.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Full administrative exemptions. 50-201.603 Section 50-201.603 Public Contracts and Property Management Other Provisions Relating... defaulting contractor where the stipulations required in this section were not included in the...

  16. 41 CFR 50-201.501 - Records of employment.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Records of employment. 50-201.501 Section 50-201.501 Public Contracts and Property Management Other Provisions Relating to... years from their last date of entry; (e) Basic employment and earnings records: All basic time...

  17. 48 CFR 436.201 - Evaluation of contractor performance.

    Science.gov (United States)

    2010-10-01

    ... Construction 436.201 Evaluation of contractor performance. Preparation of performance evaluation reports. In addition to the requirements of FAR 36.201, performance evaluation reports shall be prepared for indefinite... of services to be ordered exceeds $500,000.00. For these contracts, performance evaluation...

  18. 7 CFR 1463.201 - Refunds of importer assessments.

    Science.gov (United States)

    2010-01-01

    ... provisions of 7 CFR 1464.105 that were in effect prior to March 30, 2005, so long as such request for refunds... 7 Agriculture 10 2010-01-01 2010-01-01 false Refunds of importer assessments. 1463.201 Section... PROGRAM Miscellaneous Provisions § 1463.201 Refunds of importer assessments. Assessments paid on...

  19. 29 CFR 1614.201 - Age Discrimination in Employment Act.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Age Discrimination in Employment Act. 1614.201 Section 1614.201 Labor Regulations Relating to Labor (Continued) EQUAL EMPLOYMENT OPPORTUNITY COMMISSION FEDERAL... Discrimination in Employment Act. (a) As an alternative to filing a complaint under this part, an...

  20. 41 CFR 50-201.1101 - Minimum wages.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Minimum wages. 50-201.1101 Section 50-201.1101 Public Contracts and Property Management Other Provisions Relating to Public.... Determinations of prevailing minimum wages or changes therein will be published in the Federal Register by...

  1. 5 CFR 315.201 - Service requirement for career tenure.

    Science.gov (United States)

    2010-01-01

    ... period may also begin, but not end, with status quo employment under subpart G of part 316 of this... calendar days by other than status quo or indefinite employment in the competitive service, or military.... 315.201 Section 315.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL...

  2. 7 CFR 201.25 - Contents of the label.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Contents of the label. 201.25 Section 201.25 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED...

  3. 7 CFR 201.8 - Contents of the label.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Contents of the label. 201.8 Section 201.8 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED...

  4. 7 CFR 201.61 - Fluorescence percentages in ryegrasses.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Fluorescence percentages in ryegrasses. 201.61 Section... ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.61 Fluorescence percentages in ryegrasses. Tolerances for 400-seed fluorescence tests shall be those set forth in the following table plus one-half...

  5. Effect of thallium-201 blood levels on reversible myocardial defects

    International Nuclear Information System (INIS)

    To determine if 201Tl plasma blood levels correlate with the presence of reversible myocardial defects during exercise testing, 14 patients with stable coronary artery disease underwent two separate exercise 201Tl stress tests. Between initial and delayed imaging, on one test the patients drank an instant breakfast drink (eating) and on the other they drank an equivalent volume of water as a control (H2O). Thallium-201 imaging was performed immediately postexercise, immediately after eating/H2O and 210 min after eating/H2O. Between initial and immediate post eating/H2O images 201Tl reversible defects occurred in 27/38 regions in the H2O test versus 15/38 regions in the eating test (p = 0.02). Over this early time period, plasma 201Tl activity was significantly higher in the H2O test than eating test (p less than 0.05). In conclusion, early reversal of 201Tl defects may, in part, be the result of higher plasma 201Tl activity early after initial postexercise 201Tl imaging

  6. 22 CFR 201.23 - Procurement under private sector procedures.

    Science.gov (United States)

    2010-04-01

    .... 201.23 Section 201.23 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES AND PROCEDURES... shall be submitted to the Office of Small and Disadvantaged Business Utilization/Minority Resource... price and delivery terms and other relevant procurement data, in the English language. The metric...

  7. 17 CFR 256.201 - Common stock issued.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Common stock issued. 256.201... COMPANY ACT OF 1935 Liabilities and Other Credit Accounts § 256.201 Common stock issued. This account shall include the par or stated value of all common capital stock issued and outstanding....

  8. 48 CFR 9903.201-3 - Solicitation provisions.

    Science.gov (United States)

    2010-10-01

    ...-covered prime contract or subcontract of $50 million or more in the current cost accounting period may not... more or if, during its current cost accounting period, the offeror has been awarded a single CAS.... 9903.201-3 Section 9903.201-3 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS...

  9. 46 CFR 201.76 - Applications for Government aid.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Applications for Government aid. 201.76 Section 201.76... Government aid. Applications for operating-differential subsidies, charter of Government-owned vessels, and other types of Government aid shall conform to the requirements set forth in the various general...

  10. 21 CFR 201.50 - Statement of identity.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.50 Section 201.50 Food... identity. (a) The label of prescription and insulin-containing drugs in package form shall bear as one of its principal features a statement of the identity of the drug. (b) Such statement of identity...

  11. 14 CFR 201.5 - Advertising and sales by applicants.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Advertising and sales by applicants. 201.5... CODE- Application Procedures § 201.5 Advertising and sales by applicants. (a) An applicant for new or amended certificate or commuter air carrier authority shall not: (1) Advertise, list schedules, or...

  12. 5 CFR 2610.201 - Contents of application.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Contents of application. 2610.201 Section 2610.201 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES... Agricultural Marketing Act (12 U.S.C. 1141j(a)). (c) The application shall state the amount of fees...

  13. 9 CFR 93.201 - General prohibitions; exceptions.

    Science.gov (United States)

    2010-01-01

    ....201 Section 93.201 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... such poultry are handled as follows: 3 Such permit may be obtained from the Animal and Plant Health... aboard an aircraft, ocean vessel, or other means of conveyance; or (ii) Except for poultry in...

  14. 17 CFR 201.152 - Filing of papers: Form.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Filing of papers: Form. 201... PRACTICE Rules of Practice General Rules § 201.152 Filing of papers: Form. (a) Specifications. Papers filed... white paper measuring 81/2×11 inches, except that, to the extent that the reduction of larger...

  15. 17 CFR 201.150 - Service of papers by parties.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Service of papers by parties... PRACTICE Rules of Practice General Rules § 201.150 Service of papers by parties. (a) When required. In every proceeding as defined in § 201.101(a), each paper, including each notice of appearance,...

  16. 48 CFR 871.201-3 - Medical services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Medical services. 871.201... Rehabilitation and Employment Service 871.201-3 Medical services. The medical services provided trainees under... any other medical service under the jurisdiction of the Veterans Health Administration to which...

  17. 40 CFR 600.201-86 - General applicability.

    Science.gov (United States)

    2010-07-01

    ... Section 600.201-86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.201-86...

  18. 40 CFR 600.201-08 - General applicability.

    Science.gov (United States)

    2010-07-01

    ... Section 600.201-08 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.201-08...

  19. 40 CFR 600.201-93 - General applicability.

    Science.gov (United States)

    2010-07-01

    ... Section 600.201-93 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.201-93...

  20. 40 CFR 600.201-12 - General applicability.

    Science.gov (United States)

    2010-07-01

    ... Section 600.201-12 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.201-12...

  1. 37 CFR 201.25 - Visual Arts Registry.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Visual Arts Registry. 201.25... AND PROCEDURES GENERAL PROVISIONS § 201.25 Visual Arts Registry. (a) General. This section prescribes the procedures relating to the submission of Visual Arts Registry Statements by visual artists...

  2. 48 CFR 1427.201-2 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1427.201-2 Section 1427.201-2 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR GENERAL... the CCO with legal review and concurrence....

  3. 20 CFR 802.201 - Who may file an appeal.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Who may file an appeal. 802.201 Section 802... Prereview Procedures Commencing Appeal: Parties § 802.201 Who may file an appeal. (a) A party. (1) Any party... administrative law judge or deputy commissioner to the Board by filing a notice of appeal pursuant to...

  4. 21 CFR 201.17 - Drugs; location of expiration date.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs; location of expiration date. 201.17 Section...) DRUGS: GENERAL LABELING General Labeling Provisions § 201.17 Drugs; location of expiration date. When an expiration date of a drug is required, e.g., expiration dating of drug products required by § 211.137 of...

  5. Thallium-201 scintigraphy in diagnosis of coronary stenosis

    International Nuclear Information System (INIS)

    The sensitivity of rest and exercise thallium-201 scintigraphy for the detection of significant coronary artery disease and myocardial ischaemia was compared with rest and exercise electrocardiography in 46 patients with chest pain. Of 26 patients with greater that 70 per cent coronary stenosis, 16 had abnormal rest thallium-201 scintigrams and 13 had Q waves. Myocardial perfusion defects in the resting scintigram correlated very well with evidence of previous myocardial infarction (16 of 17 patients, 94%) significant Q waves were present in 13 of these 17 patients (76%). After exercise, abnormal thallium-201 scintigrams consistent with ischaemia were found in 21 patients (81%). Abnormal exercise electrocardiograms were present in 15 patients (58%). The combination of abnormal exercise thallium-201 scintigrams or exercise electrocardiograms (23/26, 88%) exceeded abnormal exercise electrocardiograms alone (15/26, 58%). The two procedures were thus complementary. Abnormal rest or exercise thallium-201 scintigrams were obtained in 25/26 patients (96%) compared with abnormal rest or exercise electrocardiograms in 21/26 patients (84%). Twenty patients with less than 50 per cent coronary stenosis had normal rest thallium-201 scintigrams and no Q waves. Two had abnormal exercise thallium-201 scintigrams and 7 had abnormal exercise electrocardiograms. Thus,exercise thallium scintigraphy has higher sensitivity than exercise electrocardiography in detecting exercise induced ischaemia and is more specific. Scintigraphy appears to have a higher sensitivity than electrocardiography in detecting coronary artery disease. (author)

  6. Venous uptake of /sup 201/Tl as thallous chloride

    Energy Technology Data Exchange (ETDEWEB)

    Silberstein, E.B.; Thomas, S.R. (Cincinnati Univ., OH (USA). Coll. of Medicine); Robbins, P.J.; Fortman, D.L. (Office of Science and Technology, Cincinnati, OH (USA). Food and Drug Administration, Nuclear Medicine Lab.); Sill, P.

    1984-05-01

    Thallium-201, injected as thallous chloride, has been found to adhere to or be taken up by the vein into which it is injected, permitting images to be obtained of human veins up to 4 h following injection. A digoxin-insensitive rat vein model also retained /sup 201/Tl but for shorter periods of time. /sup 201/Tl uptake is independent of the solution into which it is introduced, whether 5% dextrose or 0.9% sodium chloride. This technique permits multiple delayed views of normal veins to be obtained but is of uncertain value in the evaluation of thrombophlebitis of the calf because of rather poor resolution and high cost.

  7. 5 CFR 470.201 - Purposes of research programs.

    Science.gov (United States)

    2010-01-01

    ... knowledge, techniques, and materials about personnel management; (b) Seeks solutions to personnel management... conducting personnel management research; or (g) Designs systems for the assessment and transmittal of... Section 470.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE...

  8. 48 CFR 27.201 - Patent and copyright infringement liability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Patent and copyright... REGULATION GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 27.201 Patent and copyright infringement liability....

  9. 48 CFR 1327.201 - Patent and copyright infringement liability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Patent and copyright... GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 1327.201 Patent and copyright infringement liability....

  10. 48 CFR 1427.201 - Patent and copyright infringement liability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Patent and copyright... INTERIOR GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 1427.201 Patent and copyright infringement liability....

  11. 38 CFR 1.201 - Employee's duty to report.

    Science.gov (United States)

    2010-07-01

    ... PROVISIONS Referrals of Information Regarding Criminal Violations § 1.201 Employee's duty to report. All VA employees with knowledge or information about actual or possible violations of criminal law related to...

  12. 7 CFR 201.56-5 - Grass family, Poaceae (Gramineae).

    Science.gov (United States)

    2010-01-01

    ... grasses listed in § 201.2(h). (a) Cereals: Agrotricum, barley, oat, rye, mountain rye, wheat, wheat... family, Poaceae (Gramineae). Kinds of seed: Bentgrasses, bluegrasses, bluestems, bromes, cereals,...

  13. 42 CFR 447.201 - State plan requirements.

    Science.gov (United States)

    2010-10-01

    ... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS PAYMENTS FOR SERVICES Payment Methods: General Provisions § 447.201...) The plan must describe the policy and the methods to be used in setting payment rates for each type...

  14. Pre-deploy operations with SPARTAN-201 during STS-64

    Science.gov (United States)

    1994-01-01

    The astronauts onboard the Space Shuttle Discovery used a 70mm camera to capture this view of the pre-deply operations with the Shuttle Pointed Autonomous Research Tool for Astronomy (SPARTAN-201). In the grasp of the robot arm device of the Remote Manipulator System (RMS), Spartan-201 hovers above Discovery's cargo bay prior to its two days of free-flight, some 40 miles away from the parent spacecraft.

  15. 29 CFR 553.201 - Statutory provisions: section 7(k).

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Statutory provisions: section 7(k). 553.201 Section 553.201...: section 7(k). (a) Section 7(k) of the Act provides a partial overtime pay exemption for fire protection.... (b) As specified in §§ 553.20 through 553.28 of subpart A, workers employed under section 7(k)...

  16. NOVA 201 ultrasonic thickness gage (NOVA Gage)

    Science.gov (United States)

    Garecht, Diane

    1990-01-01

    The measurement integrity of the NOVA 201 digital ultrasonic thickness gage (NOVA gage) was demonstrated by comparing the NOVA gage measurements to the thickness gage measurements, and determining the bias and uncertainty of the NOVA gage when measuring redesigned solid rocket motor (RSRM) hardware per engineering test plans (ETP). The NOVA gage was tested by three different operators on steel and aluminum RSRM hardware for wall thickness. The results show that the measurement bias is not consistent. The uncertainty of the bias is caused by the heterogeneous material properties of the RSRM components that influence the time of flight of ultrasonic waves. The measurement uncertainty inherent to the design and operation of the NOVA gage is less in comparison to the uncertainty of the bias. The total measurement uncertainty cannot be substantially reduced by taking more than one measurement. There is no correlation between bias and the surface finish range of this test unless 3-in-One oil is used as a couplant, in which case there appears to be a slight trend. There is no correlation between uncertainty and the surface finish range. The measurement uncertainty of the NOVA gage can be reduced using 3-in-One oil as a couplant.

  17. 201-Tl production studies by 203-Tl(p,3n)201-Pb and 202-Hg(p,2n) nuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Birattari, C.; Bonardi, M.; Salomone, A. (Milan Univ. (Italy). Ist. di Fisica)

    Thallium 201 has been produced in the Milan university AVF cyclotron by a /sup 203/Tl(p,3n)/sup 201/Pb and /sup 202/Hg(p,2n) nuclear reactions. /sup 201/Tl//sup 201/Pb were separated radiochemically by the preparation of thallium as thallous iodide after complexation of the lead with EDTA. /sup 202/Hg and /sup 201/Tl were separated by washing the target and holder, to which the radiothallium adheres with 3HCl and adding NaOH. Quality control is by radiochromatography.

  18. Serial Myocardial Imaging after a Single Dose of Thallium-201

    Directory of Open Access Journals (Sweden)

    Takahiko Kamata

    2014-10-01

    Full Text Available Although thallium-201 exercise scintigraphy has been established for the detection of myocardial ischemia and viability, little is known regarding the myocardial thallium-201 kinetics during angioplasty. Herein, we report a 77-year old man with angina pectoris, in whom serial myocardial imaging after a single dose of thallium-201 was helpful in identifying not only the culprit lesion and myocardial viability, but also the dynamic changes in myocardial perfusion during angioplasty. Thallium-201 images after exercise showed a perfusion defect in the inferior wall, with a trivial redistribution 3 hours after the exercise and a marked improvement 24 hours later. Coronary angiography, performed 27 hours after exercise scintigraphy, showed severe stenosis in the right coronary artery. Guidewire crossing of the lesion interrupted the antegrade flow, which was restored after balloon dilation and stent implantation. Thallium-201 images, 2 hours after angioplasty (i.e., 30 hours after exercise, showed a decreased tracer uptake in the inferior wall, which improved the next day (i.e., 48 hours after exercise. Cardiac biomarkers were negative in the clinical course.

  19. 177Lu-OPS201 targeting somatostatin receptors

    DEFF Research Database (Denmark)

    Beykan, Seval; Dam, Jan S; Eberlein, Uta;

    2016-01-01

    kidneys (13.7 Gy), the osteogenic cells (3.9 Gy), the urinary bladder wall (1.8 Gy), and the liver (1.0 Gy). No metabolites of (177)Lu-OPS201 were found by radio HPLC analysis. None of the absorbed doses calculated will exceed organ toxicity levels. CONCLUSIONS: The (177)Lu-OPS201 was well tolerated and......-integrated activity coefficients were calculated for the organs showing visible uptake. Based on these data, the absorbed organ dose coefficients for a 70-kg patient were calculated with OLINDA/EXM. For humans after an injection of 5 GBq (177)Lu-OPS201, the highest predicted absorbed doses are obtained for the...

  20. Tank characterization report for single-shell Tank B-201

    Energy Technology Data Exchange (ETDEWEB)

    Heasler, P.G.; Remund, K.M.; Tingey, J.M.; Baird, D.B.; Ryan, F.M.

    1994-09-01

    The purpose of this report is to characterize the waste in single shell Tank B-201. Characterization includes the determination of the physical, chemical (e.g., concentrations of elements and organic species), and radiological properties of the waste. These determinations are made using analytical results from B-201 core samples as well as historical information about the tank. The main objective is to determine average waste properties: but in some cases, concentrations of analytes as a function of depth were also determined. This report also consolidates the available historical information regarding Tank B-201, arranges the analytical information from the recent core sampling in a useful format, and provides an interpretation of the data within the context of what is known about the tank.

  1. Studies about the stress transaxial myocardium tomography with thallium -201

    International Nuclear Information System (INIS)

    Since the time of earliest applications of SPECT technology to Thallium-201 myocardial perfusion imaging, there has been no agreement as to what constitutes the best procedures to follow in order to achieve the theoretical advantages of SPECT to diagnose coronary artery disease. The purpose of these studies are to show the results of experimental and clinical investigations, that, have helped to resolve most of some controversies. Myocardial perfusion SPECT with Thallium-201 is clinically useful procedure that is readily applicable for routine clinical application provided correct techniques are utilized. (author)

  2. 37 CFR 201.23 - Transfer of unpublished copyright deposits to the Library of Congress.

    Science.gov (United States)

    2010-07-01

    ... copyright deposits to the Library of Congress. 201.23 Section 201.23 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.23 Transfer of unpublished copyright deposits to the Library of Congress. (a) General. This section...

  3. 21 CFR 201.2 - Drugs and devices; National Drug Code numbers.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs and devices; National Drug Code numbers. 201.2 Section 201.2 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING General Labeling Provisions § 201.2 Drugs and devices; National Drug...

  4. 21 CFR 201.125 - Drugs for use in teaching, law enforcement, research, and analysis.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs for use in teaching, law enforcement, research, and analysis. 201.125 Section 201.125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF... § 201.125 Drugs for use in teaching, law enforcement, research, and analysis. A drug subject to §...

  5. 48 CFR 9903.201-8 - Compliant accounting changes due to external restructuring activities.

    Science.gov (United States)

    2010-10-01

    ... changes due to external restructuring activities. 9903.201-8 Section 9903.201-8 Federal Acquisition... Requirements 9903.201-8 Compliant accounting changes due to external restructuring activities. The contract... practice changes directly associated with external restructuring activities that are subject to and...

  6. 30 CFR 201.100 - Responsibilities of the Associate Director for Minerals Revenue Management.

    Science.gov (United States)

    2010-07-01

    ... Minerals Revenue Management. 201.100 Section 201.100 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT GENERAL Oil and Gas, Onshore § 201.100 Responsibilities of the Associate Director for Minerals Revenue Management. The Associate Director is...

  7. 29 CFR 825.201 - Leave to care for a parent.

    Science.gov (United States)

    2010-07-01

    ... foster care, or to care for a parent, the husband and wife would each be entitled to the difference... 29 Labor 3 2010-07-01 2010-07-01 false Leave to care for a parent. 825.201 Section 825.201 Labor....201 Leave to care for a parent. (a) General rule. An eligible employee is entitled to FMLA leave...

  8. 10 CFR 490.201 - Alternative fueled vehicle acquisition mandate schedule.

    Science.gov (United States)

    2010-01-01

    .... 490.201 Section 490.201 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ALTERNATIVE FUEL TRANSPORTATION PROGRAM Mandatory State Fleet Program § 490.201 Alternative fueled vehicle acquisition mandate... annually for State government fleets, including agencies thereof but excluding municipal fleets,...

  9. 40 CFR 1033.201 - General requirements for obtaining a certificate of conformity.

    Science.gov (United States)

    2010-07-01

    ... your application (see 40 CFR 1068.5). (e) An authorized representative of your company must approve and... certificate of conformity. 1033.201 Section 1033.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY....201 General requirements for obtaining a certificate of conformity. Certification is the process...

  10. 27 CFR 44.201 - Return to manufacturer or customs warehouse proprietor.

    Science.gov (United States)

    2010-04-01

    ... customs warehouse proprietor. 44.201 Section 44.201 Alcohol, Tobacco Products and Firearms ALCOHOL AND... Proprietors Notice of Removal of Shipment § 44.201 Return to manufacturer or customs warehouse proprietor... to the factory, or cigars are removed from such a warehouse for return to a customs warehouse,...

  11. 37 CFR 201.14 - Warnings of copyright for use by certain libraries and archives.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Warnings of copyright for use by certain libraries and archives. 201.14 Section 201.14 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.14...

  12. 37 CFR 201.24 - Warning of copyright for software lending by nonprofit libraries.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Warning of copyright for software lending by nonprofit libraries. 201.24 Section 201.24 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.24 Warning...

  13. 37 CFR 201.6 - Payment and refund of Copyright Office fees.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Payment and refund of Copyright Office fees. 201.6 Section 201.6 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.6 Payment and refund of Copyright...

  14. 22 CFR 201.47 - Use of marine insurance loss proceeds.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Use of marine insurance loss proceeds. 201.47... Commodity-Related Services § 201.47 Use of marine insurance loss proceeds. The borrower/grantee shall pay... marine insurance claim under a marine insurance policy financed pursuant to this part 201, if...

  15. 48 CFR 1819.201 - General policy. (NASA supplements paragraphs (a), (c), (d), and (f))

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true General policy. (NASA supplements paragraphs (a), (c), (d), and (f)) 1819.201 Section 1819.201 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 1819.201 General policy....

  16. 7 CFR 201.73 - Processors and processing of all classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... seed. 201.73 Section 201.73 Agriculture Regulations of the Department of Agriculture (Continued... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.73 Processors and processing of all classes of certified seed. The following requirements must be met by processors of all...

  17. 7 CFR 201.51b - Purity procedures for coated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Purity procedures for coated seed. 201.51b Section 201... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.51b...

  18. 7 CFR 201.12a - Lawn and turf seed mixtures.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Lawn and turf seed mixtures. 201.12a Section 201.12a..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.12a Lawn and turf seed mixtures. Seed mixtures intended for...

  19. 7 CFR 201.71 - Establishing the source of all classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... seed. 201.71 Section 201.71 Agriculture Regulations of the Department of Agriculture (Continued... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.71 Establishing the source of all classes of certified seed. The certifying agency shall have evidence of the class and source...

  20. 48 CFR 339.201-70 - Required provision and contract clause.

    Science.gov (United States)

    2010-10-01

    ... contract clause. 339.201-70 Section 339.201-70 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES SPECIAL CATEGORIES OF CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Electronic and Information Technology 339.201-70 Required provision and contract clause. (a) The Contracting Officer shall insert...

  1. 9 CFR 201.100 - Records to be furnished poultry growers and sellers.

    Science.gov (United States)

    2010-01-01

    ... growers and sellers. 201.100 Section 201.100 Animals and Animal Products GRAIN INSPECTION, PACKERS AND... poultry growers and sellers. Link to an amendment published at 74 FR 63277, Dec. 3, 2009. (a) Contracts... forth as follows: § 201.100 Records to be furnished poultry growers and sellers. (a) Poultry...

  2. 4 CFR 201.3 - Publicly available documents and electronic reading room.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Publicly available documents and electronic reading room. 201.3 Section 201.3 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.3 Publicly available documents and electronic reading room. (a) Many Board records...

  3. 47 CFR 54.201 - Definition of eligible telecommunications carriers, generally.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Definition of eligible telecommunications carriers, generally. 54.201 Section 54.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... § 54.201 Definition of eligible telecommunications carriers, generally. (a) Carriers eligible...

  4. 21 CFR 201.115 - New drugs or new animal drugs.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false New drugs or new animal drugs. 201.115 Section 201.115 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.115 New drugs or new...

  5. 24 CFR 201.22 - Credit requirements for borrowers.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Credit requirements for borrowers... § 201.22 Credit requirements for borrowers. (a) Credit application and review. (1) Before making a loan... borrower and any co-maker or co-signer is solvent and an acceptable credit risk, with a reasonable...

  6. 7 CFR 201.56-9 - Mallow family, Malvaceae.

    Science.gov (United States)

    2010-01-01

    ..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.56-9 Mallow family, Malvaceae. Kinds of seed: Cotton, kenaf, and okra. (a) General description. (1) Germination habit: Epigeal dicot. (2)...

  7. 7 CFR 201.57a - Dormant seeds.

    Science.gov (United States)

    2010-01-01

    ..., or application of germination promoting chemicals. (b) The percentage of dormant seed, if present..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.57a Dormant seeds. Dormant seeds...

  8. 40 CFR 240.201-2 - Recommended procedures: Design.

    Science.gov (United States)

    2010-07-01

    ... carcasses, automobile bodies, dewatered sludges from water treatment plants, and industrial process wastes. ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Design. 240... § 240.201-2 Recommended procedures: Design. (a) Provision for storing, handling, and removing...

  9. Contribution to the study of thallium 201 myocardium scintigraphy

    International Nuclear Information System (INIS)

    In this work a new isotope was tested in the field of myocardium scintigraphy: thallium 201. The different radioisotopes used so far in myocardium scintigraphy are reviewed to begin with. The main biological and physical characteristics of thallium and the scintillation camera used for this work are described next. In our opinion thallium 201 owing to its biological behavior similar to that of potassium and to its physical characteristics, appears as one of the better -if not the best- known tracer suitable for use in myocardium scintigraphy. Its properties are suited to the use of a scintillation camera, which considerably shortens the examination time and thus allows an isotopic exploration of the myocardium from several incidences. The only disadvantage of this cyclotron-produced isotope seems to be its high price which will probably limit its use on a large scale. Fifty thallium 201 myocardium scintigraphs were practised on forty-eight coronary thrombosis patients. From this was established a precise topographic correlation between the electrocardiographic diagnosis and the scintigraph. The two corresponded in 47 cases out of 50. The few disagreements between ECG and scintigraphic results seem to be due either to poor-quality images or to an overall myocardium hypofixation connected with a very extensive necrosis. This means that thallium 201 myocardium scintigraphy is a reliable method of examination in the great majority of cases, giving a direct picture of the heart muscle and its necrotic lesions

  10. 4 CFR 201.7 - Timing of responses to requests.

    Science.gov (United States)

    2010-01-01

    ... Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.7 Timing of... disclosed in part shall be marked or annotated to show the amount of information deleted unless doing so would harm an interest protected by an applicable exemption. The location of the information...

  11. 48 CFR 9903.201-1 - CAS applicability.

    Science.gov (United States)

    2010-10-01

    ...-materials, and labor-hour contracts and subcontracts for the acquisition of commercial items. (7) Contracts...) shall be subject to CAS. A CAS-covered contract may be subject to full, modified or other types of CAS coverage. The rules for determining the applicable type of CAS coverage are in 9903.201-2. (b)...

  12. 48 CFR 1536.201 - Evaluation of contracting performance.

    Science.gov (United States)

    2010-10-01

    ... Contracting for Construction 1536.201 Evaluation of contracting performance. (a) The Contracting Officer will... will file the form in the contractor performance evaluation files which it maintains. (e) The Quality... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Evaluation of...

  13. 48 CFR 36.201 - Evaluation of contractor performance.

    Science.gov (United States)

    2010-10-01

    ... Contracting for Construction 36.201 Evaluation of contractor performance. See 42.1502(e) for the requirements for preparing past performance evaluations for construction contracts. ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Evaluation of...

  14. 48 CFR 236.201 - Evaluation of contractor performance.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTS Special Aspects of Contracting for Construction 236.201 Evaluation of contractor performance. (a) Preparation of performance evaluation reports. Use DD Form 2626, Performance Evaluation (Construction... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation of...

  15. 9 CFR 113.201 - Canine Distemper Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.201 Canine Distemper Vaccine, Killed Virus. Canine Distemper...

  16. 9 CFR 201.69 - Furnishing information to competitor buyers.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Furnishing information to competitor... STOCKYARDS ACT Trade Practices § 201.69 Furnishing information to competitor buyers. No packer, dealer, or... operations: (a) Furnish competitor packers, dealers, market agencies, or their buyers or...

  17. 44 CFR 206.201 - Definitions used in this subpart.

    Science.gov (United States)

    2010-10-01

    ... Administration § 206.201 Definitions used in this subpart. (a) Applicant means a State agency, local government, or eligible private nonprofit organization, as identified in Subpart H of this regulation, submitting... natural feature. Land used for agricultural purposes is not a facility. (d) Grant means an award...

  18. 10 CFR 1015.201 - Aggressive agency collection activity.

    Science.gov (United States)

    2010-01-01

    ... establishing the amount due. (b) In accordance with 31 CFR Chapter IX parts 900-904 and this part, DOE will... DOJ for litigation. (See 31 CFR 285.12, Transfer of Debts to Treasury for Collection.) This... 10 Energy 4 2010-01-01 2010-01-01 false Aggressive agency collection activity. 1015.201...

  19. 48 CFR 14.201-8 - Price-related factors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Price-related factors. 14... CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.201-8 Price-related factors. The factors set forth in paragraphs (a) through (e) below may be applicable in evaluation of bids for...

  20. 18 CFR 367.2010 - Account 201, Common stock issued.

    Science.gov (United States)

    2010-04-01

    ... stock issued. 367.2010 Section 367.2010 Conservation of Power and Water Resources FEDERAL ENERGY... GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2010 Account 201, Common stock issued. This account must include the par or stated value of all common capital stock issued...

  1. 19 CFR 201.21 - Availability of specific records.

    Science.gov (United States)

    2010-04-01

    ... legislative body concerned, and confidential business data as defined in 18 U.S.C. 1905 and 19 CFR 201.06 are...; the term subpoena means any compulsory process in a case or matter to which the Commission is not a... without limitation, official letters, telegrams, memoranda, reports, studies, calendar and diary...

  2. 48 CFR 614.201-70 - Use of English language.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Use of English language... METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 614.201-70 Use of English language. Use of English language solicitations and contracts is mandatory unless a deviation has been approved by...

  3. 37 CFR 2.201 - Copies and certified copies.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Copies and certified copies... Trademark Office § 2.201 Copies and certified copies. (a) Non-certified copies of trademark registrations... appropriate fee required by § 2.6. (b) Certified copies of trademark registrations and of any...

  4. Thallium-201 scintigraphy for bone and soft tissue tumors

    Energy Technology Data Exchange (ETDEWEB)

    Tokuumi, Yuji; Tsuchiya, Hiroyuki; Sunayama, Chiaki; Matsuda, Eizo; Asada, Naohiro; Taki, Junichi; Sumiya, Hisashi; Miyauchi, Tsutomu; Tomita, Katsuro [Kanazawa Univ. (Japan). School of Medicine

    1995-05-01

    This study was undertaken to assess the usefulness of thallium-201 scintigraphy in bone and soft tissue tumors. Pre-therapy scintigraphy was undertaken in a total of 136 patients with histologically confirmed diagnosis, consisting of 74 with malignant bone and soft tissue tumors, 39 with benign ones, 12 with diseases analogous to tumors, and 11 others. Thallium activity was graded on a scale of 0-4: 0=background activity, 1=equivocal activity, 2=definitive activity, but less than myocardium, 3=definite activity equal to myocardium, and 4=activity greater than myocardium. In the group of malignant tumors, thallium-201 uptake was found in 80%, although it was low for chondrosarcoma (2/8) and malignant Schwannoma (one/3). The group of benign tumors, however, showed it in only 41%, being restricted to those with giant cell tumors, chondroblastoma, fibromatosis, and osteoid osteoma. Thallium-201 uptake was also found in all 8 patients with metastatic tumors. In 23 patients undergoing thallium imaging before and after chemotherapy, scintigraphic findings revealed a high correlation with histopathological findings. Thus, thallium-201 scintigraphy may be potentially used to distinguish malignant from benign bone and soft tissue tumors, except for a few histopathological cases, as well as to determine loco-regional metastases and response to chemotherapy. (N.K.).

  5. 12 CFR 201.3 - Extensions of credit generally.

    Science.gov (United States)

    2010-01-01

    ... TALF transactions should send a written notice to the Credit, Investment, and Payment Risk group of the... Reserve its views of the credit risk of any transaction within the TALF asset sector that has been... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Extensions of credit generally. 201.3...

  6. 48 CFR 814.201 - Preparation of invitations for bids.

    Science.gov (United States)

    2010-10-01

    ... assigned by the national system or VA's Electronic Contract Management System (eCMS). VHA shall use eCMS... AFFAIRS CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 814.201 Preparation of... accepted, and will become a contract in the same fiscal year but, because of procurement lead time,...

  7. 17 CFR 232.201 - Temporary hardship exemption.

    Science.gov (United States)

    2010-04-01

    ... no later than one business day after the date on which the filing was to be made. (1) An electronic... submitted to the Commission within six business days of filing the paper format document. The electronic... REGULATION S-T-GENERAL RULES AND REGULATIONS FOR ELECTRONIC FILINGS Hardship Exemptions § 232.201...

  8. 27 CFR 25.201 - Removal by pipeline.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Removal by pipeline. 25... Distilled Spirits Plant § 25.201 Removal by pipeline. A brewer may remove beer from the brewery, without payment of tax, by pipeline to the bonded premises of a distilled spirits plant which is authorized...

  9. SPECT-T1-201 cardiac imaging

    International Nuclear Information System (INIS)

    Topics of discussion include: limitations of planar thallium-201 imaging; tomographic acquisition protocol; quantitative analysis involving slice selection, circumferential profile generation, comparison to normal limits and polar display of results; sensitivity and specificity; sources of error involving patient motion and upward creep; and clinical applications

  10. 48 CFR 814.201-6 - Solicitation provisions.

    Science.gov (United States)

    2010-10-01

    ... electronic means. (b) In an invitation for bid for supplies, equipment, or services (other than construction... CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 814.201-6 Solicitation provisions. (a) The contracting officer must place the provision entitled “Caution to Bidders-Bid Envelopes,”...

  11. 48 CFR 941.201-71 - Use of subcontracts.

    Science.gov (United States)

    2010-10-01

    ... CATEGORIES OF CONTRACTING ACQUISITION OF UTILITY SERVICES Acquiring Utility Services 941.201-71 Use of... and/or sewerage at facilities owned or leased by DOE shall not be acquired under a subcontract arrangement, except as provided for at 970.4102-1 or if the prime contract is with a utility company....

  12. 24 CFR 597.201 - Evaluating the strategic plan.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Evaluating the strategic plan. 597... Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR COMMUNITY PLANNING AND DEVELOPMENT, DEPARTMENT OF...: ROUND ONE DESIGNATIONS Nomination Procedure § 597.201 Evaluating the strategic plan. The strategic...

  13. 31 CFR 544.201 - Prohibited transactions involving blocked property.

    Science.gov (United States)

    2010-07-01

    ... DESTRUCTION PROLIFERATORS SANCTIONS REGULATIONS Prohibitions § 544.201 Prohibited transactions involving... General, and other relevant agencies, to be owned or controlled by, or acting or purporting to act for or... Designated Nationals and Blocked Persons List (“SDN” list) (which is accessible via the Office of...

  14. 31 CFR 546.201 - Prohibited transactions involving blocked property.

    Science.gov (United States)

    2010-07-01

    ... REGULATIONS Prohibitions § 546.201 Prohibited transactions involving blocked property. (a) Except as... be owned or controlled by, or acting or purporting to act for or on behalf of, directly or indirectly... section, are published on the Office of Foreign Assets Control's Specially Designated Nationals...

  15. 31 CFR 543.201 - Prohibited transactions involving blocked property.

    Science.gov (United States)

    2010-07-01

    ... REGULATIONS Prohibitions § 543.201 Prohibited transactions involving blocked property. (a) Except as..., after consultation with the Secretary of State: (i) To constitute a threat to the peace and national... or controlled by, or acting or purporting to act for or on behalf of, directly or indirectly,...

  16. 31 CFR 547.201 - Prohibited transactions involving blocked property.

    Science.gov (United States)

    2010-07-01

    ... THE CONGO SANCTIONS REGULATIONS Prohibitions § 547.201 Prohibited transactions involving blocked... pursuant to this paragraph (a); or (vii) To be owned or controlled by, or acting or purporting to act for... Specially Designated Nationals and Blocked Persons List (“SDN List”) (which is accessible via the Office...

  17. 31 CFR 594.201 - Prohibited transactions involving blocked property.

    Science.gov (United States)

    2010-07-01

    ... support of: (A) Acts of terrorism that threaten the security of U.S. nationals or the national security... SANCTIONS REGULATIONS Prohibitions § 594.201 Prohibited transactions involving blocked property. (a) Except... Attorney General, to have committed, or to pose a significant risk of committing, acts of terrorism...

  18. 7 CFR 201.45 - Obtaining the working sample.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS Purity Analysis in the Administration of the Act § 201.45 Obtaining the working sample. (a) The... available, the sample shall be thoroughly mixed and placed in a pile and the pile shall be...

  19. 24 CFR 201.18 - Modification agreement or repayment plan.

    Science.gov (United States)

    2010-04-01

    ... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.18... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Modification agreement or...

  20. 24 CFR 201.23 - Borrower's initial payment.

    Science.gov (United States)

    2010-04-01

    ... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Eligibility and Disbursement Requirements § 201... independently of the property securing repayment of the Title I loan, unless the prior approval of the...

  1. 49 CFR 1503.201 - Reports of violations.

    Science.gov (United States)

    2010-10-01

    ... Investigative Procedures § 1503.201 Reports of violations. (a) Any person who knows of a violation of a TSA requirement should report it to appropriate personnel of any TSA office. (b) TSA will review each report made under this section, together with any other information TSA may have that is relevant to the...

  2. Clinical value of thallium 201 in a cardiology service

    International Nuclear Information System (INIS)

    At present the most widely used element in isotopic cardiology is undoubtedly 201Tl. In the few years since its appearance many publication testify to its growing use in the external detection of coronary thrombosis, the discovery of ischemia exertion, the non-traumatic observation of patients after an aortocoronary bridging operation, the diagnosis of coronary deficiency associated with another heart disease (aorta narrowing, mitral prolapsus, obstructive cardiomyopathy) and in combination with two other radioisotopic methods. The present work is intended as a modest contribution, still very recent, to the critical study of this new technique in all its present aspects. Part one presents the various characteristics responsible for the advantages and limits of 201Tl, then describes the techniques and apparatus used. The production, dosimetry, toxicity and biological behaviour of 201Tl are also discussed. A hundred and twenty-five examinations were performed in the Nuclear Medicine Service of the Limoges UHC between May 1977 and October 1978. The results are analysed in part two. This is followed by a discussion which attempts, in the light of our experience, to situate the place occupied by 201Tl in the range of complementary examinations useful in declared or assumed coronary cases. We then propose an examination procedure and precise indications we believe to be justified, accounting for economic problems before considering the future prospects of myocardium scintigraphy

  3. 5 CFR 536.201 - Mandatory grade retention.

    Science.gov (United States)

    2010-01-01

    ... AND PAY RETENTION Grade Retention § 536.201 Mandatory grade retention. (a) Subject to the requirements in this section and in §§ 536.102 and 536.203, an agency must provide grade retention to an employee... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Mandatory grade retention....

  4. 17 CFR 229.201 - (Item 201) Market price of and dividends on the registrant's common equity and related...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false (Item 201) Market price of and... registrant may translate such prices into United States currency at the currency exchange rate in effect on... Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION STANDARD INSTRUCTIONS FOR FILING...

  5. Verification of RESRAD-RDD. (Version 2.01)

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Jing-Jy [Argonne National Lab. (ANL), Argonne, IL (United States); Flood, Paul E. [Argonne National Lab. (ANL), Argonne, IL (United States); LePoire, David [Argonne National Lab. (ANL), Argonne, IL (United States); Kamboj, Sunita [Argonne National Lab. (ANL), Argonne, IL (United States); Yu, Charley [Argonne National Lab. (ANL), Argonne, IL (United States)

    2015-09-01

    In this report, the results generated by RESRAD-RDD version 2.01 are compared with those produced by RESRAD-RDD version 1.7 for different scenarios with different sets of input parameters. RESRAD-RDD version 1.7 is spreadsheet-driven, performing calculations with Microsoft Excel spreadsheets. RESRAD-RDD version 2.01 revamped version 1.7 by using command-driven programs designed with Visual Basic.NET to direct calculations with data saved in Microsoft Access database, and re-facing the graphical user interface (GUI) to provide more flexibility and choices in guideline derivation. Because version 1.7 and version 2.01 perform the same calculations, the comparison of their results serves as verification of both versions. The verification covered calculation results for 11 radionuclides included in both versions: Am-241, Cf-252, Cm-244, Co-60, Cs-137, Ir-192, Po-210, Pu-238, Pu-239, Ra-226, and Sr-90. At first, all nuclidespecific data used in both versions were compared to ensure that they are identical. Then generic operational guidelines and measurement-based radiation doses or stay times associated with a specific operational guideline group were calculated with both versions using different sets of input parameters, and the results obtained with the same set of input parameters were compared. A total of 12 sets of input parameters were used for the verification, and the comparison was performed for each operational guideline group, from A to G, sequentially. The verification shows that RESRAD-RDD version 1.7 and RESRAD-RDD version 2.01 generate almost identical results; the slight differences could be attributed to differences in numerical precision with Microsoft Excel and Visual Basic.NET. RESRAD-RDD version 2.01 allows the selection of different units for use in reporting calculation results. The results of SI units were obtained and compared with the base results (in traditional units) used for comparison with version 1.7. The comparison shows that RESRAD

  6. Performance of the Microwave Anisotropy Probe AST-201 Star Trackers

    Science.gov (United States)

    Ward, David K.; vanBezooijen, Roelof; Bauer, Frank H. (Technical Monitor)

    2002-01-01

    The Microwave Anisotropy Probe (MAP) was launched to create a full-sky map of the cosmic microwave background. MAP incorporates two modified Lockheed Martin AST-201 (Autonomous Star Tracker) star trackers. The AST-201 employs an eight element radiation hardened lens assembly which is used to focus an image on a charge coupled device (CCD). The CCD image is then processed by a star identification algorithm which outputs a three-axis attitude. A CCD-shift algorithm called Time Delayed Integration (TDI) was also included in each star tracker. In order to provide some radiation effect filtering during MAP's three to five phasing loop passes through the Van Allen radiation belts, a simple pixel filtering scheme was implemented, rather than using a more complex, but more robust windowing algorithm. The trackers also include a fiber optic data interface. This paper details the ground testing that was accomplished on the MAP trackers.

  7. Uptake of thallium-201 in enlarged thyroid glands. Concise communication

    Energy Technology Data Exchange (ETDEWEB)

    Fukuchi, M.; Kido, A.; Hyodo, K.; Tachibana, K.; Onoue, K.; Morita, T.; Nagai, K.

    1979-08-01

    We have investigated the thyroid uptake of Tl-201 in 37 patients with various types of goiter, and in six with normal thyroids. Significant thallium uptake was found in all cases in which there was thyroid enlargement, including Graves' disease, toxic thyroid nodule, primary hypothyroidism, simple goiter, Hashimoto's disease, thyroid carcinoma, and thyroid adenoma. If goiter was absent, however, there was no demonstrable uptake - e.g., in secondary hypothyroidism, subacute thyroiditis, and the normal controls. Thallium uptake did not correlate with thyroid function tests such as BMR, T/sub 3/-RU, T/sub 3/, T/sub 4/, TSH, antithyroid antibodies, or the 24-hr I-131 uptake. In 23 patients with diffuse goiter, on the other hand, maximum Tl-201 uptake correlated well with thyroid weight: r = 0.836 (p < 0.001); y = 0.02 x + 0.06.

  8. Thallium-201 scintigraphy of the myocardium in connection with adenosine

    International Nuclear Information System (INIS)

    It is shown that thallium-201 SPECT studies of the myocardium performed subsequent to intravenous infusion of adenosine provide results at least as valuable as those from exercise thallium-201 scintigraphy in the diagnosis of coronary artery disease. The infusion of adenosine offers great advantages over exercise studies in that it is a standardized procedure uninfluenced by a patient's physical fitness, which can thus be used in all cases. There are quite a number of clinically tolerable untoward reactions that may be associated with discomfort but do not warrant discontinuation of the procedure. Serious, verifiable side-effects are rare and disappear immediately on termination of the infusion. The most recent research in this field has shown that newly developed compounds of 99mTc are also suitable for radionuclide studies of the myocardium with adenosine vasodilation. (orig.)

  9. The clinical value of planar thallium-201 myocardial perfusion scintigraphy

    International Nuclear Information System (INIS)

    The clinical value of planar thalium-201 myocardial perfusion scintigraphy was examined, using visual and quantitative analysis, for the detection of presence, localization and extent of coronary disease, using coronary arteriography as gold standard. The indremental diagnostic yield of different noninvasive tests for the diagnosis and the severity of coronary artery disease was quantified by using multivariate discriminant analysis. (author). 284 refs.; 14 figs.; 37 tabs

  10. [Blunt abdominal trauma.--analysis of 201 cases (author's transl)].

    Science.gov (United States)

    Pannenborg, G; Wolf, O; Voigtsberger, P

    1978-01-01

    201 blunt abdominal traumata treated clinically at the surgical department of the Medical Academy in Erfurt from 1967 to 1976 are reported: No increase of blunt abdominal traumata within the period of the report in spite of considerable growth of trafficdensity and industrialization could be observed.--The percentage of severe secundary injuries remained approximately constant, too.--Intestinal lesions, combined hepatolienal ruptures caused the highest mortality especially in combination with severe craniocerebral lesions. PMID:685552

  11. Thallium-201 skeletal muscle imaging in myotonic muscular dystrophy

    International Nuclear Information System (INIS)

    A 34-year-old male with myotonic muscular dystrophy whose skeletal muscle involvement was demonstrated by thallium-201 whole body scintigraphy is described. The disease was diagnosed with physical examination, high serum CK level (120 - 450 i.u./ml) and typical electromyographic findings. Although he had very slight left limb weakness, his both legs showed well developed muscles without any atrophy or fasciculation and showed good pulsation of dorsalis pedis arteries. Muscle imaging was performed using digital gamma camera with twin opposed large rectangular detectors and on-line computer after intravenous injection of 2 mCi of thallium-201. Anterior and posterior data were obtained simultaneously with a 512 by 512 matrix format by the twin detectors both in front of and behind the patient. The two cameras scanned the whole body from head to feet in 15 minutes. And thallium-201 whole body image was reconstructed from the anterior and posterior data, by taking the geometric mean of the corresponding pixel values, after correction of photon attenuation of the posterior data. The whole body image showed symmetrical accumulation of thallium at scapular, deltoid, and gluteal muscles, and thallium uptake was selectively spared at left calf muscles. (author)

  12. Thallium-201 single-photon emission tomography in the treatment follow-up of nasopharyngeal carcinoma

    International Nuclear Information System (INIS)

    In order to assess the usefulness of thallium-201 single-photon emission tomography (SPET) in the treatment follow-up of nasopharyngeal carcinoma (NPC), a total of 75 201Tl SPET studies were performed in 18 patients with histologically proven NPC. The findings were compared with those of magnetic resonance imaging (MRI) before and after therapy. Four patients received radiotherapy alone while the other 14 received concurrent chemo-radiotherapy. Treatment response was classified as complete (CR) or partial (PR) based on the findings of MRI and 201Tl SPET. Intense 201Tl uptake by the tumour was seen in all 18 patients before treatment. After treatment, MRI showed seven CRs and 11 PRs, whereas 201Tl SPET showed 13 CRs and five PRs. In 12 patients, the results of 201Tl SPET were in agreement with those of MRI. In six patients MRI showed PR but 201Tl showed CR. Follow-up (mean 10.6 months) MRI and 201Tl SPET studies of these six patients revealed that tumour gradually decreased and finally vanished in three patients. This preliminary study indicates that 201Tl SPET has potential in the assessment of early response to treatment of patients with NPC when compared with MRI. (orig.)

  13. Inhibition of meal stimulated gastric acid secretion by an octapeptide somatostatin analogue SMS 201-995.

    OpenAIRE

    Olsen, J A; Loud, F B; Christiansen, J

    1987-01-01

    A dose response study of the effect of an octapeptide somatostatin analogue, SMS 201-995, on meal stimulated gastric acid secretion was carried out in 12 healthy volunteers. Infusion of SMS 201-995 in a dose of 50 pmol/kg/h almost completely abolished the acid response to the meal. Pl-gastrin was significantly decreased during infusion of 10 pmol/kg/h of SMS 201-995 and insulin was significantly inhibited during infusion of 50 pmol/kg/h. SMS 201-995 in a dose of 50 pmol/kg/h inhibited basal a...

  14. 21 CFR 201.200 - Disclosure of drug efficacy study evaluations in labeling and advertising.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Disclosure of drug efficacy study evaluations in labeling and advertising. 201.200 Section 201.200 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT... Commissioner of Food and Drugs from the National Academy of Sciences (1969).” As the report notes, this...

  15. 22 CFR 201.73 - Limitations on the responsibilities of banks.

    Science.gov (United States)

    2010-04-01

    .... 201.73 Section 201.73 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES AND PROCEDURES... accepted by the bank in the ordinary course of business in good faith. Except as may be required in the... the fact that the Commodity Approval Application or the Invoice-and-Contract Abstract on the...

  16. 50 CFR 226.201 - Critical habitat for Hawaiian monk seals.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Critical habitat for Hawaiian monk seals. 226.201 Section 226.201 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND... Critical habitat for Hawaiian monk seals. Hawaiian Monk Seal (Monachus schauinslandi) All beach areas,...

  17. 21 CFR 201.24 - Labeling for systemic antibacterial drug products.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Labeling for systemic antibacterial drug products. 201.24 Section 201.24 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... antibacterial drug products. The labeling of all systemic drug products intended for human use indicated...

  18. 30 CFR 243.201 - How will MMS determine if I am financially solvent?

    Science.gov (United States)

    2010-07-01

    ... solvent? 243.201 Section 243.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial... making payments found in 30 CFR 218.51. You are not required to use Electronic Funds Transfer (EFT)...

  19. 48 CFR 53.201-1 - Contracting authority and responsibilities (SF 1402).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contracting authority and responsibilities (SF 1402). 53.201-1 Section 53.201-1 Federal Acquisition Regulations System FEDERAL ACQUISITION... responsibilities (SF 1402). SF 1402 (10/83), Certificate of Appointment. SF 1402 is prescribed for use...

  20. 48 CFR 853.201-1 - Contracting authority and responsibilities (SF 1402).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contracting authority and responsibilities (SF 1402). 853.201-1 Section 853.201-1 Federal Acquisition Regulations System DEPARTMENT OF... responsibilities (SF 1402). Standard Form (SF) 1402, Certificate of Appointment, is used in accordance with FAR...

  1. 9 CFR 201.43 - Payment and accounting for livestock and live poultry.

    Science.gov (United States)

    2010-01-01

    ... and live poultry. 201.43 Section 201.43 Animals and Animal Products GRAIN INSPECTION, PACKERS AND... poultry. (a) Market agencies to make prompt accounting and transmittal of net proceeds. Each market agency shall, before the close of the next business day following the sale of any livestock consigned to it...

  2. 9 CFR 201.82 - Care and promptness in weighing and handling livestock and live poultry.

    Science.gov (United States)

    2010-01-01

    ... handling livestock and live poultry. 201.82 Section 201.82 Animals and Animal Products GRAIN INSPECTION... handling livestock and live poultry. (a) Each stockyard owner, market agency, dealer, packer and live poultry dealer shall exercise reasonable care and promptness with respect to loading,...

  3. 40 CFR 1039.201 - What are the general requirements for obtaining a certificate of conformity?

    Science.gov (United States)

    2010-07-01

    ... for all decisions related to your application (see 40 CFR 1068.5). (e) An authorized representative of... obtaining a certificate of conformity? 1039.201 Section 1039.201 Protection of Environment ENVIRONMENTAL... obtaining a certificate of conformity? (a) You must send us a separate application for a certificate...

  4. 40 CFR 1042.201 - General requirements for obtaining a certificate of conformity.

    Science.gov (United States)

    2010-07-01

    ... for all decisions related to your application (see 40 CFR 1068.5). (e) An authorized representative of... certificate of conformity. 1042.201 Section 1042.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... of conformity. (a) You must send us a separate application for a certificate of conformity for...

  5. 40 CFR 1045.201 - What are the general requirements for obtaining a certificate of conformity?

    Science.gov (United States)

    2010-07-01

    ... CFR 1060.1 and 1060.601. The following general requirements apply for obtaining a certificate of... decisions related to your application (see 40 CFR 1068.5). (e) An authorized representative of your company... obtaining a certificate of conformity? 1045.201 Section 1045.201 Protection of Environment...

  6. 30 CFR 204.201 - Who may obtain accounting and auditing relief?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Who may obtain accounting and auditing relief? 204.201 Section 204.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief §...

  7. 7 CFR 767.201 - Real estate inventory property with important resources.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Real estate inventory property with important resources. 767.201 Section 767.201 Agriculture Regulations of the Department of Agriculture (Continued) FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS INVENTORY PROPERTY MANAGEMENT Real Estate Property With Important Resources or Located...

  8. 22 CFR 201.15 - U.S. flag vessel shipping requirements.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false U.S. flag vessel shipping requirements. 201.15... for USAID Financing § 201.15 U.S. flag vessel shipping requirements. (a) General requirements. Unless... regarding shipping arrangements with suppliers as will assure discharge of this responsibility....

  9. 37 CFR 201.9 - Recordation of agreements between copyright owners and public broadcasting entities.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Recordation of agreements between copyright owners and public broadcasting entities. 201.9 Section 201.9 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS §...

  10. 48 CFR 1519.201-72 - Small and disadvantaged business utilization specialists.

    Science.gov (United States)

    2010-10-01

    ... business utilization specialists. 1519.201-72 Section 1519.201-72 Federal Acquisition Regulations System... disadvantaged business utilization specialists. (a) Small Business Specialists (SBS) shall be appointed in... prescribed from time to time in furtherance of overall small and small disadvantaged business...

  11. 48 CFR 1519.201-71 - Director of Small and Disadvantaged Business Utilization.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Director of Small and Disadvantaged Business Utilization. 1519.201-71 Section 1519.201-71 Federal Acquisition Regulations System... Small and Disadvantaged Business Utilization. The Director, OSDBU, provides guidance and advice,...

  12. 48 CFR 419.201-70 - Office of Small and Disadvantaged Business Utilization (OSDBU).

    Science.gov (United States)

    2010-10-01

    ... Disadvantaged Business Utilization (OSDBU). 419.201-70 Section 419.201-70 Federal Acquisition Regulations System... and Disadvantaged Business Utilization (OSDBU). The Office of Small and Disadvantaged Business Utilization (OSDBU) develops rules, policy, procedures and guidelines for the effective administration of...

  13. 22 CFR 201.26 - Expenditure of marine insurance loss payments.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Expenditure of marine insurance loss payments... § 201.26 Expenditure of marine insurance loss payments. Unless otherwise authorized by USAID, any marine insurance loss payment under a marine insurance policy financed pursuant to this part 201 received by...

  14. 48 CFR 201.109 - Statutory acquisition-related dollar thresholds-adjustment for inflation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Statutory acquisition-related dollar thresholds-adjustment for inflation. 201.109 Section 201.109 Federal Acquisition...-adjustment for inflation. (d) A matrix showing the most recent escalation adjustments of...

  15. 7 CFR 201.70 - Limitations of generations for certified seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Limitations of generations for certified seed. 201.70... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.70 Limitations of generations for certified...

  16. 7 CFR 201.67 - Seed certifying agency standards and procedures.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Seed certifying agency standards and procedures. 201...) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.67 Seed certifying agency standards and procedures. In order to qualify as a seed certifying agency for purposes of section 101(a)(25) of the...

  17. 7 CFR 201.74 - Labeling of all classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Labeling of all classes of certified seed. 201.74... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.74 Labeling of all classes of certified seed....

  18. 7 CFR 201.72 - Production of all classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Production of all classes of certified seed. 201.72... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.72 Production of all classes of certified...

  19. 22 CFR 201.44 - Vesting in USAID of title to commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Vesting in USAID of title to commodities. 201... APPLICABLE TO COMMODITY TRANSACTIONS FINANCED BY USAID General Provisions Relating to USAID Financing of Commodities and Commodity-Related Services § 201.44 Vesting in USAID of title to commodities. (a) Vesting...

  20. 22 CFR 201.42 - Reexport of USAID-financed commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Reexport of USAID-financed commodities. 201.42... COMMODITY TRANSACTIONS FINANCED BY USAID General Provisions Relating to USAID Financing of Commodities and Commodity-Related Services § 201.42 Reexport of USAID-financed commodities. Unless specifically...

  1. Fast washout of thallium-201 from area of myocardial infarction: possible artifact of background subtraction

    Energy Technology Data Exchange (ETDEWEB)

    Brown, K.A.; Benoit, L.; Clements, J.P.; Wackers, F.J.

    1987-06-01

    A recent report described a pattern of reverse redistribution on poststreptokinase /sup 201/Tl studies which was believed to be due to rapid washout of /sup 201/Tl from the infarct area related to reperfusion of the infarct vessel. We have also observed the phenomenon of rapid washout of /sup 201/Tl from the area of infarction in the absence of thrombolytic therapy. This study was undertaken to test the hypothesis that rapid washout of /sup 201/Tl from an area of infarction is an artifact of background subtraction usually employed in analysis of washout. A total of 61 patients with previous myocardial infarction who underwent cardiac catheterization and exercise /sup 201/Tl imaging were examined. Thallium-201 images were analyzed using a validated quantitative method employing interpolative background correction. Abnormally increased /sup 201/Tl washout was noted in 11 infarct segments in 10 (18%) patients. Infarct segments with rapid washout had significantly less initial uptake, and more severe associated wall motion abnormalities than infarct segments with normal washout. When quantitative analysis was repeated without background subtraction, no segments with rapid washout were observed. A phantom model was constructed to further test our hypothesis. The frequency of observed rapid washout was directly related to the severity of the initial defect and was entirely dependent upon utilizing background correction during the quantitative analysis. Our study suggests that rapid washout of /sup 201/Tl in an area of previous infarction reflects an artifact of background subtraction involved with standard quantitative analysis.

  2. 7 CFR 201.58c - Detection of captan, mercury, or thiram on seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Detection of captan, mercury, or thiram on seed. 201.58c Section 201.58c Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL... Detection of captan, mercury, or thiram on seed. The bioassay method may be used according to the...

  3. Degradation of myocardial perfusion SPECT images caused by contaminants in thallous (201Tl) chloride

    NARCIS (Netherlands)

    Staelens, S.G.; De Wit, T.C.; Lemahieu, I.A.; Beekman, F.J.

    2008-01-01

    Purpose Thallous (201Tl) chloride is a single-photon emission computed tomography (SPECT) tracer mainly used for assessing perfusion and viability of myocardial tissue. 201Tl emits X-rays around 72 keV and gammas at 167 keV, and has a half-life of 73 h. Regulations allow an intrinsic contamination

  4. 21 CFR 201.129 - Drugs; exemption for radioactive drugs for research use.

    Science.gov (United States)

    2010-04-01

    ... to human research subjects during the course of a research project intended to obtain basic research... labeled drug or regarding human physiology, pathophysiology, or biochemistry (but not intended for... research use. 201.129 Section 201.129 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH...

  5. Excessive grooming induced by somatostatin or its analog SMS 201-995

    NARCIS (Netherlands)

    Wimersma Greidanus, T.B. van; Maigret, C.; Krechting, B.

    1987-01-01

    Intracerebroventricular (i.c.v.) administration of somatostatin or SMS 201-995 induces excessive grooming behavior in rats. The grooming inducing effect of somatostatin is rather weak, as doses of 300 ng or less did not result in increased total grooming scores. In contrast a dose of 10 ng SMS 201-9

  6. 37 CFR 201.26 - Recordation of documents pertaining to computer shareware and donation of public domain computer...

    Science.gov (United States)

    2010-07-01

    ... pertaining to computer shareware and donation of public domain computer software. 201.26 Section 201.26... GENERAL PROVISIONS § 201.26 Recordation of documents pertaining to computer shareware and donation of public domain computer software. (a) General. This section prescribes the procedures for submission...

  7. Effect of a somatostatin analogue, SMS 201-995, on 133Xe clearance from colonic muscosa in unanesthetized man

    International Nuclear Information System (INIS)

    The effect of intravenous bolus injection of the somatostatin analogue SMS 201-995 on mucosal and submucosal blood flow was studied with the local 133Xe clearance technique in eight subjects. Mucosal and submocosal blood flow decreased by 33% after injection of SMS 201-995. These observations suggest that SMS 201-995, like somatostatin, inhibits splanchnic blood flow

  8. 37 CFR 201.34 - Procedures for filing Correction Notices of Intent to Enforce a Copyright Restored under the...

    Science.gov (United States)

    2010-07-01

    ... prescribed in § 201.3(c). (2) Method of payment. See 37 CFR 201.33(e)(1),(2). (f) Public online access... Office History Documents (COHD) file through the Library of Congress electronic information system.... (3) Restored work. For the definition of works restored under the URAA, see 37 CFR 201.33. (c)...

  9. 37 CFR 201.13 - Notices of objection to certain noncommercial performances of nondramatic literary or musical works.

    Science.gov (United States)

    2010-07-01

    ... certain noncommercial performances of nondramatic literary or musical works. 201.13 Section 201.13 Patents... PROVISIONS § 201.13 Notices of objection to certain noncommercial performances of nondramatic literary or... preventing the noncommercial performance of a nondramatic literary or musical work under...

  10. 31 CFR 597.201 - Prohibited transactions involving blocked assets or funds of foreign terrorist organizations or...

    Science.gov (United States)

    2010-07-01

    ... blocked assets or funds of foreign terrorist organizations or their agents. 597.201 Section 597.201 Money... CONTROL, DEPARTMENT OF THE TREASURY FOREIGN TERRORIST ORGANIZATIONS SANCTIONS REGULATIONS Prohibitions § 597.201 Prohibited transactions involving blocked assets or funds of foreign terrorist...

  11. 14 CFR 11.201 - Office of Management and Budget (OMB) control numbers assigned under the Paperwork Reduction Act.

    Science.gov (United States)

    2010-01-01

    ... PROCEDURES Paperwork Reduction Act Control Numbers § 11.201 Office of Management and Budget (OMB) control... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Office of Management and Budget (OMB) control numbers assigned under the Paperwork Reduction Act. 11.201 Section 11.201 Aeronautics and...

  12. Evaluation of Tl-201 SPECT imaging findings in prostate cancer

    Directory of Open Access Journals (Sweden)

    Sinem Ozyurt

    2015-07-01

    Full Text Available Objectives: To compare with histopathological findings the findings of prostate cancer imaging by SPECT method using Tl-201 as a tumor seeking agent. Methods: The study comprised 59 patients (age range 51-79 years, mean age 65.3 ± 6.8 years who were planned to have transrectal ultrasonography (TRUS-guided biopsies due to suspicion of prostate cancer between April 2011 and September 2011. Early planar, late planar and SPECT images were obtained for all patients. Scintigraphic evaluation was made in relation to uptake presence and patterns in the visual assessment and to Tumor/Background (T/Bg ratios for both planar and SPECT images in the quantitative assessment. Histopathological findings were compatible with benign etiology in 36 (61% patients and malign etiology in 23 (39% patients. Additionally, comparisons were made to evaluate the relationships between uptake patterns,total PSA values and Gleason scores. Results: A statistically significant difference was found between the benign and malignant groups in terms of uptake in planar and SPECT images and T/Bg ratios and PSA values. No statistically significant difference was found between uptake patterns of planar and SPECT images and Gleason scores in the malignant group. Conclusions: SPECT images were superior to planar images in the comparative assessment. Tl-201 SPECT imaging can provide an additional contribution to clinical practice in the diagnosis of prostate cancer and it can be used in selected patients.

  13. Effect of insulin on the tissue distribution of thallium-201

    International Nuclear Information System (INIS)

    Translocation of potassium under the influence of insulin has been repeatedly demonstrated by various investigators during the past 50 years. Accordingly, it is expected that insulin administration would affect the distribution pattern of the potassium analogue thallium-201. To test the validity of this assumption, the present study was performed on 46 rabbits, with an average weight of 3.9 +- 0.8 pounds. To study the effects of the factors involved in the administration of insulin and its dosage, the rabbits were divided into groups; each group being studied on a separate day. The experimental animals were sacrificed exactly 10 minutes after the intravenous injection of radiothallium. The results of the present study showed that thallium-201 uptake per gram tissue varied from one batch to another. However, the radioactivity uptake per gram by the different organs showed a constant pattern. Among the organs studied, the highest level of radioactivity per gram was encountered in the kidneys and heart, followed by the lungs. Then came the liver and lastly the striated muscles. Insulin administration caused an increase in the radioactivity uptake in all the organs studied. The magnitude of this increment was highest in the heart, kidneys and lungs; moderate in the liver, and slight in the striated muscles. In addition, the effect of insulin occurred at an optimum time that varied with the route of administration and was dose related up to a certain level. (author)

  14. Synthesis and in vivo evaluation of {sup 201}Tl(III)-DOTA complexes for applications in SPECT imaging

    Energy Technology Data Exchange (ETDEWEB)

    Hijnen, Nicole M.; Vries, Anke de [Biomedical NMR, Department of Biomedical Engineering, Eindhoven University of Technology, 5600 MB Eindhoven (Netherlands); Blange, Roy [Department of Biomolecular Engineering, Antwerp University, 2610 Antwerp (Belgium); Burdinski, Dirk [Department of Biomolecular Engineering, Philips Research, 5656 AE Eindhoven (Netherlands); Gruell, Holger, E-mail: h.gruell@tue.n [Biomedical NMR, Department of Biomedical Engineering, Eindhoven University of Technology, 5600 MB Eindhoven (Netherlands); Department of Biomolecular Engineering, Philips Research, 5656 AE Eindhoven (Netherlands)

    2011-05-15

    Introduction: The aim of this study was to assess the use of {sup 201}thallium{sup 3+} ({sup 201}Tl{sup 3+}) as a radiolabel for nuclear imaging tracers. Methods for labeling of 1,4,7,10-tetraazacyclododecane-N,N',N'',N''' tetraacetic acid (DOTA) and diethylenetriaminepentaacetic acid (DTPA) chelators with {sup 201}Tl{sup 3+} were investigated, and the levels of stability of these chelates were tested in vitro and in vivo. Methods: {sup 201}Tl(I)Cl was treated with hydrochloric acid and ozone to form {sup 201}Tl(III)Cl{sub 3}. The procedure for labeling of DOTA and DTPA was optimized, testing different buffer solutions and pH values. The stability levels of {sup 201}Tl(III)-DOTA and {sup 201}Tl(III)-DTPA were assessed in buffer, mouse serum and human serum (1:1, v/v) at a temperature of 310 K for 48 h. Subsequently, in vivo stability studies with {sup 201}Tl(III)-DOTA were performed, comparing the biodistribution of {sup 201}Tl(III)-DOTA with that of {sup 201}Tl(I)Cl in a single-isotope study and with that of {sup 177}Lu(III)-DOTA in a dual-isotope single photon emission computed tomography study. Results: {sup 201}Tl(III)-DTPA, {sup 201}Tl(III)-DOTA and {sup 177}Lu(III)-DOTA were prepared with >95% radiochemical purity. While {sup 201}Tl(III)-DOTA showed a prolonged level of stability in buffer and serum, {sup 201}Tl was quickly released from DTPA in serum. Apart from some urinary excretion, the biodistribution of DOTA-chelated {sup 201}Tl{sup 3+} was similar to that of free (ionic) {sup 201}Tl{sup +} and did not match the biodistribution of {sup 177}Lu(III)-DOTA. This indicated a limited stability of {sup 201}Tl(III)-DOTA complexes in vivo. Conclusion: Despite promising results on the labeling and in vitro stability of {sup 201}Tl(III)-DOTA, our in vivo results indicate that the integrity of {sup 201}Tl(III)-DOTA decreases to <20% during the time required for urinary excretion, thereby limiting the use of {sup 201}Tl{sup 3+} as a

  15. Synthesis and in vivo evaluation of 201Tl(III)-DOTA complexes for applications in SPECT imaging

    International Nuclear Information System (INIS)

    Introduction: The aim of this study was to assess the use of 201thallium3+ (201Tl3+) as a radiolabel for nuclear imaging tracers. Methods for labeling of 1,4,7,10-tetraazacyclododecane-N,N',N'',N''' tetraacetic acid (DOTA) and diethylenetriaminepentaacetic acid (DTPA) chelators with 201Tl3+ were investigated, and the levels of stability of these chelates were tested in vitro and in vivo. Methods: 201Tl(I)Cl was treated with hydrochloric acid and ozone to form 201Tl(III)Cl3. The procedure for labeling of DOTA and DTPA was optimized, testing different buffer solutions and pH values. The stability levels of 201Tl(III)-DOTA and 201Tl(III)-DTPA were assessed in buffer, mouse serum and human serum (1:1, v/v) at a temperature of 310 K for 48 h. Subsequently, in vivo stability studies with 201Tl(III)-DOTA were performed, comparing the biodistribution of 201Tl(III)-DOTA with that of 201Tl(I)Cl in a single-isotope study and with that of 177Lu(III)-DOTA in a dual-isotope single photon emission computed tomography study. Results: 201Tl(III)-DTPA, 201Tl(III)-DOTA and 177Lu(III)-DOTA were prepared with >95% radiochemical purity. While 201Tl(III)-DOTA showed a prolonged level of stability in buffer and serum, 201Tl was quickly released from DTPA in serum. Apart from some urinary excretion, the biodistribution of DOTA-chelated 201Tl3+ was similar to that of free (ionic) 201Tl+ and did not match the biodistribution of 177Lu(III)-DOTA. This indicated a limited stability of 201Tl(III)-DOTA complexes in vivo. Conclusion: Despite promising results on the labeling and in vitro stability of 201Tl(III)-DOTA, our in vivo results indicate that the integrity of 201Tl(III)-DOTA decreases to 201Tl3+ as a radiolabel for tracer imaging.

  16. The effects of chemical and radioactive properties of Tl-201 on human erythrocyte glutathione reductase activity

    International Nuclear Information System (INIS)

    Aim: The aim of the study was to evaluate the inhibitory effects of thallium-201 (201Tl) solution on human erythrocyte glutathione reductase (GR) activity. Methods: Erythrocyte GR was initially purified by 2′,5′-adenosine diphosphate Sepharose-4B affinity and Sephadex G-200 gel filtration chromatography. The purification was monitored by sodium dodecyl sulfate–polyacrylamide gel electrophoresis, which showed a single band for the final enzyme preparation. The in vitro and in vivo effects of the 201Tl solution including Tl+, Fe+3 and Cu+2 metals and the in vitro effects of the radiation effect of the 201Tl solution and nonradioactive Tl+, Fe+3 and Cu+2 metals on human erythrocyte GR enzyme were studied. Enzyme activity was determined with the Beutler method at 340 nm using a spectrophotometer. All purification procedures were carried out at +4°C. Results: Glutathione reductase was purified 2033-fold at a yield of 28.17%. 201Tl solution and radiation exposure had inhibitory effects on the enzyme activity. Besides, effects of nonradioactive Tl+, Fe+3 and Cu+2 were studied on enzyme activity in vitro. Furthermore, seven human patients were also used for in vivo studies of 201Tl solution. Conclusion: It was detected in in vitro and in vivo studies that the human erythrocyte GR enzyme is inhibited due to the radiation effect of 201Tl solution.

  17. Preoperative evaluation of brain lesion with {sup 201}TI brain SPECT: is it useful to differentiate benign and malignant lesions?

    Energy Technology Data Exchange (ETDEWEB)

    Sohn, Hyung Sun; Kim, Euy Neyng; Kim, Sung Hoon; Chung, Yong An; Chung, Soo Kyo; Hong, Yong Gil; Lee, Youn Soo [College of Medicine, The Catholic Univ., Seoul (Korea, Republic of)

    2000-10-01

    Thallium-201 ({sup 201}TI) brain SPECT, which can represent cellular activity of brain lesions, may provide more useful information in differentiating between benign and malignant brain lesions more so than CT or MRI, that merely represents anatomic changes or breakdown of blood brain barrier. We used {sup 201}TI brain SPECT prospectively to evaluate the utility of {sup 201}TI-indices as an indicator of benign or malignant lesions. We studied 28 patients. There were 13 cases of benign lesions (3: nonspecific benign lesion, 3: meningioma, 2: low grade glioma, 1: tuberculoma, central neurocytoma, hemangioblastoma, radiation necrosis, and choroid plexus papilloma) and 15 cases of malignant lesions (6: glioblastoma multiforme, 5: anaplastic glioma, 2: medulloblastoma, 1: metastasis and lymphoma). In all patients, CT and/or MRI were obtained and then {sup 201}TI brain SPECT was obtained with measuring mean {sup 201}TI index and peak {sup 201}TI index. An unpaired t-test was performed to compare the {sup 201}TI-indices and pathologic diagnoses to evaluate the utility of {sup 201}TI-indices as an indicator of benign or malignant lesions. There were no statistically significant difference in {sup 201}TI-indices between benign and malignant brain lesions (P>0.05). These results demonstrated that we could not use {sup 201}TI indices on brain SPECT alone as an indicator of benign or malignant brain lesions.

  18. Codon 201Gly Polymorphic Type of the DCC Gene is Related to Disseminated Neuroblastoma

    Directory of Open Access Journals (Sweden)

    Xiao-Tang Kong

    2001-01-01

    Full Text Available The deleted in colorectal carcinoma (DCC gene is a potential tumor- suppressor gene on chromosome 18821.3. The relatively high frequency of loss of heterozygosity (LOH and loss of expression of this gene in neuroblastoma, especially in the advanced stages, imply the possibility of involvement of the DCC gene in progression of neuroblastoma. However, only few typical mutations have been identified in this gene, indicating that other possible mechanisms for the inactivation of this gene may exist. A polymorphic change (Arg to Gly at DCC codon 201 is related to advanced colorectal carcinoma and increases in the tumors with absent DCC protein expression. In order to understand whether this change is associated with the development or progression of neuroblastoma, we investigated codon 201 polymorphism of the DCC gene in 102 primary neuroblastomas by polymerase chain reaction single-strand conformation polymorphism. We found no missense or nonsense mutations, but a polymorphic change from CGA (Arg to GGA (Gly at codon 201 resulting in three types of polymorphism: codon 201Gly type, codon 201Arg/Gly type, and codon 201Arg type. The codon 201Gly type occurred more frequently in disseminated (stages IV and IVs neuroblastomas (72% than in localized (stages I, II, and III tumors (48% (P=.035, and normal controls (38% (P=.024. In addition, the codon 201Gly type was significantly more common in tumors found clinically (65% than in those found by mass screening (35% (P=.002. The results suggested that the codon 201Gly type of the DCC gene might be associated with a higher risk of disseminating neuroblastoma.

  19. Effect of eating on thallium-201 myocardial redistribution after myocardial ischemia

    International Nuclear Information System (INIS)

    To determine whether eating a high-carbohydrate meal between initial and delayed postexercise thallium-201 (Tl-201) imaging affects detection of Tl-201 redistribution during exercise stress testing, 16 patients with stable angina performed 2 Tl-201 treadmill exercise stress tests within a 14-day interval. Immediately after initial postexercise imaging, patients either drank a commercially available instant breakfast preparation for the intervention test or drank an equivalent volume of water for the control test. Comparable exercise workloads were achieved by exercising patients to the same heart rate for both tests. The order of the 2 (intervention and control) tests were randomized. All patients had at least 1 region of Tl-201 myocardial redistribution on either their eating or control test scans, although only 7 of the 16 had positive treadmill exercise test responses. Forty-six regions showing Tl-201 myocardial redistribution were identified in all 144 regions examined. Significantly more of these regions were identified on control test scans than on eating test scans: 11 of 46 on both test scans, 6 of 46 only on eating test scans and 29 of 46 only on control scans (p less than 0.001). Consistent with results of the quantitative regional analysis, the percentage of Tl-201 clearance over 4 hours in the 46 Tl-201 myocardial redistribution regions was 39 +/- 8% for the eating tests and 29 +/- 8% for control tests (mean +/- standard deviation, p less than 0.003). In 4 patients diagnosis of transient ischemia would have been missed because their 14 Tl-201 myocardial redistribution regions were detected only on the control test scans

  20. Brain abscess uptake at TI-201 brain SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Won Hyoung; Han, Eun Ji; Yoo, Ie Ryung; Chung, Yong An; Sohn, Hyung Sun; Kim, Sung Hoon; Chung, Soo Kyo; Choi, Yeong Jin [The Catholic University of Korea, Seoul (Korea, Republic of)

    2007-08-15

    A 22-year-old woman with a history of acute lymphoblastic leukemia was hospitalized for headache and vomiting CT scan showed a well-defined, ring like enhancing mass in the left frontal lobe with surrounding edema and midline shift. Magnetic resonance imaging demonstrated a round homogeneous mass with a ring of enhancement in the left frontal lobe. TI-201 brain SPECT showed increased focal uptake coinciding with the CT and MRI abnormality. Aspiration of the lesion performed through a burr hole yielded many neutrophils, a few lymphocytes and histiocytes with some strands of filamentous microorganism-like material. Modified AFB stained negative for norcardia. Gram stain showed a few white blood cells and no microorganism. Antibiotics were started and produced a good clinical response. After one month, CT scan showed markedly reduction in size and extent was observed.

  1. Effectiveness of oblique section display in thallium-201 myocardial tomography

    Energy Technology Data Exchange (ETDEWEB)

    O' Brien, A.R.; Gemmell, H.G.

    1986-08-01

    A simple left ventricle phantom, placed in a water-filled body phantom, has been used to compare the detectability of simulated perfusion defects in short-axis oblique sections with transverse section tomography and conventional planar imaging. Images of the phantom were assessed by five experienced observers and their responses analysed on a lesion-by-lesion basis. No significant difference in defect detectability was found between planar imaging and transverse section tomography. However, following reorientation of the transverse section data into oblique planes perpendicular to the long-axis of the phantom there was a statistically significant increase in defect detectability compared with planar imaging. Observers also detected significantly more defects using oblique section display compared with the original transverse sections. This suggests that reformatting of the transverse sections into oblique planes may be essential to realize the full potential of thallium-201 myocardial tomography.

  2. 201 MHz Cavity R and D for MUCOOL and MICE

    International Nuclear Information System (INIS)

    We describe the design, fabrication, analysis and preliminary testing of the prototype 201 MHz copper cavity for a muon ionization cooling channel. Cavity applications include the Muon Ionization Cooling Experiment (MICE) as well as cooling channels for a neutrino factory or a muon collider. This cavity was developed by the US muon cooling (MUCOOL) collaboration and is being tested in the MUCOOL Test Area (MTA) at Fermilab. To achieve a high accelerating gradient, the cavity beam irises are terminated by a pair of curved, thin beryllium windows. Several fabrication methods developed for the cavity and windows are novel and offer significant cost savings as compared to conventional construction methods. The cavity's thermal and structural performances are simulated with an FEA model. Preliminary high power RF commissioning results will be presented

  3. 201Hg excitation in plasma produced by laser

    International Nuclear Information System (INIS)

    The use of high power lasers allows the study of the properties of matter in extreme conditions of temperature and density. Indeed, the interaction of a power laser and a target creates a plasma in which the temperature is high enough to reach important degrees of ionization. These conditions can allow the excitation of the nucleus. A nucleus of interest to study the processes of nuclear excitation is the 201Hg. This work aims to design an experiment where the 201Hg excitation will be observed in a plasma produced by a high power laser. The first part of this manuscript presents the calculation of the expected nuclear excitation rates in the plasma. For about ten years, nuclear excitation rates have been calculated using the average atom model. To validate this model a code named ADAM (French acronym for Beyond The Average Atom Model) was developed to calculate the nuclear excitation rates under the DCA (Detailed Configuration Accounting) hypothesis. ADAM allows us to deduce the thermo dynamical domain where the nuclear excitation rates determined with the average atom model are relevant. The second part of this manuscript presents the coupling of the excitation rate calculation with a hydrodynamic code to calculate the number of excited nuclei produced in one laser shot for different laser intensity. Finally, in the last part, first experimental approaches which will be used to design an experiment on a laser installation are presented. These approaches are based on the detection and determination of the amount of multicharged ions obtained far from the target (∼80 cm). For this purpose, an electrostatic analyzer was used. (author)

  4. Diagnostic advantages of the association of electrocardiograms and thallium 201 exercise scintigraphy in detecting coronary disease

    International Nuclear Information System (INIS)

    Thallium 201 exercise scintigraphy combined with 14-lead exercise electrocardiography detects coronary artery disease in 95-96 percent of the patients, whether men or women. When both tests were positive, 93 percent of the men and 100 percent of the women had coronary artery disease. In women, thallium 201 seems to do better than 14-lead exercise electrocardiogram, detecting the presence of coronary artery disease in 72 percent and its absence in 83 percent of the cases. In approximately 50 percent of the cases, the results of thallium 201 and multiple-lead exercise testing were discordant; in these cases, an accurate clinical history is helpful. (author)

  5. Tl-201 uptake in bone and soft tissue involvement of sarcoidosis.

    Science.gov (United States)

    Degirmenci, B; Mavi, A; Ozkal, S; Itil, O; Havitcioglu, H; Ozaksoy, D; Yilmaz, M; Kaya, G C

    2001-06-01

    The authors describe a 38-year-old man who was referred to the nuclear medicine department because of pain and swelling of his fingers in both hands. Tc-99m MDP and Tl-201 scans were performed to evaluate the lesions. A Tc-99m MDP bone scan showed hyperemia and increased uptake in the lesions. A Tl-201 scan showed marked uptake in both early and delayed images in the lesions of his fingers. Bone biopsy and histologic examination confirmed sarcoidosis. This case indicates that Tl-201 uptake can be seen in bone lesions resulting from sarcoidosis. PMID:11353294

  6. Usefulness of 201Tl SPECT in the evaluation of treatment effect for primary lung cancer

    International Nuclear Information System (INIS)

    Thallium-201 single photon emission computed tomography (201Tl SPECT) was performed on 20 patients with primary lung cancer before and after treatment (radiotherapy alone or combination of chemotherapy and radiotherapy). They were divided into early recurrence group and no recurrence group by presence of local tumor regrowth within 6 months after treatment. Retention index (Ret. I) after treatment was significantly lower (p201Tl SPECT indicated viability of residual mass, so it was useful in the evaluation of treatment effect for primary lung cancer. (author)

  7. sup(99m)Tc-pyrophosphate and 201Tl myocardial scintigrams in a patient with myocarditis

    International Nuclear Information System (INIS)

    Myocardial necrosis in acute myocarditis was investigated by scintigraphy. sup(99m)Tc-pyrophosphate (PYP) and 201TI myocardial scintigrams were obtained on a patient with acute myocarditis due to mycoplasma infection. sup(99m)Tc-PYP myocardial scintigrams in the acute stage demonstrated grade 2+ findings, which remained until the chronic stage. 201TI myocardial scintigrams in the acute stage revealed impaired perfusion restricted to the posterolateral wall, and this decrease continued through the chronic stage. It was concluded that both of sup(99m)Tc-PYP and 201TI myocardial scintigrams can reveal abnormality of acute myocarditis. (Ueda, J.)

  8. 反渗透阻垢剂HLH-201的性能研究%Research on Properties of Scale Inhibitor HLH-201 for Reverse Osmosis

    Institute of Scientific and Technical Information of China (English)

    张英雄; 邢琳; 曹宗仑; 平春霞

    2012-01-01

    采用静态阻垢法和动态阻垢法对自行研制的以聚环氧琥珀酸为主的反渗透阻垢剂HLH-201进行了性能研究.静态阻垢结果表明,阻垢剂质量浓度为4.0 mg/L时,对CaCO3的阻垢率达到89.0%.动态阻垢结果表明,HLH-201能够满足对黄河水的阻垢要求,在加酸调节pH为6.8~7.0时,浓缩倍数可以达到5.0倍.%The properties of the self-made scale inhibitor HLH-201 for reverse osmosis, which is based on polyepoxysuccinic acid, were studied by static scale inhibition method and dynamic scale inhibition method. The static scale inhibition results show that when the mass concentration of HLH-201 is 4.0 mg/L, the scale inhibition efficiency for CaCO3 can reach 89.0%. The dynamic scale inhibition results show that the HLH-201 can meet the requirements for scale inhibition of Yellow river water, and when pH is adjusted to 6.8-7.0 with acid, the concentration ratio can reach 5.0.

  9. 7 CFR 201.48 - Kind or variety considered pure seed.

    Science.gov (United States)

    2010-01-01

    ... purity procedures for smooth brome, chewings fescue, red fescue, orchardgrass, fairway crested wheatgrass... within the seed unit. Refer to § 201.51(c)(1) for inert matter classification. (i) Seed units of beet...

  10. Tank characterization report for single-shell tank 241-B-201

    Energy Technology Data Exchange (ETDEWEB)

    Conner, J.M., Fluor Daniel Hanford

    1997-02-03

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-201. This report supports the requirements of the Ri- Party Agreement Milestone M-44-05.

  11. 201Tl+-labelled Prussian blue nanoparticles as contrast agents for SPECT scintigraphy

    Science.gov (United States)

    Perrier, M.; Busson, M.; Massasso, G.; Long, J.; Boudousq, V.; Pouget, J.-P.; Peyrottes, S.; Perigaud, Ch.; Porredon-Guarch, C.; de Lapuente, J.; Borras, M.; Larionova, J.; Guari, Y.

    2014-10-01

    Prussian blue (PB) and its analogues on the nanometric scale are exciting nano-objects that combine the advantages of molecular-based materials and nanochemistry. Herein, we demonstrate that ultra-small PB nanoparticles of 2-3 nm can be easily labelled with radioactive 201Tl+ to obtain new nanoprobes as radiotracers for 201-thallium-based imaging.Prussian blue (PB) and its analogues on the nanometric scale are exciting nano-objects that combine the advantages of molecular-based materials and nanochemistry. Herein, we demonstrate that ultra-small PB nanoparticles of 2-3 nm can be easily labelled with radioactive 201Tl+ to obtain new nanoprobes as radiotracers for 201-thallium-based imaging. Electronic supplementary information (ESI) available: Experimental details and procedures, toxicological data, PXRD, TEM images, kinetics and adsorption isotherms, SPECT/CT images, Tl+ captation profiles. See DOI: 10.1039/c4nr03044c

  12. Clinical evaluation of the ipsilateral lung uptake of 201TlCl in spontaneous pneumothorax

    International Nuclear Information System (INIS)

    A case of re-expansion pulmonary edema following the treatment of spontaneous pneumothorax was reported, and in 3 other cases of this disease, perfusion lung scintigraphy with sup(99m)Tc-MAA and myocardial scintigraphy with 201TlCl were performed in order to evaluate the regional pulmonary arterial perfusion and lung uptake of 201Tl. The perfusion decrease and the marked uptake of 201Tl were observed in the ipsilateral lung of 2 cases. In a previous study, we reported that diffuse bilateral lung uptake of 201Tl, which was distributed in more than 90% of the extravascular space of the lung, was observed in various cases with heart disease, diffuse interstitial pneumonia etc. Therefore, it seems that ipsilateral lung in cases with spontaneous pneumothorax may be accompanied with a subclinical increased vascular permeability and abnormal accumulation of interstitial fluid. Thus patients with spontaneous pneumothorax will be predisposed to re-expansion pulmonary edema. (author)

  13. Clinical evaluation of the ipsilateral lung uptake of /sup 201/TlCl in spontaneous pneumothorax

    Energy Technology Data Exchange (ETDEWEB)

    Fujii, T.; Hirayama, J.; Kanai, H.; Kanbayashi, T.; Mimura, N.; Amamiya, H. (Shinshu Univ., Matsumoto, Nagano (Japan). Faculty of Medicine)

    1982-08-01

    A case of re-expansion pulmonary edema following the treatment of spontaneous pneumothorax was reported, and in 3 other cases of this disease, perfusion lung scintigraphy with sup(99m)Tc-MAA and myocardial scintigraphy with /sup 201/TlCl were performed in order to evaluate the regional pulmonary arterial perfusion and lung uptake of /sup 201/Tl. The perfusion decrease and the marked uptake of /sup 201/Tl were observed in the ipsilateral lung of 2 cases. In a previous study, we reported that diffuse bilateral lung uptake of /sup 201/Tl, which was distributed in more than 90% of the extravascular space of the lung, was observed in various cases with heart disease, diffuse interstitial pneumonia etc. Therefore, it seems that ipsilateral lung in cases with spontaneous pneumothorax may be accompanied with a subclinical increased vascular permeability and abnormal accumulation of interstitial fluid. Thus patients with spontaneous pneumothorax will be predisposed to re-expansion pulmonary edema.

  14. Role of thallium-201 total-body scintigraphy in follow-up of thyroid carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Hoefnagel, C.A.; Delprat, C.C.; Marcuse, H.R.; de Vijlder, J.J.

    1986-12-01

    To evaluate the reliability of total-body scintigraphy using (/sup 201/Tl)chloride in postoperative follow-up of thyroid carcinoma, this procedure was performed in 326 patients after total thyroidectomy for thyroid carcinoma. The results were compared with those of 131I scintigraphy and thyroglobulin assays. /sup 201/Tl total-body scintigraphy was found to have the greatest sensitivity (94%), whereas /sup 131/I scintigraphy had the highest specificity (99%). It is shown that /sup 201/Tl total-body scintigraphy is a useful procedure in follow-up of thyroid cancer, however, the combination of parameters provides the greatest reliability. In medullary thyroid carcinoma, which is usually /sup 131/I negative, /sup 201/Tl total-body scintigraphy can be of great value for the localization of metastases which are indicated by elevated serum levels of calcitonin and carcinoembryonic antigen.

  15. 19 CFR 201.17 - Procedures for requesting access to records.

    Science.gov (United States)

    2010-04-01

    ... GENERAL APPLICATION Availability of Information to the Public Pursuant to 5 U.S.C. 552 § 201.17 Procedures... life or physical safety of an individual; (ii) An urgency to inform the public about an actual...

  16. Extraction chromatography in isotope production: application in the production of 67Ga and 201Tl

    International Nuclear Information System (INIS)

    Extraction chromatography was applied to the production of the radioisotopes 67Ga and 201Tl. 67Ga was produced by irradiation of natural zinc target with 24 MeV protons in a cyclotron. The separation of 67Ga was carried out by extraction chromatography from 6N HCL. 201Tl was produced in a similar way using lead as a precursor, and it was extracted using 4N HNO3 or HCL. (U.K.)

  17. Effects of ischemic-like insult on myocardial 201Tl accumulation

    International Nuclear Information System (INIS)

    Despite extensive clinical use of thallium-201 (201Tl) for myocardial imaging, the effect of ischemia on myocardial accumulation and release of 201Tl independent of flow has not been fully defined. Therefore, myocardial accumulation of 201Tl in response to ischemic-like myocardial injury was assessed in vitro using the cultured fetal mouse heart preparation. Cultured fetal mouse hearts (n . 311) were subjected to injury simulating ischemia by deprivation of oxygen and oxidizable substrates for periods ranging from 15 minutes to 10 hours. The extent of irreversible injury was determined by the percentage of lactic dehydrogenase (LDH) lost from the hearts to the culture medium during recovery from injury. Injury was essentially reversible at 1 hour of insult. The fraction of 201Tl content in injured compared with control hearts was not significantly lower after 1 hour of insult. By 3 hours of insult, irreversible injury as assessed by loss of LDH was detectable and the extent of injury increased progressively through 10 hours. During the 3-10-hour period of irreversible injury, 201Tl accumulation within injured hearts compared with controls was related in a monotonically decreasing fashion to the loss of LDH as described by a mathematical kinetic model that fit the observations closely (R2 greater than 0.99). These results indicate that in this organ culture preparation, in which there is effectively an unlimited reservoir of 201Tl and no confounding effects of perfusion, the time-dependent 201Tl accumulation is determined by the extent of irreversible injury

  18. 37 CFR 201.4 - Recordation of transfers and certain other documents.

    Science.gov (United States)

    2010-07-01

    ... and for digital audio recording devices and media (17 U.S.C. 111(d), 119(b) and 1003(c); see 37 CFR... or more public broadcasting entities and certain owners of copyright (17 U.S.C. 118; see 37 CFR 201.9... located outside of the 48 contiguous States (17 U.S.C. 111(e); see 37 CFR 201.12); (ii) Notices...

  19. Froth characteristic of MIBC and BK-201 frothers%起泡剂MIBC和BK-201的浮选泡沫特性

    Institute of Scientific and Technical Information of China (English)

    曾培; 欧乐明; 冯其明; 李洪强; 张福亚

    2015-01-01

    选用非极性基结构不同的起泡剂MIBC和BK-201,利用自制的泡沫性能测试系统,在两相泡沫体系下,测定两相泡沫不同高度处的气泡直径、静压强、表观溢流速度,研究起泡剂对泡沫特征及夹带的影响.结果表明:增加起泡剂浓度,气泡的兼并行为受到抑制,气泡直径逐渐减小;当MIBC浓度超过75 mg/L、BK-201浓度超过150 mg/L时,兼并行为受到显著抑制,气泡直径基本保持不变.在相同的浓度下,相比MIBC,BK-201产生的泡沫气泡直径大、含液率低、水回收速率低.因而,微细粒脉石在BK-201所形成泡沫中夹带更弱,浮选选择性更好.%By using self-designed foam property testing system, two nonpolar base structure frothers, MIBC and BK-201 were chosen to study the influences of frothers on the foam characteristic and entrainment by measuring the bubble diameter, static pressure and apparent flooding velocity in the two-phase foam. The results show that bubble merger degree reduces and air bubble diameter decreases with increasing frothers concentration. When the concentrations of MIBC and BK-201 are more than 75 and 150 mg/L, respectively, the air bubble diameter basically remains unchanged because the merger behavior is dramatically depressed. Under the same concentration, BK-201 generates larger diameter bubble, lower liquid holdup and lower water recovery compared with MIBC. As a result, the foam entrainment of fine gangue is weaker and the selectivity of flotation is better when BK-201 is used.

  20. Thallium-201 stress-redistribution myocardial rotational tomography: development of criteria for visual interpretation

    International Nuclear Information System (INIS)

    Despite high sensitivity and specificity for overall detection of coronary artery disease (CAD), planar stress-redistribution thallium-201 (Tl-201) scintigraphy remains suboptimal in localizing disease, because of overlap of myocardial segments. Single photon emission computerized tomography (SPECT), by providing three-dimensional representation of myocardial Tl-201, offers promise for improved localization of CAD. In 50 consecutive patients (22 normal and 28 with CAD), who underwent SPECT stress-redistribution Tl-201 imaging, we systemically developed visual interpretive criteria for perfusion abnormality on SPECT. For overall detection of disease, the best criterion for abnormality was greater than or equal to 8 sectors of moderately decreased Tl-201 uptake. With this criterion, the true positive and true negative rates for overall detection of disease were 96% and 91%, respectively. The best criterion for significant defect in the anterior or posterior coronary circulation was greater than or equal to 3 sectors of moderately decreased Tl-201 uptake. With this criterion, the true positive and true negative rates for anterior circulation disease were 71% and 100%, respectively. With respect to posterior circulation disease, the true positive and true negative rates were 100% and 50%, respectively. Regarding identification of dual circulation disease, the true positive and true negative rates were 71% and 82%, respectively

  1. Lung uptake of thallium-201: a marker of defect reversibility?

    Science.gov (United States)

    Sanderson, R.; Woldman, S.; McCurrach, G.; Martin, W.; Hutton, I.

    1998-06-01

    High lung uptake of thallium-201 at stress is reported to be associated with a large number of perfusion defects and poor prognosis. This study was performed to assess whether the reversibility of stress perfusion defects was related to lung uptake. Gated planar thallium scans at stress and at redistribution from 102 consecutive patients with essentially normal left ventricular ejection fraction (using gated blood pool ventriculography) were graded in terms of defect size. Lung and myocardial uptake of thallium were quantitated by region of interest methods relative to the given activity in a previously validated method. There was no significant correlation (non-parametric) between lung uptake and degree of redistribution (). There was a weak but positive correlation between lung uptake and defect size (). Both exercise time and double product showed a negative correlation with lung uptake (e.g. for double product, ). In conclusion, contrary to our expectation, lung uptake is not related to the degree of redistribution. High lung uptake seems to reflect poor cardiovascular reserve.

  2. Observation of portal circulation through superior mesenteric vein by enteric coated capsule of thallium-201

    International Nuclear Information System (INIS)

    A new method of oral administration of an enteric coated capsule of 201Tl (201Tl-capsule) was developed to evaluate the portal circulation through the superior mesenteric vein (SMV). The 201Tl-capsule was not collapsed in the artificial gastric juice, whereas it melted soon after soaking in the artificial intestinal juice. In a clinical trial of 42 cases, 201Tl was satisfactory released in the duodenum in 36 cases where clear liver images were observed except in 1 patient. Heart to liver ratio (H/L) at 60 or 90 min after duodenal release of 201Tl was 0.32±0.07 (mean ±1 s.d.) in normal controls, 0.34±0.12 in chronic hepatitis, 0.31±0.12 in acute hepatitis, 0.45±0.13 in liver cirrhosis and 0.48±0.32 in cirrhosis with hepatocellular carcinoma. In 11 patients who had both oral and rectal studies with 201Tl, 7 showed a high H/L ratio of more than 0.8 in the rectal study but only 1 showed a similarly high ratio of 1.07 in the oral study. In the group of varied liver disorders we have studied so far, it was found that most of the SMV blood flowed into the liver and the degree of portal systemic shunting (PSS) from the SMV was much smaller compared to that from the inferior mesenteric vein. The present study with oral administration of the 201Tl-capsule was of value in understanding portal circulation through the SMV, however, this technique seemed of limited usefulness for evaluating overall pathologic PSS. (orig.)

  3. Different thallium-201 single-photon emission tomographic patterns in benign and aggressive meningiomas

    Energy Technology Data Exchange (ETDEWEB)

    Tedeschi, E. [Dipartimento di Diagnostica per Immagini, Centro CNR per la Medicina Nucleare, Napoli (Italy); Soricelli, A. [Dipartimento di Diagnostica per Immagini, Centro CNR per la Medicina Nucleare, Napoli (Italy); Brunetti, A. [Dipartimento di Diagnostica per Immagini, Centro CNR per la Medicina Nucleare, Napoli (Italy); Romano, M. [Dipartimento di Diagnostica per Immagini, Centro CNR per la Medicina Nucleare, Napoli (Italy); Bucciero, A. [Istituto di Neurochirurgia, Universita `Federico II`, Napoli (Italy); Iaconetta, G. [Istituto di Neurochirurgia, Universita `Federico II`, Napoli (Italy); Alfieri, A. [Istituto di Neurochirurgia, Universita `Federico II`, Napoli (Italy); Postiglione, A. [Dipartimento di Clinica Medica, Universita `Federico II`, Napoli (Italy); Salvatore, M. [Dipartimento di Diagnostica per Immagini, Centro CNR per la Medicina Nucleare, Napoli (Italy)

    1996-11-01

    To evaluate the possibility of preoperatively obtaining an index of aggressiveness for intracranial meningiomas, we prospectively studied 22 patients with computed tomographic or magnetic resonance imaging evidence of meningeal tumour, using single-photon emission tomography (SPET) of the brain and thallium-201 ({sup 201}Tl). On a brain-dedicated SPET scanner, a rapid acquisition protocol with early, short scans was started simultaneously with the intravenous administration of 111 MBq {sup 201}Tl, covering the initial intratumoral distribution of the tracer. Twenty minutes post injection, a delayed SPET scan was also obtained. On the reconstructed and attenuation-corrected images we calculated the {sup 201}Tl concentration in tumour and normal contralateral brain tissue, and compared intratumoral tracer concentration in the initial and the final part of the rapid acquisition protocol. Benign and malignant meningiomas were classified as such based on histological examination. In malignant lesions, the ratio of the {sup 201}Tl concentration at 2-4 min post injection to that at 14-16 min was found to be significantly higher than in non-aggressive neoplasms (mean{+-}1 SD: 1.14{+-}0.31 and 0.56{+-}0.13, respectively, P <0.01). Conversely, in the delayed scan, most lesions showed high tracer concentration, and the two groups could not be distinguished. In addition, three recurrent meningiomas displayed the same imaging behaviour as the malignant group, i.e. had similar {sup 201}Tl concentration values at 2-4 and at 14-16 min. Our findings suggest that the comparative assessment of intratumoral {sup 201}Tl concentration at 2-4 and at 14-16 min post injection could provide a fast, simple method to differentiate preoperatively intracranial meningiomas with different biological behaviour. (orig.). With 3 figs., 1 tab.

  4. Different thallium-201 single-photon emission tomographic patterns in benign and aggressive meningiomas

    International Nuclear Information System (INIS)

    To evaluate the possibility of preoperatively obtaining an index of aggressiveness for intracranial meningiomas, we prospectively studied 22 patients with computed tomographic or magnetic resonance imaging evidence of meningeal tumour, using single-photon emission tomography (SPET) of the brain and thallium-201 (201Tl). On a brain-dedicated SPET scanner, a rapid acquisition protocol with early, short scans was started simultaneously with the intravenous administration of 111 MBq 201Tl, covering the initial intratumoral distribution of the tracer. Twenty minutes post injection, a delayed SPET scan was also obtained. On the reconstructed and attenuation-corrected images we calculated the 201Tl concentration in tumour and normal contralateral brain tissue, and compared intratumoral tracer concentration in the initial and the final part of the rapid acquisition protocol. Benign and malignant meningiomas were classified as such based on histological examination. In malignant lesions, the ratio of the 201Tl concentration at 2-4 min post injection to that at 14-16 min was found to be significantly higher than in non-aggressive neoplasms (mean±1 SD: 1.14±0.31 and 0.56±0.13, respectively, P 201Tl concentration values at 2-4 and at 14-16 min. Our findings suggest that the comparative assessment of intratumoral 201Tl concentration at 2-4 and at 14-16 min post injection could provide a fast, simple method to differentiate preoperatively intracranial meningiomas with different biological behaviour. (orig.). With 3 figs., 1 tab

  5. Effect of errors in reangulation on planar and tomographic thallium-201 washout profile curves

    Energy Technology Data Exchange (ETDEWEB)

    Lancaster, J.L.; Starling, M.R.; Kopp, D.T.; Lasher, J.C.; Blumhardt, R.

    1985-12-01

    Cardiac phantom studies were performed with and without a defect present to test the hypothesis that myocardial 201TI quantitative circumferential washout profile curves calculated from planar and rotating slant hole (RSH) collimator tomographic images are equally affected by errors in axial repositioning. Simulated stress images were acquired with the long axis of the phantom perpendicular to the camera surface and redistribution images were acquired to represent 50% 201TI washout with axial repositioning errors relative to the stress position ranging from 0 to 20 degrees in 5 degrees increments. There was a decrease in the 201TI washout profile curves compared to that expected (50%) in the wall tilted away from the camera surface, and a reciprocal increase in the 201TI washout profile curves in the wall tilted towards the camera surface for both imaging techniques whether a lesion was present or not. This effect became more pronounced as the error in axial repositioning was increased for both the planar (p less than 0.001) and the RSH tomographic (p less than 0.001) techniques. However, the deviation of the 201TI washout profile curves from that expected (50%) was greater for the planar imaging technique with or without a lesion (p less than 0.05 to 0.001). Thus, we conclude that 201TI quantitative circumferential washout profile curves calculated using this tomographic imaging technique are less affected by errors in axial repositioning than those calculated using an equivalent projection by standard planar imaging methods. These data emphasize the importance which must be placed on the repositioning of patients to obtain valid 201TI washout profile curves for the detection and localization of coronary artery disease.

  6. 201Thallium SPECT, accuracy in astrocytoma diagnosis and treatment evaluation

    International Nuclear Information System (INIS)

    The aims of the studies included in this thesis were: - to investigate the reliability of 201Thallium single photon emission computed tomography. Tl SPECT for preoperative diagnosis and histological staging of malignant astrocytomas in comparison with CT; - to develop a method for quantification of cerebral thallium uptake, and to evaluate the quantitative measurement in comparison with CT, for astrocytoma treatment follow-up purposes; - to compare quantitative Tl SPECT and proton magnetic resonance spectroscopy (H-MRS) with conventional MR imaging for astrocytoma monitoring, and to evaluate associations between change of morphological tumour characteristics during treatment and changes of cerebral thallium uptake and metabolic ratios. Results and conclusions: - High TI-index, calculated as a ratio comparing tumour uptake to uptake in the contralateral hemisphere, is an indicator of highly malignant astrocytoma. Differentiation between the high-grade astrocytomas, the low-grade astrocytomas, and infectious lesions is only partial, with an overlap of Tl-indexes between these groups. High-grade astrocytomas that do not show contrast enhancement on CT, and astrocytomas with central necrosis and moderate ring-enhancement, tend to be underestimated when evaluated by Tl-index calculation. Tl SPECT is not a reliable method for non-invasive tumour staging among the group of highly malignant astrocytomas. - Quantification of cerebral TI-uptake, defining the volume of viable tumour tissue, is a new method for astrocytoma chemotherapy monitoring. Results suggest that the method provides prognostic information, and information of treatment efficacy, at an earlier stage than CT. - We did not find a higher accuracy of quantitative Tl SPECT than of MR for monitoring purposes and our results indicated that treatment induced MR changes were interrelated with TI-uptake variations. - Multi-voxel H-MRS was difficult to apply for astrocytoma treatment monitoring, due to the anatomical

  7. Dynamic single photon emission computed tomography of Tl-201 with exercise loading

    International Nuclear Information System (INIS)

    Single photon emission computed tomography (SPECT) with Tl-201 has been reported to provide accurate means for diagnosis of coronary artery disease (CAD). The purpose of this study is to examine the serial changes in regional myocardial activity of Tl-201 injected during exercise loading in CAD using a multidetector SPECT system. Four cases without coronary stenosis (N) and 17 patients with CAD including 9 cases with prior myocardial infarction (MI) were studied. Tl-201 was injected during submaximal exercise loading with a bicycle ergometer. Serial dynamic SPECT scan was performed every 5 min until 30 min after injection, followed by additional 3 scans for 10 min at 1 hr, 2 hr and 3 hr after injection. These SPECT images were corrected for the acquisition time, but no corrections were made for photon attenuation and scattering. N revealed uniform distribution throughout the study, and rapid washout was observed from the early period in 3/4 cases (10 to 24 % for initial 25 min). CAD showed various patterns of abnormal distribution and washout. In addition, the changes in regional distribution of Tl-201 were observed during the early period. These preliminary results indicate the significance of the early washout during the 30 min after injection of Tl-201, and careful consideration should be taken in calculating the washout rate by a conventional SPECT system with a rotating gamma camera. (author)

  8. Sequential change of cardiomyopathy of Duchenne muscular dystrophy by 201Tl myocardial SPECT

    International Nuclear Information System (INIS)

    201Tl myocardial SPECT were performed to evaluate of cardiomyopathy in Duchenne type of progressive muscular dystrophy (DMD). Follow up SPECT images of the same patients were also obtained about 1 year after the first scan. Cases subjected to study were 10 DMD. At the first study the hypoperfusion area of the left ventricular muscle were observed in 6 cases (60%) out of 10. At the second study the hypoperfusion areas became wider and lower in 4 out of 6 cases (66.7%). The new hypoperfusion area which was not demonstrated at the first study was observed at the second study in one case of these cases. These results suggested that the positive rate of cardiomyopathy in DMD by 201Tl myocardial SPECT was high, and 201Tl myocardial SPECT is a useful examination to detect the change of myocardial damage in DMD. (author)

  9. REMOVAL OF GLUCORAPHENIN FROM THE EXTRACT OF RADISH PIGMENT BY ANION EXCHANGE RESIN 201×7

    Institute of Scientific and Technical Information of China (English)

    ZhouXiaohua; ChenQi

    1998-01-01

    A method for removimg glucoraphenin from the extract of Radish pigment by anion exchange resin 201×7 was studied.The adsorption capacity of 201×7 resin for glucoraphenin was 72.8mg/ml resin,the equilibrium time 55 minutes,and the optinum pH5.5.All glucoraphenin that had been adsorbed on 201×7 resin was eluted by 1.5BV.hr-1, eluent in whinc concentration of NaOH was 0.05mol·L-1 at the flow rate of 1.5BV/h.Extracting solution of deglucoraphenin was enriched by vacuum and spray drying.A powder product of Radish pigment was obtained and E1cm1%=4.30.

  10. Myocardial perfusion as assessed by thallium-201 scintigraphy during the discontinuation of mechanical ventilation in ventilator-dependent patients

    International Nuclear Information System (INIS)

    Patients who cannot be separated from mechanical ventilation (MV) after an episode of acute respiratory failure often have coexisting coronary artery disease. The authors hypothesized that increased left ventricular (LV) wall stress during periods of spontaneous ventilation (SV) could alter myocardial perfusion in these patients. Using thallium-201 (201TI) myocardial scintigraphy, the authors studied the occurrence of myocardial perfusion abnormalities during periods of SV in 15 MV-dependent patients (nine women, six men; aged 71 ± 7 yr, mean ± SD). Fourteen of these patients were studied once with 201TI myocardial scintigraphy during intermittent mechanical ventilation (IMV) and again on another day, after at least 10 min of SV through a T-piece. One patient was studied during SV only. Thirteen of 14 of the patients (93%) studied during MV had abnormal patterns of initial myocardial 201TI uptake, but only 1 patient demonstrated redistribution of 201TI on delayed images. The remainder of the abnormalities observed during MV were fixed defects. SV produced significant alterations of myocardial 201TI distribution or transient LV dilation, or both, in 7 of the 15 patients (47%). Four patients demonstrated new regional decreases of LV myocardial thallium concentration with redistribution of the isotope on delayed images. The patient studied only during SV also had myocardial 201TI defects with redistribution. Five patients (3 also having areas of 201TI redistribution) had transient LV dilation during SV

  11. 21 CFR 201.323 - Aluminum in large and small volume parenterals used in total parenteral nutrition.

    Science.gov (United States)

    2010-04-01

    ... used in total parenteral nutrition. 201.323 Section 201.323 Food and Drugs FOOD AND DRUG ADMINISTRATION... parenteral nutrition. (a) The aluminum content of large volume parenteral (LVP) drug products used in total parenteral nutrition (TPN) therapy must not exceed 25 micrograms per liter (µg/L). (b) The package insert...

  12. 9 CFR 201.49 - Requirements regarding scale tickets evidencing weighing of livestock, live poultry, and feed.

    Science.gov (United States)

    2010-01-01

    ... evidencing weighing of livestock, live poultry, and feed. 201.49 Section 201.49 Animals and Animal Products... regarding scale tickets evidencing weighing of livestock, live poultry, and feed. (a) Livestock. When... printed weights shall be retained as part of the person or firm's business records to...

  13. 40 CFR 201.26 - Procedures for the measurement on receiving property of retarder and car coupling noise.

    Science.gov (United States)

    2010-07-01

    ... receiving property of retarder and car coupling noise. 201.26 Section 201.26 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS NOISE EMISSION STANDARDS FOR TRANSPORTATION... receiving property of retarder and car coupling noise. (a) Retarders—(1) Microphone. The microphone must...

  14. 21 CFR 201.322 - Over-the-counter drug products containing internal analgesic/antipyretic active ingredients...

    Science.gov (United States)

    2010-04-01

    ... analgesic/antipyretic active ingredients; required alcohol warning. 201.322 Section 201.322 Food and Drugs... containing internal analgesic/antipyretic active ingredients; required alcohol warning. (a) People who... internal analgesic/antipyretic active ingredients may cause similar adverse effects. FDA concludes that...

  15. 45 CFR 201.6 - Withholding of payment; reduction of Federal financial participation in the costs of social...

    Science.gov (United States)

    2010-10-01

    ... financial participation in the costs of social services and training. 201.6 Section 201.6 Public Welfare... Federal financial participation in the costs of social services and training. (a) When withheld. Further... (AABD) of the Act, Federal financial participation in the costs of social services and training...

  16. 75 FR 3705 - Foreign-Trade Zone 201-Holyoke, MA; Application for Subzone; Yankee Candle Corporation (Candles...

    Science.gov (United States)

    2010-01-22

    ... Foreign-Trade Zones Board Foreign-Trade Zone 201--Holyoke, MA; Application for Subzone; Yankee Candle Corporation (Candles and Gift Sets); Whately and South Deerfield, MA An application has been submitted to the..., grantee of FTZ 201, requesting special-purpose subzone status for the candle and gift set...

  17. 76 FR 11291 - University of New Mexico AGN-201M Reactor Notice of Issuance of Renewed Facility Operating...

    Science.gov (United States)

    2011-03-01

    ... COMMISSION University of New Mexico AGN-201M Reactor Notice of Issuance of Renewed Facility Operating License... No. R-102, held by the University of New Mexico (the licensee), which authorizes continued operation of the University of New Mexico AGN-201M Reactor (UNMR), located in Albuquerque, Bernalillo...

  18. Thallium chloride 201Tl combined with single photon emission computed tomography (SPECT) in the evaluation of vestibular schwannoma growth

    DEFF Research Database (Denmark)

    Charabi, Samih Ahmed; Lassen, N A; Thomsen, J;

    1997-01-01

    Thallium chloride 201Tl combined with SPECT was performed in a series of 29 patients with neuroradiological evidence of vestibular schwannoma (VS). The relative tumor uptake (U) and relative tumor concentration (C) of the radiotracer 201Tl was determined, and the cerebellum served as a reference....

  19. 37 CFR 201.33 - Procedures for filing Notices of Intent to Enforce a restored copyright under the Uruguay Round...

    Science.gov (United States)

    2010-07-01

    ... of Intent to Enforce a restored copyright under the Uruguay Round Agreements Act. 201.33 Section 201... copyright under the Uruguay Round Agreements Act. (a) General. This section prescribes the procedures for submission of Notices of Intent to Enforce a Restored Copyright under the Uruguay Round Agreements Act,...

  20. 49 CFR 1572.201 - Transportation of hazardous materials via commercial motor vehicle from Canada or Mexico to and...

    Science.gov (United States)

    2010-10-01

    ... vehicle drivers licensed by Canada and Mexico. (b) Terms used in this section. The terms used in 49 CFR... commercial motor vehicle from Canada or Mexico to and within the United States. 1572.201 Section 1572.201... ASSESSMENTS Transportation of Hazardous Materials From Canada or Mexico To and Within the United States...

  1. Specific localization of thallium 201 in human high-grade astrocytoma by microautoradiography.

    Science.gov (United States)

    Mountz, J M; Raymond, P A; McKeever, P E; Modell, J G; Hood, T W; Barthel, L K; Stafford-Schuck, K A

    1989-07-15

    The ability to accurately distinguish remaining or recurrent high-grade astrocytoma from necrosis or edema following treatment is essential to optimal patient management. Thallium 201 planar gamma-camera imaging has been shown to be helpful in detecting recurrent high-grade astrocytoma; however, due to tissue heterogeneity adjacent to and within tumor, the cellular specificity and quantification of 201Tl uptake are largely unknown. In order to determine which tissues are responsible for the radioisotope uptake, microautoradiographic techniques were used to examine multiple tissue sections from five patients with high-grade astrocytoma. Each patient received 5 mCi of 201Tl i.v. 1 h prior to tumor removal. Additionally, all patients received computerized tomographic and 201Tl planar gamma-camera scans prior to surgery. Following surgery, the excised tissue specimens were tentatively classified by gross pathological examination and then immediately processed for dry mount autoradiography; grain density was determined over regions containing tumor, adjacent and uninvolved brain tissue, necrotic tissue, and background. Highly significant differences were found in grain densities (201Tl uptake) between tumor and uninvolved brain tissue, as well as between uninvolved brain tissue and necrotic tissue; there was no significant difference between background grain density and that in necrotic tissue. Mean grain densities (grains/cm2 +/- 1 SD) across patients were: tumor, 102 +/- 23; adjacent, uninvolved brain tissue, 29 +/- 11; necrotic tissue, 6.2 +/- 1.1; and background, 7.0 +/- 4.1. We conclude that the ability of 201Tl to selectively image high-grade astrocytoma is due to its preferential uptake into tumor cells.

  2. Studies on Feeding Animals with Straw of Grain-Straw-Dual-Use-Rice 201

    Institute of Scientific and Technical Information of China (English)

    ZHENG Jin-gui; CHEN Jun-chen; HUANG Qin-lou; ZHENG Kai-bin; YE Xin-fu; TU Jie-feng; CHEN Bing-huan

    2002-01-01

    The straw of Grain-Straw-Dual-Use-Rice (GSDUR) variety 201 of which the grain quality and yield were equivalent to that of common rice variety (the grain yield approximately 7.5 t ha-1 ), but straw protein content was 9.31% (common rice straw i.e. CK was approximately 4.0%), and other eight fodder indexes were better than CK to some extent, was employed to feed animals. 15 N tracing result suggested that the protein in 201 straw could be effectively transformed into fish body protein and white mouse body protein. The digestibility of fodder, the 15N recovery rate of animal body and the absorption of fodder protein were 13.8,9.6, 24. 49 % and 16.5, 6.0, 47.2 % higher than those of common rice straw respectively when feeding grass carp and white mice with 201 rice straw, whereas the 1s N recovery rates of animal manure were 3.25, 6.5 %lower than those of common rice straw, respectively. The results of feeding animals with 201 straw were as carp, fish weight gain per kg fresh rice straw were increased by 60.0, 16.8 and 37.0% respectively when 201fresh straw was used to feed grass carp compared to feeding CK, and fish yield could be increased by 297.5 kg creased by 33.9 and 26.8% respectively when 201 rice straw was used as the main raw material of the compound fodder to feed white geese compared to feeding CK, and geese weight could be increased by 2 358.0 kg powder substituting for wheat bran which made up of 5 % compound fodder to feed cross bred pigs compared to CK, but 0. 11 kg fine fodder could be saved when 1 kg cross bred pig weight was increased.

  3. Myocardial ischemia detection by artificial intelligence interpretation of Tl-201 tomograms

    International Nuclear Information System (INIS)

    This paper reports on an expert system environment which automatically assigned certainty factors to abnormal regions in stress and delayed myocardial thallium-201 polar bulls-eye plots. MYCIN-type algorithms propagated certainty factors for the presence, location, and character of each coronary lesion. Ninety-four previously validated rules that considered only stress perfusion defects spawned 91 new rules considering tracer redistribution. Fifteen new rules assessed vascular territories for the presence and location of fixed or reversible defects. This artificial intelligence tool can provide novice readers of cardiac T1-201 studies automatic, consistent, objective, and justified interpretations that consider artifacts, coronary territory overlap, and multiple defects

  4. The long-acting somatostatin analogue SMS 201-995 causes malabsorption

    DEFF Research Database (Denmark)

    Witt, K; Pedersen, N T

    1989-01-01

    Somatostatin and its long-acting analogue SMS 201-995 (Sandostatin) have been suspected of causing steatorrhoea. The aim of this study was to examine the effect of SMS 201-995 on fat assimilation in healthy subjects, using 14C-triolein and 3H-oleic acid as tracers of dietary triglycerides and fre...... of 82% (range, 46-126%), and the faecal fat excretion increased to a median of 22 g/day (range, 4-34 g/day), all clearly above normal. The faecal 14C-triolein/3H-oleic acid test showed triglycerides and free fatty acids to be equally malassimilated, which indicates malabsorption....

  5. Research on the constitutive relationship of semi-solid ZL201 alloy%半固态ZL201合金本构关系研究

    Institute of Scientific and Technical Information of China (English)

    王姣姣; 尚淑珍; 路贵民; 于建国

    2012-01-01

    Thermal simulation compression tests on semisolid billet of ZL201 alloy prepared by NearLiquidusCasting at different parameters were carried out using the Gleeble3800 dynamic material testing machine, and then the constitutive equation of semisolid ZL201 alloy was established based on the experimental data. According to the constitutive equation and the equations presented by Stefan, parameters of power law model, such as apparent viscosity, were identified. The commercial simulation software ANYCASTING was applied to simulate and analyze the thixotropic diecasting processes of semisolid automobile engine bracket. The flow characteristic of semisolid ZL201 alloy in semisolid diecasting processes was investigated with simulation. The results show that the apparent viscosity decreases with the increase of shear rate, semisolid alloy shows that shearing thinning thixotropy, the semisolid slurry filled the cavity by way of laminar flow, with the sound semisolid diecasting part obtaining.%采用Gleeble3800热模拟试验机对液相线铸造获得的ZL201合金半固态坯料进行了不同工艺参数下的热模拟试验,并进行了变形抗力本构方程拟合,以此为基础根据Stefan方程确定了幂律模型中的表观粘度等参数,采用商用仿真软件ANYCASTING对汽车发动机支架进行了触变压铸过程数值模拟分析,获得了ZL201合金的半固态充填流动特征响应,结果表明:半固态表观粘度随剪切速率增大而下降,在充型过程中呈现剪切变稀的触变成形特点,半固态浆料将以层流方式充填型腔,可获得充型完好的半固态压铸零件。

  6. 7 CFR 205.201 - Organic production and handling system plan.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Organic production and handling system plan. 205.201... MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Organic Production and...

  7. [Corrosion of stainless steel 201, 304 and 316L in the simulated sewage pipes reactor].

    Science.gov (United States)

    Bao, Guo-Dong; Zuo, Jian-E; Wang, Ya-Jiao; Gan, Li-Li

    2014-08-01

    The corrosion behavior of stainless steel 201, 304 and 316L which would be used as sewer in-situ rehabilitation materials was studied in the simulated sewage pipes reactor. The corrosion potential and corrosion rate of these three materials were studied by potentiodynamic method on the 7th, 14th, 21st, 56th day under two different conditions which were full immersion condition or batch immersion condition with a 2-day cycle. The electrode process was studied by Electrochemical Impedance Spectroscopy (EIS) on the 56th day. The microstructure and composition of the corrosion pitting were analyzed by Scanning Electron Microscope (SEM) and Energy Dispersive Spectrometer (EDS) on the 56th day. The results showed that 304 and 316L had much better corrosion resistance than 201 under both conditions. 304 and 316L had much smaller corrosion rate than 201 under both conditions. The corrosion resistance of all three kinds of stainless steel under the batch immersion condition was much better than those under the full immersion condition. The corrosion rate of all three kinds of stainless steel under the batch immersion condition was much smaller than those under the full immersion condition. Point pitting corrosion was formed on the surfaces of 304 and 316L. In comparison, a large area of corrosion was formed in the surface of 201.

  8. A scatter correction method for T1-201 images: A Monte Carlo investigation

    Energy Technology Data Exchange (ETDEWEB)

    Hademenos, G.J.; King, M.A. (Univ. of Massachusetts Medical Center, Worcester, MA (United States). Dept. of Nuclear Medicine); Ljungberg, M. (Lund Univ., (Sweden). Dept. of Radiation Physics); Zubal, G.; Harrell, C.R. (Yale Univ. School of Medicine, New Haven, CT (United States). Dept. of Diagnostic Radiology)

    1993-08-01

    Results from the application of a modified dual photopeak window (DPW) scatter correction method to Monte Carlo simulated T1-201 emission images are presented. In the Monte Carlo investigation, individual simulations were performed for six radiation emissions of T1-201. For each emission, point sources of T1-201 were imaged at various locations i na water-filled elliptical tub phantom using three energy windows: two 12% windows abutted at 72 keV and a third 10 keV window placed to the right of the photopeak window (95.001 keV - 105.000 keV). The third window was used to estimate the spilldown contribution from the T1-201 gamma rays in each of the two photopeak windows. Using the corrected counts in these two windows, the DPW method was applied to each point source image to estimate the scatter distribution. For point source images in both homogeneous and non-homogeneous attenuating media, the application of this modified version of DPW resulted in an approximately six-fold reduction in the scatter fraction and an excellent agreement of the shape of the tails between the estimated scatter distribution and the Monte Carlo-simulated truth. This method was also applied to two views of an extended cardiac distribution within an anthropomorphic phantom, again, resulting in at least a six-fold improvement between the scatter estimate and the Monte Carlo-simulated true scatter.

  9. 49 CFR 374.201 - Prohibition against smoking on interstate passenger-carrying motor vehicles.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Prohibition against smoking on interstate... MOTOR CARRIER SAFETY REGULATIONS PASSENGER CARRIER REGULATIONS Limitation of Smoking on Interstate Passenger Carrier Vehicles § 374.201 Prohibition against smoking on interstate passenger-carrying...

  10. 20 CFR 404.201 - What is included in this subpart?

    Science.gov (United States)

    2010-04-01

    ... DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts General § 404.201 What is included in this subpart? In this subpart we describe how we compute your primary insurance amount (PIA), how and when we... automatically adjust your PIA to reflect changes in the cost of living. (a) What is my primary insurance...

  11. 4 CFR 201.11 - Requirements for waiver or reduction of fees.

    Science.gov (United States)

    2010-01-01

    ... Section 201.11 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS... request additional information if necessary. However, the Board must make a determination on the fee... information. In certain circumstances, a partial fee waiver may be appropriate, if some, but not all, of...

  12. 4 CFR 201.4 - Board records exempt from public disclosure.

    Science.gov (United States)

    2010-01-01

    ... Section 201.4 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS... types of matters to be withheld. (d) Trade secrets, and commercial or financial information obtained... personal privacy. (g) Records or information compiled for law enforcement purposes, but only to the...

  13. 41 CFR 50-201.1102 - Tolerance for apprentices, student-learners, and handicapped workers.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Tolerance for apprentices... Management Other Provisions Relating to Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL...) Apprentices, student-learners, and workers, whose earning capacity is impaired by age or physical or...

  14. 77 FR 40338 - Announcing Revised Draft Federal Information Processing Standard (FIPS) 201-2, Personal Identity...

    Science.gov (United States)

    2012-07-09

    ... April 8, 2005 (70 FR 17975), and in accordance with NIST policy was due for review in 2010. In... agencies. On March 8, 2011, a notice was published in the Federal Register (76 FR 12712), soliciting public... Standard (FIPS) 201-2, Personal Identity Verification (PIV) of Federal Employees and Contractors,...

  15. 9 CFR 201.95 - Inspection of business records and facilities.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Inspection of business records and... STOCKYARDS ACT General § 201.95 Inspection of business records and facilities. Each stockyard owner, market agency, dealer, packer, swine contractor, and live poultry dealer, upon proper request, shall...

  16. 9 CFR 201.96 - Unauthorized disclosure of business information prohibited.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Unauthorized disclosure of business... PACKERS AND STOCKYARDS ACT General § 201.96 Unauthorized disclosure of business information prohibited. No..., dealer, packer, swine contractor, or live poultry dealer concerned, divulge or make known in any...

  17. 9 CFR 201.67 - Packers not to own or finance selling agencies.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Packers not to own or finance selling... STOCKYARDS ACT Trade Practices § 201.67 Packers not to own or finance selling agencies. No packer subject to the Act shall have an ownership interest in, finance, or participate in the management or operation...

  18. 30 CFR 77.201-1 - Tests for methane; qualified person; use of approved device.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Tests for methane; qualified person; use of... WORK AREAS OF UNDERGROUND COAL MINES Surface Installations § 77.201-1 Tests for methane; qualified person; use of approved device. Tests for methane in structures, enclosures, or other facilities,...

  19. 30 CFR 77.201-2 - Methane accumulations; change in ventilation.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Methane accumulations; change in ventilation... OF UNDERGROUND COAL MINES Surface Installations § 77.201-2 Methane accumulations; change in... centum or more of methane changes or adjustments in the ventilation of such installation shall be made...

  20. 11 CFR 201.3 - Public funding, audits and litigation: Ex parte contacts prohibited.

    Science.gov (United States)

    2010-01-01

    ... soon after the communication as is reasonably possible but no later than three business days after the... communication as is reasonably possible but no later than three business days after the communication, unless... REGULATIONS EX PARTE COMMUNICATIONS § 201.3 Public funding, audits and litigation: Ex parte...

  1. 31 CFR 560.803 - Customs procedures: Goods specified in § 560.201.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Customs procedures: Goods specified... REGULATIONS Procedures § 560.803 Customs procedures: Goods specified in § 560.201. (a) With respect to goods... Customs officers shall not accept or allow any: (1) Entry for consumption or warehouse (including...

  2. 7 CFR 201.55a - Moisture and aeration of substratum.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Moisture and aeration of substratum. 201.55a Section... and aeration of substratum. (a) The substratum must be moist enough to supply the needed moisture to the seeds at all times. Excessive moisture which will restrict aeration of the seeds should be...

  3. 21 CFR 201.19 - Drugs; use of term “infant”.

    Science.gov (United States)

    2010-04-01

    ...: GENERAL LABELING General Labeling Provisions § 201.19 Drugs; use of term “infant”. The regulations affecting special dietary foods (§ 105.3(e) of this chapter) define an infant as a child not more than 12... term infant. Some question has arisen whether, for the purposes of drug labeling, an infant means...

  4. 42 CFR 1001.201 - Conviction relating to program or health care fraud.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 5 2010-10-01 2010-10-01 false Conviction relating to program or health care fraud... Permissive Exclusions § 1001.201 Conviction relating to program or health care fraud. (a) Circumstance for... misdemeanor relating to fraud, theft, embezzlement, breach of fiduciary responsibility, or other...

  5. 41 CFR 301-71.201 - What are the reviewing official's responsibilities?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false What are the reviewing... ACCOUNTABILITY REQUIREMENTS Travel Claims for Reimbursement § 301-71.201 What are the reviewing official's responsibilities? The reviewing official must have full knowledge of the employee's activities. He/she must...

  6. 20 CFR 405.201 - Reviewing an initial determination-general.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Reviewing an initial determination-general... PROCESS FOR ADJUDICATING INITIAL DISABILITY CLAIMS Review of Initial Determinations by a Federal Reviewing Official § 405.201 Reviewing an initial determination—general. If you are dissatisfied with the...

  7. Investigating Validity of Math 105 as Prerequisite to Math 201 among Undergraduate Students, Nigeria

    Science.gov (United States)

    Zakariya, Yusuf F.

    2016-01-01

    In this study, the author examined the validity of MATH 105 as a prerequisite to MATH 201. The data for this study was extracted directly from the examination results logic of the university. Descriptive statistics in form of correlations and linear regressions were used to analyze the obtained data. Three research questions were formulated and…

  8. 7 CFR 201.33 - Seed in bulk or large quantities; seed for cleaning or processing.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Seed in bulk or large quantities; seed for cleaning or... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling in General § 201.33 Seed in bulk or large quantities; seed for cleaning or processing. (a) In the case of seed in bulk, the information required...

  9. Quantitative assessment of regional myocardial blood flow with thallium-201 and SPECT.

    Science.gov (United States)

    Iida, H; Eberl, S

    1998-01-01

    Thallium-201 has been used extensively as a myocardial perfusion agent and to assess myocardial viability. Unlike other 99mTc-labeled agents such as 99mTc-sestamibi and 99mTc-tetrofosmine, the regional concentration of 201Tl varies with time, and its kinetics make it a potential candidate for estimating absolute physiologic parameters with kinetic model analysis. This article outlines a strategy for quantitative assessment of regional myocardial blood flow in man using 201Tl and dynamic single photon emission computed tomography (SPECT). Quantitatively accurate SPECT images that are proportional to the true radioactivity distribution are prerequisites for model-based kinetic analysis. Our technique for quantitative SPECT includes ordered-subset maximum likelihood-expectation maximization (ML-EM) reconstruction with transmission data-based attenuation correction and transmission-dependent convolution subtraction scatter correction. A three-compartment model was found to reproduce the observed regional time-activity curves well, and dog experiments demonstrated that influx rate constant (K1) values estimated from the dynamic SPECT data correlated well with absolute myocardial blood flow determined by in vitro microspheres for a physiologically wide range of flows. Several possible strategies for simplifying the study procedures, without compromising accuracy, are also presented, which should make absolute quantitation of regional myocardial blood flow feasible using 201Tl and a conventional SPECT camera in a clinical setting.

  10. 37 CFR 201.11 - Satellite carrier statements of account covering statutory licenses for secondary transmissions.

    Science.gov (United States)

    2010-07-01

    ... period shall be the rate fixed by the Licensing Division of the Copyright Office pursuant to 37 CFR 201... with the total statutory royalty fee or the confirmed arbitration royalty fee for such accounting... information shall be provided as part of the EFT and/or as part of the remittance advice as provided for...

  11. 49 CFR 172.201 - Preparation and retention of shipping papers.

    Science.gov (United States)

    2010-10-01

    ... List of CFR Sections Affected which appears in the Finding Aids section of the printed volume and on... 49 Transportation 2 2010-10-01 2010-10-01 false Preparation and retention of shipping papers. 172..., TRAINING REQUIREMENTS, AND SECURITY PLANS Shipping Papers § 172.201 Preparation and retention of...

  12. 7 CFR 201.56-6 - Legume or pea family, Fabaceae (Leguminosae).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Legume or pea family, Fabaceae (Leguminosae). 201.56-6...-6 Legume or pea family, Fabaceae (Leguminosae). Kinds of seed: Alfalfa, alyceclover, asparagusbean..., lupines, northern sweetvetch, peas, peanut, roughpea, sainfoin, sesbania, sourclover,...

  13. 21 CFR 201.1 - Drugs; name and place of business of manufacturer, packer, or distributor.

    Science.gov (United States)

    2010-04-01

    ... HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING General Labeling Provisions § 201.1 Drugs... industry to contract out the performance of certain manufacturing operations listed in paragraph (b) of... case of a corporate person, only by the actual corporate name, except that the corporate name may...

  14. 5 CFR 2604.201 - Public reading room facility and Web site.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Public reading room facility and Web site... DISCLOSURE REPORTS FOIA Public Reading Room Facility and Web Site; Index Identifying Information for the Public § 2604.201 Public reading room facility and Web site. (a)(1) Location of public reading...

  15. 49 CFR 179.201-5 - Postweld heat treatment and corrosion resistance.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Postweld heat treatment and corrosion resistance....201-5 Postweld heat treatment and corrosion resistance. (a) Tanks and attachments welded directly... tested to demonstrate that they possess the corrosion resistance specified in § 179.200-7(d), Footnote...

  16. 24 CFR 201.50 - Lender efforts to cure the default.

    Science.gov (United States)

    2010-04-01

    ... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Default Under the Loan Obligation § 201... co-signer, and shall place in the loan file a copy of any modification agreement or repayment...

  17. 47 CFR 68.201 - Connection to the public switched telephone network.

    Science.gov (United States)

    2010-10-01

    ... CARRIER SERVICES (CONTINUED) CONNECTION OF TERMINAL EQUIPMENT TO THE TELEPHONE NETWORK Terminal Equipment Approval Procedures § 68.201 Connection to the public switched telephone network. Terminal equipment may not be connected to the public switched telephone network unless it has either been certified by...

  18. 7 CFR 201.29 - Germination of vegetable seed in containers of 1 pound or less.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination of vegetable seed in containers of 1 pound... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Vegetable Seeds § 201.29 Germination of... the percentage of germination and date of test. Each variety of vegetable seed which has a...

  19. 7 CFR 201.31 - Germination standards for vegetable seeds in interstate commerce.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination standards for vegetable seeds in... AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Vegetable Seeds § 201.31 Germination standards for vegetable seeds in interstate commerce. The following germination standards...

  20. 29 CFR 780.201 - Meaning of “forestry or lumbering operations.”

    Science.gov (United States)

    2010-07-01

    ... STANDARDS ACT Agriculture as It Relates to Specific Situations Forestry Or Lumbering Operations § 780.201 Meaning of “forestry or lumbering operations.” The term “forestry or lumbering operations” refers to the... and in part 788 of this chapter which considers the section 13(a)(13) exemption for forestry...

  1. The 160 Square Degree ROSAT Survey: The revised catalog of 201 clusters with spectroscopic redshifts

    DEFF Research Database (Denmark)

    Mullis, C.R.; McNamara, B.R.; Quintana, H.;

    2003-01-01

    We present the revised catalog of galaxy clusters detected as extended X-ray sources in the 160 Square Degree ROSAT Survey, including spectroscopic redshifts and X-ray luminosities for 200 of the 201 members. The median redshift is z(median) = 0.25, and the median X-ray luminosity is L-X,L-median...

  2. 22 CFR 201.61 - Meaning of terms in this subpart.

    Science.gov (United States)

    2010-04-01

    ... COMMODITY TRANSACTIONS FINANCED BY USAID Price Provisions § 201.61 Meaning of terms in this subpart. (a... respect to the quantity, quality, grade, period of delivery, supply area, terms of sale, or class of... price different from the price in the sale being tested; or (2) Can be related to the sale being...

  3. Evaluation of Tl-201 lung uptake and impairment of pulmonary perfusion on scintigraphies in pulmonary tuberculosis

    Energy Technology Data Exchange (ETDEWEB)

    Fujii, Tadashige [Shinshu Univ., Matsumoto, Nagano (Japan). School of Allied Medical Sciences; Tanaka, Masao; Koizumi, Tomonori; Kubo, Keishi

    2000-02-01

    Tl-201 lung uptake in 74 patients (85 lesions) and pulmonary perfusion in 105 patients were studied to evaluate clinical usefulness of Tl-201 lung uptake and perfusion lung scintigraphy in pulmonary tuberculosis, using a scintillation camera with a mini-computer system. As indices of Tl-201 lung uptake, lung (lesion) to upper mediastinum uptake ratio (L/M) and visual grading were used. L/M in pulmonary tuberculosis was 1.96{+-}0.66, which was significantly larger than 1.04{+-}0.24 in healthy controls and lower than that in heart diseases with left heart failure and idiopathic interstitial pneumonia, and showed no significant differences with that in acute pneumonia, pyothorax, primary lung cancer and malignant mediastinal tumor. L/M in pulmonary tuberculosis did not correlate with CRP, erythrocyte sedimentation rate, Gaffky number of sputum and body temperature. It correlated with the type of pulmonary tuberculosis according to the Gakken Classification reflecting the disease activity. It was larger in the exudative type, caseo-infiltrative one, disseminated one, one with cavity in infiltrative lesion than the fibro-caseous one. On perfusion lung scintigram, impairment of pulmonary perfusion larger than area of the entire unilateral lung was observed in 68 cases (64.8%). Area of hypoperfused lung field, which correlated with % vital capacity (r=0.60, p=0.0002) and PaO{sub 2} (r=0.39,p=0.0024), was significantly larger in patients with silicosis and those with bilateral pleural involvements such as pleural callosity than in those with type III according to the Gakkai Classification. Most of the patients showed decreased pulmonary perfusion and Tl-201 accumulation of which grade reflects the disease activity in active tuberculous lesion. Patients with miliary tuberculosis and those with silicotuberculosis showed diffuse Tl-201 accumulation in the both lungs. Tl-201 lung scintigraphy seems to be useful for visualizing active tuberculous lesions, particularly the ones

  4. Evaluation of Tl-201 lung uptake and impairment of pulmonary perfusion on scintigraphies in pulmonary tuberculosis

    International Nuclear Information System (INIS)

    Tl-201 lung uptake in 74 patients (85 lesions) and pulmonary perfusion in 105 patients were studied to evaluate clinical usefulness of Tl-201 lung uptake and perfusion lung scintigraphy in pulmonary tuberculosis, using a scintillation camera with a mini-computer system. As indices of Tl-201 lung uptake, lung (lesion) to upper mediastinum uptake ratio (L/M) and visual grading were used. L/M in pulmonary tuberculosis was 1.96±0.66, which was significantly larger than 1.04±0.24 in healthy controls and lower than that in heart diseases with left heart failure and idiopathic interstitial pneumonia, and showed no significant differences with that in acute pneumonia, pyothorax, primary lung cancer and malignant mediastinal tumor. L/M in pulmonary tuberculosis did not correlate with CRP, erythrocyte sedimentation rate, Gaffky number of sputum and body temperature. It correlated with the type of pulmonary tuberculosis according to the Gakken Classification reflecting the disease activity. It was larger in the exudative type, caseo-infiltrative one, disseminated one, one with cavity in infiltrative lesion than the fibro-caseous one. On perfusion lung scintigram, impairment of pulmonary perfusion larger than area of the entire unilateral lung was observed in 68 cases (64.8%). Area of hypoperfused lung field, which correlated with % vital capacity (r=0.60, p=0.0002) and PaO2 (r=0.39,p=0.0024), was significantly larger in patients with silicosis and those with bilateral pleural involvements such as pleural callosity than in those with type III according to the Gakkai Classification. Most of the patients showed decreased pulmonary perfusion and Tl-201 accumulation of which grade reflects the disease activity in active tuberculous lesion. Patients with miliary tuberculosis and those with silicotuberculosis showed diffuse Tl-201 accumulation in the both lungs. Tl-201 lung scintigraphy seems to be useful for visualizing active tuberculous lesions, particularly the ones that could

  5. MRI and thallium-201 SPECT in the prediction of survival in glioma

    Energy Technology Data Exchange (ETDEWEB)

    Vos, Maaike J. [VU University Medical Center, Department of Neurology, Amsterdam (Netherlands); Medical Center Haaglanden, Department of Neurology, PO Box 432, The Hague (Netherlands); Berkhof, Johannes [VU University Medical Center, Department of Epidemiology and Biostatistics, Amsterdam (Netherlands); Hoekstra, Otto S. [VU University Medical Center, Department of Nuclear Medicine and PET Research, Amsterdam (Netherlands); Bosma, Ingeborg; Sizoo, Eefje M.; Heimans, Jan J.; Reijneveld, Jaap C.; Postma, Tjeerd J. [VU University Medical Center, Department of Neurology, Amsterdam (Netherlands); Sanchez, Esther [VU University Medical Center, Department of Radiology, Amsterdam (Netherlands); Lagerwaard, Frank J. [VU University Medical Center, Department of Radiation Oncology, Amsterdam (Netherlands); Buter, Jan [VU University Medical Center, Department of Medical Oncology, Amsterdam (Netherlands); Noske, David P. [VU University Medical Center, Department of Neurosurgery and Neuro-Oncology Research Group, Amsterdam (Netherlands)

    2012-06-15

    This paper aims to study the value of MRI and Thallium 201 ({sup 201}Tl) single-photon emission computed tomography (SPECT) in the prediction of overall survival (OS) in glioma patients treated with temozolomide (TMZ) and to evaluate timing of radiological follow-up. We included patients treated with TMZ chemoradiotherapy for newly diagnosed glioblastoma multiforme (GBM) and with TMZ for recurrent glioma. MRIs and {sup 201}Tl SPECTs were obtained at regular intervals. The value of both imaging modalities in predicting OS was examined using Cox regression analyses. Altogether, 138 MRIs and 113 {sup 201}Tl SPECTs in 46 patients were performed. Both imaging modalities were strongly related to OS (P {<=} 0.02). In newly diagnosed GBM patients, the last follow-up MRI (i.e., after six adjuvant TMZ courses) and SPECT (i.e., after three adjuvant TMZ courses) were the strongest predictors of OS (P = 0.01). In recurrent glioma patients, baseline measurements appeared to be the most predictive of OS (P < 0.01). The addition of one imaging modality to the other did not contribute to the prediction of OS. Both MRI and {sup 201}Tl SPECT are valuable in the prediction of OS. It is adequate to restrict to one of both modalities in the radiological follow-up during treatment. In the primary GBM setting, MRI after six adjuvant TMZ courses contributes significantly to the prediction of survival. In the recurrent glioma setting, baseline MRI appears to be a powerful predictor of survival, whereas follow-up MRIs during TMZ seem to be of little additional value. (orig.)

  6. The mathematical model for ID-201 semiconductor single photon counter%ID-201单光子计数器计数模型研究

    Institute of Scientific and Technical Information of China (English)

    曹攀; 朱广浩; 金飚兵

    2016-01-01

    InGaAs半导体单光子探测器具备探测性能强,集成度高等优势,在光谱分析和量子通信等领域有广泛的应用.本文以ID Quantique公司出品的ID-201半导体单光子计数器为研究对象,结合计数器核心部件雪崩光电二极管的工作原理探究其计数光子时的内部过程,推导出每秒钟光子计数值和该计数器几个重要参数触发频率(trigger frequency),门脉冲宽度(gate width),门强制关闭时间(dead time),探测效率(detection efficiency)之间的数学表达式.推导过程着重分析了计数门脉冲的关闭效应对光子探测概率的影响.首先利用泊松分布求解光子计数值与探测效率(detection efficiency)之间的关系,然后将计数过程分成两大部分,分析计数结果与门强制关闭时间(dead time)之间关系.求解得表达式后,利用1550 nm激光器作为ID-201的输入光源,在各种不同实验条件下,对该表达式的正确性进行了检验.%The technology of photon counting has wide applications in physics and electrical engineering.Single photon detectors based on avalanche photodiodes are attractive,Considering their advantages including compact sizes,broad spectrum of responses,and high detection efficiencies.The semiconductor single photon detector normally works in the gated mode,where photons can only be detected when the gate is open.However,if any photon is detected by the photon counter during the gate,several gates after the detection will be forced to shut down so that no photon can be detected during this period.The timing duration that the gates are down is called the dead time.This article mainly focuses on the photon counting performance of the ID-201 semiconductor photon counter,which is produced by the ID Quantique company.The purpose is to derive a photon counting formula for ID-201 and verify it using experiments.Starting with a simple Poisson distribution,we first studied the relationship between the detection

  7. The use of thallium-201 in the preoperative detection of breast cancer: an adjunct to mammography and ultrasonography

    International Nuclear Information System (INIS)

    Thallium-201 breast scans were performed preoperatively in 72 female patients with breast abnormalities detected by mammography and/or ultrasonography (7.5-13 MHz), in order to differentiate benign from malignant breast disease. Informed consent was obtained from each patient. Scintigraphy consisted of anterior and oblique planar images of the affected breast and axilla at 10 min and 3 h following the injection of 201Tl chloride (110 MBq). Pathological features of breast malignancies, were analysed for their association with 201Tl uptake by tumour cells. A total of 76 breast lesions were assessed in the study. On final histological diagnosis, there were 56 malignant tumours, 14 benign nodules (9 fibroadenomas, two cases of adenosis, two cases of focal fibrosis and one case of epitheliosis) and six atypical lesions (atypical ductal or lobular hyperplasia). Thallium scintigraphy was shown to have high accuracy (92%) in detecting breast cancer, better than mammography (74%) and ultrasonography (84%). Almost all (51/56) breast cancers showed greater 201Tl activity than surrounding normal breast tissue while there was no significant increase in 201Tl activity above background in all but one (19/20) case of non-malignant disease. 201Tl activity within breast tumours, calculated as tumour/background (T/B) ratio, ranged between 1.2 and 2.5 with a mean value of 1.45. The concentration of thallium in the breast cancer seems to be primarily dependent on vascularity and tumour size. 201Tl scan sensitivity was 97% for malignant lesions larger than 1.5 cm (n = 35) and 80% for lesions of 1.5 cm or less (n = 21); however, five of the eight breast cancers smaller than 1.0 cm were also detectable by 201Tl scintigraphy, compared with five out of seven by mammography. Thallium scintigraphy would not be useful in evaluating the axilla for lymph node metastases (sensitivity 27%, specificity 77%). (orig./MG)

  8. Influence of immobilization on the stability of pTG201 recombinant plasmid in some strains of Escherichia coli.

    OpenAIRE

    Nasri, M; Sayadi, S.; Barbotin, J N; Dhulster, P; Thomas, D.

    1987-01-01

    The stability of pTG201 plasmid was examined by continuous culture in three genetically different Escherichia coli hosts. Two types of experiment were carried out, one with free cells and one with immobilized cells. When cells were cultivated in free continuous culture in the absence of antibiotic selection, the plasmid was maintained with various degrees of stability in the three host organisms. By contrast, in continuous culture with immobilized cells, plasmid pTG201 was stably maintained i...

  9. Assessment of lower extremities ischemic disease by thallium 201 perfusion scintigraphy in patients with diabetic angiopathy

    Directory of Open Access Journals (Sweden)

    Čizmić Milica

    2011-01-01

    Full Text Available Background/Aim. Tibial perfusion in diabetic microangiopathy is considered to be a diagnostic problem. A special place in quantifying muscle microcirculatory perfusion belongs to thallium 201 muscle perfusion scintigraphy (201Tl PS. Thallium, showing the characteristics of potassium (K+, enters a cell by means of active cell transportation and follows erythrocyte up to the tissue. The aim of this study was to determine if 201Tl PS of lower extremities (LE is a good method for estimating muscle microcirculatory perfusion in diabetic microangiopathy. Methods. The study included 32 patients of an average age 66.1 ± 14.9 years with signs of LE ischemia befalling into III and IV stage of ischemic disease according to the Lariche-Fontain classification. Out of that number there were 27 of the patients with non-insulin-dependent diabetes mellitus (NIDDM, while 5 of the patients were with Burger's disease and Raynand's disorder. Lower extremities PS was performed after 3 min of tibial loading by the use of dorsoplantar foot flexion and intravenous 74 MBq 201Tl as a 10-minute dynamic study. A 10 minute static scintigraphy was carried out of the gluteal region, femurs, tibias and feet per a position and repeated after 3 h at rest in the same projections. The results were interpreted visually and by the semiquantitive method using a program for calculating the number of pulses per pixel in the corresponding region over 1-, 2- and 10-minute dynamic study, thus obtaining numerical data for estimating perfusion. Binding ratio in both legs was estimated visually as low (1, medium (2 and significant (3 difference in both legs. The results were compared with doppler hemodynamic indices (PI and RI. Results. Regardless the group, 201Tl binding intensity rising was significantly 2 min after application, as compared to 1 min, and the obtained level of binding was maintained even after 10 min. In the group Fontain III the majority of the patients showed a medium

  10. ATP-loading 201Tl myocardial SPECT for the detection of ischemic heart disease

    International Nuclear Information System (INIS)

    To evaluate the usefulness for the detection of ischemic heart disease, ATP myocrdial SPECT was performed in 35 patients (mean; 59±9.4 years) with angina pectoris or old myocardial infarction. Coronary angiography (CAG) was performed in all patients. The ultra-short half-life of ATP required a continuous infusion for its use. ATP was infused intravenously at a rate of 0.16 mg/kg/min for 5 min, with 201Tl injection taking place at 3 min. Myocardial SPECT imaging was begun 5 min and 4 hr later after the end of ATP infusion. ATP caused a significant decrease in arterial blood pressure (p201Tl myocardial SPECT for the detection of coronary artery disease (CAD) was evaluated using CAG as a golden standard. The sensitivity and specificity for CAD detection were 82% and 90%, respectively. ATP myocardial SPECT is a promising new test for the detection of ischemic heart disease. (author)

  11. Assessment of myocardial viability by 24-hour imaging after stress thallium-201 scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Taki, Junichi; Nakajima, Kenichi; Bunko, Hisashi; Taniguchi, Mitsuru; Kawasuji, Michio; Tonami, Norihisa; Hisada, Kinichi (Kanazawa Univ. (Japan). School of Medicine)

    1991-12-01

    Twenty-four-hour delayed imaging after stress thallium-201 scintigraphy was assessed for more accurate detection of viable myocardium. Thirty-two patients with coronary artery disease who showed fixed perfusion abnormality (FPA) at 3 hr imaging after stress Tl study were evaluated with 24 hr delayed imaging. Of 37 areas with FPA, 19 areas (51%) showed redistribution (RD) at 24 hr imaging. After successful coronary artery bypass grafting (n=19) or transluminal coronary angioplasty (n=3), stress Tl scintigraphy was performed. Of 13 areas with RD at 24 hr imaging, 12 revealed improvement of Tl uptake after revascularization. On the other hand, of 12 areas with FPA until 24 hr, 8 showed no improvement. In conclusion, conventional stress Tl-201 scintigraphy underestimates myocardial viability, and additional 24 hr imaging permits more accurate assessment of myocardial viability. (author).

  12. [A multicenter clinical trial of SMS 201-995 (octreotide acetate) in acromegaly and gigantism].

    Science.gov (United States)

    Shimatsu, A; Imura, H; Irie, M; Nakagawa, S; Goto, Y; Shimizu, N; Takeda, R; Kato, Y; Saito, S; Ibayashi, H

    1989-07-20

    Sixty-four patients with active acromegaly and three patients with gigantism were treated with the long acting somatostatin analog SMS 201-995 (50-500 micrograms, sc, every 6-12 h or 150-880 micrograms daily by intermittent sc infusion, for up to 114 weeks). The fasting plasma GH levels were significantly suppressed (less than 50% of the values before treatment) in 49 patients and became normal in 18 patients. Suppression of GH secretion was associated with normalization of plasma somatomedin-C levels (14 out of 30 cases) and significant clinical improvement such as disappearance of headache and decrease of excessive sweating. Shrinkage of pituitary tumors as determined by computed tomography and/or magnetic resonance imaging studies occurred in 11 out of 40 cases. Side effects were minimal and tolerable. SMS 201-995 appears to be an effective agent for the treatment of acromegaly and gigantism. PMID:2684694

  13. ODM-201: a new-generation androgen receptor inhibitor in castration-resistant prostate cancer.

    Science.gov (United States)

    Fizazi, Karim; Albiges, Laurence; Loriot, Yohann; Massard, Christophe

    2015-01-01

    Androgen deprivation therapy is the standard of care for patients with advanced hormone-sensitive prostate cancer. Despite an initial response, most patients progress to castration-resistant prostate cancer (CRPC). The realization that CRPC remains driven by androgen receptor (AR) signaling has formed the basis for a new generation of agents targeting the AR axis. Two of these agents, abiraterone acetate and enzalutamide, have been shown to prolong overall survival in patients with CRPC. Several other AR inhibitors are currently in development for the treatment of CRPC. The present article reviews ODM-201, a new-generation AR inhibitor with a unique molecular structure, in the treatment of CRPC. The design of an ongoing Phase III trial (ARAMIS) of ODM-201 in men with non-metastatic CRPC is also discussed, at a disease stage for which there is currently no approved treatment. PMID:26313416

  14. STS-56 Discovery, OV-103, payload bay (PLB) with ATLAS-2 pallet and SPARTAN-201

    Science.gov (United States)

    1993-01-01

    During STS-56 with Discovery, Orbiter Vehicle (OV) 103, in an atmospheric monitoring attitude, the Atmospheric Laboratory for Applications and Science 2 (ATLAS-2) unpressurized spacelab pallet and the mission peculiar support structure (MPESS)-mounted Shuttle Pointed Autonomous Research Tool for Astronomy 201 (SPARTAN-201) are visible in the payload bay (PLB). ATLAS-2 equipment and instruments include: the igloo (center foreground, only the top visible); the inverters and pump package (far right); port conical scan sensor (adjacent to pump package at far right); the millimeter-wave atmospheric sounder (MAS) antenna (dish-shaped device at pallet center) with ATMOS recorder underneath it; the starboard conical scan sensor (small cylinder at far left); and the atmospheric trace module spectroscopy (ATMOS) (box behind conical sensor at far left). Smaller ATLAS-2 instruments located in the center of the pallet include (left to right): Active Cavity Radiometer Irradiance Monitor (ACRIM or AC

  15. 201Thallium stress myocardial imaging: an evaluation of fifty-eight asymptomatic males

    International Nuclear Information System (INIS)

    The possible value of myocardial imaging with 201thallium as a screening procedure for the detection of latent disease has not been previously shown. Fifty-eight asymptomatic men underwent exercise 201thallium imaging together with a risk score profile based on the Framingham criteria for predicting future coronary events. Six subjects (10%) developed perfusion defects compatible with myocardial ischemia. The risk score for the population with an abnormal test was 7.7 +/- 2.9%, compared to 2.0 +/- 2.2% (p less than 0.001) for those men with normal tests. Three of the subjects with abnormal scans underwent selective coronary arteriograms; all three had normal coronary arteries. During a 30-month follow-up, all individuals remained physically active and free of cardiac symptoms. Exercise myocardial imaging is not a cost-effective means of detecting coronary artery disease in an asymptomatic population and should not be used as a screening procedure

  16. (-201) β-Gallium oxide substrate for high quality GaN materials

    KAUST Repository

    Roqan, Iman S.

    2015-03-13

    (-201) oriented β-Ga2O3 has the potential to be used as a transparent and conductive substrate for GaN-growth. The key advantages of Ga2O3 are its small lattice mismatches (4.7%), appropriate structural, thermal and electrical properties and a competitive price compared to other substrates. Optical characterization show that GaN layers grown on (-201) oriented β-Ga2O3 are dominated by intense bandedge emission with a high luminescence efficiency. Atomic force microscopy studies show a modest threading dislocation density of ~108 cm-2, while complementary Raman spectroscopy indicates that the GaN epilayer is of high quality with slight compressive strain. Room temperature time-findings suggest that the limitation of the photoluminescence lifetime (~500 ps) is due to nonradiative recombination arising from threading dislocation. Therefore, by optimizing the growth conditions, high quality material with significant optical efficiency can be obtained.

  17. Reverse redistribution of thallium-201 represents a low-risk finding in thrombolysed patients following myocardial infarction

    International Nuclear Information System (INIS)

    The aim of the study was to evaluate the prevalence and clinical significance of reverse redistribution on thallium-201 imaging in post-myocardial infarction patients who have undergone thrombolytic therapy. Sixty-two patients aged 35-79 (mean 60) years with proven myocardial infarction who had undergone thrombolysis were studied 6 weeks post infarction. Standard stress and 4-h redistribution imaging was performed with 201Tl following treadmill exercise. Separate day rest injection of 201Tl was given after sublingual nitroglycerine; imaging was performed at 1 h. Planar images were acquired in three standard views and semiquantitative segmental analysis of the images was performed from the unprocessed images. All patients had radionuclide ventriculography for the assessment of left ventricular ejection fraction and wall motion abnormality. Thirty-three patients also had coronary angiography. 201Tl scintigraphy revealed fixed defects in 19 patients, reversible defects in 22, and reverse redistribution in 21. Those with reverse redistribution had a significantly higher exercise capacity (P 201Tl uptake in the region showing reverse redistribution, with rest injection of 201Tl following sublingual nitroglycerine, suggesting viable myocardium in that region. (orig./VHE)

  18. Comparison of indium-111 octreotide and thalium-201 scintigraphy in patients mammographically suspected of having breast cancer: preliminary results

    International Nuclear Information System (INIS)

    Indium-111 octreotide and thallium-201 scintigraphic studies were compared in 21 patients (16 with palpable and five with non-palpable lesions) suspected of having breast malignancies on the basis of mammography. Early (15 min) and late (3 h) 201Tl (111 MBq) and 4-h and 24-h 111In-octreotide (111-148 MBq) static planar anterior images (matrix 256 x 256) were obtained on separate days. Images were evaluated both visually and quantitatively. Biopsy was performed following the imaging studies. Histopathology revealed 17 breast carcinomas (15 cases of invasive ductal carcinoma, one mucinous adenocarcinoma and one intraductal carcinoma) and four benign breast lesions (two fibroadenomas, one abscess and one case of fat necrosis). The means histopathological tumour size (mean largest diameter) was 3.38±1.9 cm. 111In-octreotide detected 16 of the 17 breast cancers (94%) while 201Tl detected 13 of them (76%). Both 111In-octreotide and 201Tl missed one nonpalpable carcinoma showing only an isolated cluster of microcalcifications on mammography. The smallest tumour size detected by both agents 1.5 x 1.5 cm. Of the four benign lesions, only the breast abscess revealed both 201Tl and 111In-octreotide uptake. 111In-octreotide scan also showed tracer uptake in five of the six patients with histologically proven axiallary metastases, while four of these six patient showed 201Tl uptake. (orig./VHE)

  19. Optimisation of Simultaneous Tl-201/Tc-99m Dual Isotope Reconstruction with Monte-Carlo-Based Scatter Correction

    Directory of Open Access Journals (Sweden)

    Tuija Kangasmaa

    2012-01-01

    Full Text Available Simultaneous Tl-201/Tc-99m dual isotope myocardial perfusion SPECT is seriously hampered by down-scatter from Tc-99m into the Tl-201 energy window. This paper presents and optimises the ordered-subsets-expectation-maximisation-(OS-EM- based reconstruction algorithm, which corrects the down-scatter using an efficient Monte Carlo (MC simulator. The algorithm starts by first reconstructing the Tc-99m image with attenuation, collimator response, and MC-based scatter correction. The reconstructed Tc-99m image is then used as an input for an efficient MC-based down-scatter simulation of Tc-99m photons into the Tl-201 window. This down-scatter estimate is finally used in the Tl-201 reconstruction to correct the crosstalk between the two isotopes. The mathematical 4D NCAT phantom and physical cardiac phantoms were used to optimise the number of OS-EM iterations where the scatter estimate is updated and the number of MC simulated photons. The results showed that two scatter update iterations and 105 simulated photons are enough for the Tc-99m and Tl-201 reconstructions, whereas 106 simulated photons are needed to generate good quality down-scatter estimates. With these parameters, the entire Tl-201/Tc-99m dual isotope reconstruction can be accomplished in less than 3 minutes.

  20. Optimisation of simultaneous tl-201/tc-99m dual isotope reconstruction with monte-carlo-based scatter correction.

    Science.gov (United States)

    Kangasmaa, Tuija; Kuikka, Jyrki; Sohlberg, Antti

    2012-01-01

    Simultaneous Tl-201/Tc-99m dual isotope myocardial perfusion SPECT is seriously hampered by down-scatter from Tc-99m into the Tl-201 energy window. This paper presents and optimises the ordered-subsets-expectation-maximisation-(OS-EM-) based reconstruction algorithm, which corrects the down-scatter using an efficient Monte Carlo (MC) simulator. The algorithm starts by first reconstructing the Tc-99m image with attenuation, collimator response, and MC-based scatter correction. The reconstructed Tc-99m image is then used as an input for an efficient MC-based down-scatter simulation of Tc-99m photons into the Tl-201 window. This down-scatter estimate is finally used in the Tl-201 reconstruction to correct the crosstalk between the two isotopes. The mathematical 4D NCAT phantom and physical cardiac phantoms were used to optimise the number of OS-EM iterations where the scatter estimate is updated and the number of MC simulated photons. The results showed that two scatter update iterations and 10(5) simulated photons are enough for the Tc-99m and Tl-201 reconstructions, whereas 10(6) simulated photons are needed to generate good quality down-scatter estimates. With these parameters, the entire Tl-201/Tc-99m dual isotope reconstruction can be accomplished in less than 3 minutes.

  1. Accuracy of ventricular volume and ejection fraction measured by gated Tl-201 perfusion single photon emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    Pai, Moon Sun; Moon, Dae Hyuk [University of Ulsan College of Medicine, Seoul (Korea, Republic of)

    2005-02-15

    Electrocardiogram-gated single photon emission computed tomography (SPECT) provides valuable information in the assessment of both myocardial perfusion and ventricular function. Tl-201 is a suboptimal isotope for gating. Tl-201 images are more blurred compared with Tc-99m tracers due to the increased amount of scattered photons and use of a smooth filter. The average myocardial count densities are approximately one-half those of conventional technetium tracers. However, Tl-201 is still widely used because of its well-established utility for assessing myocardial perfusion, viability and risk stratification. Gated SPECT with Tl-201 enables us to assess both post-stress and rest left ventricular volume and function. Previous studies with gated Tl-201 SPECT measurements of ejection fraction (EF), end-diastolic volume (EDV), end-systolic volume (ESV) have shown high correlation with first-pass radionuclide angiography, gated blood pool scan, Tc-99m-MIBI gated SPECT, contrast ventriculography, echocardiography, and 3-dimensional magnetic resonance imaging. However, problems related to these studies include few agreement data of EDV and ESV, use of a reference method that is likely to have the same systemic errors (gated Tc-99 m-MIBI SPECT), and other technical factors related to the count density of gated SPECT. With optimization of gated imaging protocols and more validation studies, gated Tl-201 SPECT would be an accurate method to provide perfusion and function information in patients with coronary artery disease.

  2. Diagnosis of pancreatic cancer using 201Tl-chloride and a three-head rotating gamma camera SPECT system

    International Nuclear Information System (INIS)

    201Tl SPECT was performed on 17 patients with pancreatic cancer or chronic pancreatitis using a three-head rotating gamma camera SPECT system. In 7 of 10 patients with pancreatic cancer, the lesions were clearly delineated by 201Tl SPECT. Whereas the lesion of 30 mm in diameter was visualized, a large tumor of 80 mm in diameter could not be visualized. Namely, it was thought that 201Tl uptake by pancreatic cancer might be well correlated with tumor blood flow and/or its histological subtype rather than with tumor size. In 5 of 7 patients with chronic pancreatitis, no uptake by the pancreas was shown. The sensitivity, specificity, and accuracy in diagnosing pancreatic cancer by 201Tl SPECT were 70%, 71%, and 71%, respectively. The present results obtained by 201Tl SPECT were thought satisfactory enough to evaluate pancreatic cancer under the present conditions where there was no useful imaging agent for visualizing pancreatic cancer by SPECT. 201Tl SPECT is expected to be a new diagnostic tool for investigation of pancreatic tumorous lesion. (author)

  3. Assessment of the right ventricular ischemia by means of stress T1-201 myocardial imaging

    International Nuclear Information System (INIS)

    In order to evaluate the clinical significance of thallium (Tl)-201 myocardial imaging for diagnosing the right ventricular (RV) ischemia, relationship of right ventricular free wall (RVFW) appearance on myocardial images to coronary arteriographic findings was studied. Patients were divided into 3 groups as follows: 1) normal control (NC) group (19 cases) without angiographically documented coronary artery disease; non-RCA group (18 cases) with significant coronary artery lesion restricted to the left coronary artery (LCA); and 3) RCA group (41 cases) with significant right coronary artery (RCA) stenosis regardless of underlying LCA disease. On the immediate images, all patients except one in the NC group and all except 4 in the non-RCA group demonstrated ''continuous visualization'' of the RVFW in both views. In the RCA group, 6 showed ''non-visualization'' and 13 ''defective visualization'' of the RVFW in 300 LAO view. In 600 LAO view, 6 presented ''non-visualization'' and 7 ''defective visualization'' of the RVFW. On the delayed images, although none of the patients in the groups NC and non-RCA demonstrated redistribution phenomenon of the RVFW, 5 patients in the RCA group showed redistribution of Tl-201 into the RVFW. When abnormal RVFW findings were defined as ''non-visualization'' or ''defective visualization'' of the RVFW on immediate images and/or positive redistribution phenomenon of the RVFW, sensitivity and specificity of the RVFW findings on stress Tl-201 myocardial images for detection of the RCA disease were 48.8% and 94.8%, respectively. Non- and defective visualization of the RVFW on the immediate images were related to the proximally located RCA lesion, previous history of inferior MI and high grade RCA stenosis. Collateral vessels seemed to protect the RVFW against the development of exercise induced ischemia and affect the occurrence of redistibution of Tl-201 into the RVFW. (J.P.N.)

  4. Phantom evaluation of simultaneous thallium-201/technetium-99m acquisition in single-photon emission tomography

    International Nuclear Information System (INIS)

    This study investigated downscatter effects in cardiac single-photon emission tomographic studies with simultaneous thallium-201/technetium-99m acquisition, and evaluated a previously proposed subtraction technique for downscatter compensation. Ten studies were carried out with different defect sizes and locations and varying activity distributions using four energy windows: 70±10% keV, 140±10% keV, 100±10% KeV, and 103±16% keV. The subtraction technique used the 100- or 103-keV data to remove scattered 99mTc counts from the 70-keV data. The size and contrast of infarcts in the dual-isotope 70-keV image were artificially decreased compared to those in the 140-keV image, caused by scattered 99mTc counts that were comparable to the primary 201Tl counts in the 70-keV window. The subtraction technique produced larger defects and more heterogeneous activity in the myocardial wall in dual-isotope 70-keV images compared to the corresponding 201Tl-only images. These artifacts were caused by the markedly different spatial distributions of scattered 99mTc counts in the 100-keV (or 103-keV) window as compared with the 70-keV window. It is concluded that scattered 99mTc photons may cause overestimation of ischemia and myocardial viability in simultaneous dual-isotope patient studies. The proposed subtraction technique was inaccurate and produced image artifacts. Adequate downscatter compensation methods must be developed before applying simultaneous 201Tl/99mTc acquisition in clinical practice. (orig.). With 6 figs., 3 tabs

  5. A human reliability analysis of the University of New Mexico's AGN- 201M nuclear research reactor

    International Nuclear Information System (INIS)

    During 1990--1991, a probabilistic risk assessment was conducted on the University of New Mexico's AGN-201M nuclear research reactor to address the risk and consequence of a maximum hypothetical release accident. The assessment indicated a potential for consequential human error to precipitate Chis scenario. Subsequently, a human reliability analysis was performed to evaluate the significance of human interaction on the reactor's safety systems. This paper presents the results of that investigation

  6. Far-infrared and submillimeter observations and physical models of the reflection nebula Cederblad 201

    NARCIS (Netherlands)

    Kemper, C; Spaans, M; Jansen, DJ; Hogerheijde, MR; van Dishoeck, EF; Tielens, AGGM

    1999-01-01

    Infrared Space Observatory (ISO) CC nl 158 mu m, [O I] 63 mu m, and H-2 9 and 17 mu m observations are presented of the reflection nebula Ced 201, which is a photon-dominated region (PDR) illuminated by a B9.5 star with a color temperature of 10,000 K (a cool PDR). In combination with ground-based [

  7. Codon 201 Mutation of DCC Gene and Tumor Biologic Behavior in Human Colorectal Carcinoma

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Objective To explore the relationship between a point mutation of codon 201 in deleted in colorectal carcinoma ( DCC) gene and the biological behavior of colorectal carcinoma. Methods Tumor tissues and matched adjacent normal colon mucosa collected in 35 patients during surgical resection for colorectal carcinoma were analyzed. Forty normal colon mucosa tissues obtained by biopsy from patients who had neither colorectal tumor nor a family history of colorectal cancer during colonscop ic examination were used as control. Codon 201 mutatian was detected with allele-specific PCR and a restriction enzyme digestion method. The tumors were reviewed as clinical data, tumor location, histology,metastasis, and pathological staging (Dukes classification). Results The frequency of mutation at codon 201 in tumor tissue and corresponding adjacent normal mucosa was 71.4 % and 60 %, respectively, and either of the rates was significantly higher than that of normal control(32.5 % ). The point mutation rate in tumor tissues did not differ from that in the corresponding normal adjacent tissues. Statistic analysis showed that the mutation rate had no relationship to the sex, age of the patients, the histological pattern , differentiation, and invasion depth of the tumors. However, 93. 8 % of the mutation rate in colorectal cancer with lymph node invasion and/or distant metastasis is significantly higher than 52. 6 % of mutant rate in colorectal cancer uithout lymph nodes invasion or metastasis ( P <0. 05). Conclusion The point mutation at codon 201 of DCC gene is an early genetic event in colorectal cancer, and play some role in invasion and metastasis of colorectal carcinoma. It may serve as a useful genetic marker for identifying higher risk patients with colorectal carcinoma.

  8. Codon 201 Mutation of DCC Gene and Tumor Biologic Behavior in Human Colorectal Carcinoma

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Objective To explore the relationship between a point mutation of codon 201 in deleted in colorectal carcinoma ( DCC) gene and the biological behavior of colorectal carcinoma. Methods Tumor tissues and matched adjacent normal colon mucosa collected in 35 patients during surgical resection for colorectal carcinoma were analyzed. Forty normal colon mucosa tissues obtained by biopsy from patients who had neither colorectal tumor nor a family history of colorectal cancer during colonscop ic examination were used as control. Codon 201 mutatian was detected with allele-specific PCR and a restriction enzyme digestion method. The tumors were reviewed as clinical data, tumor location, histology,metastasis, and pathological staging (Dukes classification). Results The frequency of mutation at codon 201 in tumor tissue and corresponding adjacent normal mucosa was 71.4 % and 60 %, respectively, and either of the rates was significantly higher than that of normal control(32.5 % ). The point mutation rate in tumor tissues did not differ from that in the corresponding normal adjacent tissues. Statistic analysis showed that the mutation rate had no relationship to the sex, age of the patients, the histological pattern , differentiation, and invasion depth of the tumors. However, 93. 8 % of the mutation rate in colorectal cancer with lymph node invasion and/or distant metastasis is significantly higher than 52. 6 % of mutant rate in colorectal cancer uithout lymph nodes invasion or metastasis ( P <0. 05). Conclusion The point mutation at codon 201 of DCC gene is an early genetic event in colorectal cancer, and play some role in invasion and metastasis of colorectal carcinoma. It may serve as a useful genetic marker for identifying higher risk patients with colorectal carcinoma.

  9. Yeast Interacting Proteins Database: YKR037C, YDR201W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YKR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...201W SPC19 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...34 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced

  10. Thallium 201 scintigraphy in an infant with myocardial infarction following mucocutaneous lymph node syndrome

    International Nuclear Information System (INIS)

    A 4-month old boy with myocardial infarction following mucocutaneous lymph node syndrome is described. Angiocardiogram revealed multiple aneurysms of the right and left main coronary arteries, complete occlusion of the left anterior descending and left circumflex coronary arteries, and post-infarction aneurysm of the left ventricle. Thallium 201 scintigram demonstrated the infarcted area precisely and repeat examinations showed the improvement of the myocardial perfusion, which was probably due to the development of the collateral circulation. (orig.)

  11. Yeast Interacting Proteins Database: YNL201C, YBL046W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YNL201C PSY2 Putative subunit of an evolutionarily conserved protein phosphatase co...s prey (0) YBL046W PSY4 Putative regulatory subunit of an evolutionarily conserve...ne name PSY2 Bait description Putative subunit of an evolutionarily conserved protein phosphatase complex co...gene name PSY4 Prey description Putative regulatory subunit of an evolutionarily conserved protein phosphata

  12. POPDC1S201F causes muscular dystrophy and arrhythmia by affecting protein trafficking

    Science.gov (United States)

    Schindler, Roland F.R.; Scotton, Chiara; Zhang, Jianguo; Passarelli, Chiara; Ortiz-Bonnin, Beatriz; Simrick, Subreena; Schwerte, Thorsten; Poon, Kar-Lai; Fang, Mingyan; Rinné, Susanne; Froese, Alexander; Nikolaev, Viacheslav O.; Grunert, Christiane; Müller, Thomas; Tasca, Giorgio; Sarathchandra, Padmini; Drago, Fabrizio; Dallapiccola, Bruno; Rapezzi, Claudio; Arbustini, Eloisa; Di Raimo, Francesca Romana; Neri, Marcella; Selvatici, Rita; Gualandi, Francesca; Fattori, Fabiana; Pietrangelo, Antonello; Li, Wenyan; Jiang, Hui; Xu, Xun; Bertini, Enrico; Decher, Niels; Wang, Jun; Brand, Thomas; Ferlini, Alessandra

    2015-01-01

    The Popeye domain–containing 1 (POPDC1) gene encodes a plasma membrane–localized cAMP-binding protein that is abundantly expressed in striated muscle. In animal models, POPDC1 is an essential regulator of structure and function of cardiac and skeletal muscle; however, POPDC1 mutations have not been associated with human cardiac and muscular diseases. Here, we have described a homozygous missense variant (c.602C>T, p.S201F) in POPDC1, identified by whole-exome sequencing, in a family of 4 with cardiac arrhythmia and limb-girdle muscular dystrophy (LGMD). This allele was absent in known databases and segregated with the pathological phenotype in this family. We did not find the allele in a further screen of 104 patients with a similar phenotype, suggesting this mutation to be family specific. Compared with WT protein, POPDC1S201F displayed a 50% reduction in cAMP affinity, and in skeletal muscle from patients, both POPDC1S201F and WT POPDC2 displayed impaired membrane trafficking. Forced expression of POPDC1S201F in a murine cardiac muscle cell line (HL-1) increased hyperpolarization and upstroke velocity of the action potential. In zebrafish, expression of the homologous mutation (popdc1S191F) caused heart and skeletal muscle phenotypes that resembled those observed in patients. Our study therefore identifies POPDC1 as a disease gene causing a very rare autosomal recessive cardiac arrhythmia and LGMD, expanding the genetic causes of this heterogeneous group of inherited rare diseases. PMID:26642364

  13. Phantom evaluation of simultaneous thallium-201/technetium-99m acquisition in single-photon emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    Cao Zongjian [Department of Diagnostic Radiology, University of Maryland Medical Center, Baltimore, MD (United States); Chen, C.C. [Department of Diagnostic Radiology, University of Maryland Medical Center, Baltimore, MD (United States); Maunoury, C. [Department of Diagnostic Radiology, University of Maryland Medical Center, Baltimore, MD (United States); Holder, L.E. [Department of Diagnostic Radiology, University of Maryland Medical Center, Baltimore, MD (United States); Abraham, T.C. [Department of Diagnostic Radiology, University of Maryland Medical Center, Baltimore, MD (United States); Tehan, A. [Department of Diagnostic Radiology, University of Maryland Medical Center, Baltimore, MD (United States)

    1996-11-01

    This study investigated downscatter effects in cardiac single-photon emission tomographic studies with simultaneous thallium-201/technetium-99m acquisition, and evaluated a previously proposed subtraction technique for downscatter compensation. Ten studies were carried out with different defect sizes and locations and varying activity distributions using four energy windows: 70{+-}10% keV, 140{+-}10% keV, 100{+-}10% KeV, and 103{+-}16% keV. The subtraction technique used the 100- or 103-keV data to remove scattered {sup 99m}Tc counts from the 70-keV data. The size and contrast of infarcts in the dual-isotope 70-keV image were artificially decreased compared to those in the 140-keV image, caused by scattered {sup 99m}Tc counts that were comparable to the primary {sup 201}Tl counts in the 70-keV window. The subtraction technique produced larger defects and more heterogeneous activity in the myocardial wall in dual-isotope 70-keV images compared to the corresponding {sup 201}Tl-only images. These artifacts were caused by the markedly different spatial distributions of scattered {sup 99m}Tc counts in the 100-keV (or 103-keV) window as compared with the 70-keV window. It is concluded that scattered {sup 99m}Tc photons may cause overestimation of ischemia and myocardial viability in simultaneous dual-isotope patient studies. The proposed subtraction technique was inaccurate and produced image artifacts. Adequate downscatter compensation methods must be developed before applying simultaneous {sup 201}Tl/{sup 99m}Tc acquisition in clinical practice. (orig.). With 6 figs., 3 tabs.

  14. Effect of stenosed and occluded coronary arteries on immediate and late myocardial uptake of thallium-201.

    OpenAIRE

    Clitsakis, D; Layton, C A; Battersby, W; Johns, M; Stockley, A V

    1981-01-01

    Exercise and redistribution myocardial scintigraphy using thallium-201 was compared with the left ventricular angiogram and with the presence of stenosis or occlusion of coronary arteries on angiography. Irreversible scintigraphic defects representing areas of myocardial infarction were found in all patients with occlusion of the left anterior descending artery but nearly one-third of patients with stenosis of that artery also showed evidence of infarction. For the right coronary or circumfle...

  15. Implementation of Great Number of Points FFT Based on ADSP-TS201%基于ADSP-TS201的大点数FFT实现

    Institute of Scientific and Technical Information of China (English)

    穆文争; 王启智; 朱子平

    2014-01-01

    为了解决雷达信号处理中大点数脉压问题,将一维大点数FFT拆成二维实现。首先给出大点数FFT变换的数学原理,然后以96 K点为例,介绍了其在通用处理器ADSP-TS201的实现过程。测试结果表明,所提出的处理方式不仅能正确实现大点数FFT变换,而且具有较好的实时性。%In order to solve problem of great number of points pulse compression in radar signal processing, 1 di-mensional great number of points FFT can be realized by splitting it into two-dimension. The mathematical princi-ple of great number of points FFT is given firstly, then by taking 96K points as an example, the implementation process in general processor ADSP-TS201 is introduced. The test result shows that the proposed processing way not only realizes great number of points FFT correctly, but also with excellent real-time property.

  16. Tank 241-T-201, core 192 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Nuzum, J.L.

    1997-08-07

    This document is the final laboratory report for Tank 241-T-201. Push mode core segments were removed from Riser 3 between April 24, 1997, and April 25, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-201 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997), Letter of Instruction for Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI) (Bell, 1997), Additional Core Composite Sample from Drainable Liquid Samples for Tank 241-T-2 01 (ACC) (Hall, 1997), and Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report.

  17. The importance of sex-specific quantitative criteria in thallium-201 myocardial scintigraphy

    International Nuclear Information System (INIS)

    Breast attenuation is an important cause of artifactual cold spots on visually interpreted TL-201 myocardial images. This study was undertaken to determine the need for sex-specific criteria in the quantitative analysis of exercise-redistribution TL-201 myocardial scintigraphy (SCINT). The studies of 13 normal females (F) and 12 normal males (M) were processed according to the method of a previous study. Significant sexual differences were found in 7/12 regional uptake (U) proportions, 9/11 regional washout (WO) percentages, 0/3 image redistribution indices, and 0/1 lung to heart ratio. The differences primarily reflected a proportionately decreased anterior and septal uptake in F, a proportionately decreased inferior and inferoapical U in M, and faster WO in F. Sex-specific and total population normal boundaries were set a +- 3SD of the mean for each parameter. Sex-specific boundaries were narrower, and, for 5 parameters (4U and 1WO), contained within the total population boundaries. It was estimated that these differences in boundaries would result in a 6 to 25% discrepancy in patient classification. These results predict that a subset of M and F with coronary artery stenoses could be misclassified as normal by total population criteria, while properly classified as abnormal by sex-specific criteria. The authors conclude that since important differences exist between M and F in the detected pattern of TL-201 myocardial U and WO, sex-specific cr4iteria may enhance the predictive accuracy of SCINT

  18. Regulatory Implications of Structural Changes in Tyr201 of the Oxygen Sensor Protein FixL.

    Science.gov (United States)

    Yamawaki, Takeo; Ishikawa, Haruto; Mizuno, Misao; Nakamura, Hiro; Shiro, Yoshitsugu; Mizutani, Yasuhisa

    2016-07-26

    FixL is a heme-based oxygen-sensing histidine kinase that induces the expression of nitrogen fixation genes under hypoxic conditions. Oxygen dissociation from heme iron in the sensor domain of FixL initiates protein conformational changes that are transmitted to the histidine kinase domain, activating autophosphorylation activity. Conversely, oxygen binding inhibits FixL kinase activity. It is essential to elucidate the changes that occur in the protein structure upon this oxygen dissociation for understanding of the allosteric transduction mechanism. We measured ultraviolet resonance Raman spectra of FixL and its mutants for deoxy, oxy, and carbonmonoxy forms to examine the changes in protein structure upon oxygen dissociation. The observed spectral changes indicated that Tyr201 and its neighboring residues undergo structural changes upon oxygen dissociation. Kinase assays showed that substitution of Tyr201 significantly decreased the inhibition of kinase activity upon oxygen binding. These data mean that weakening of the hydrogen bond of Tyr201 that is induced by oxygen dissociation is essential for inhibition of kinase activity. We also observed spectral changes in Tyr residues in the kinase domain upon oxygen dissociation from FixL, which is the first observation of oxygen-dependent structural changes in the kinase domain of FixL. The observed structural changes support the allosteric transduction pathway of FixL which we proposed previously [ Yano, S., Ishikawa, H., Mizuno, M., Nakamura, H., Shiro, Y., and Mizutani, Y. ( 2013 ) J. Phys. Chem. B 117 , 15786 - 15791 ]. PMID:27367650

  19. Helium Pressure Shift of the Hyperfine Clock Transition in Hg-201(+)

    Science.gov (United States)

    Larigani, S. Taghavi; Burt, E. A.; Tjoelker, R. L.

    2010-01-01

    There are two stable odd isotopes of mercury with singly ionized hyperfine structure suitable for a microwave atomic clock: Hg-199(+) and Hg-201(+). We are investigating the viability of a trapped ion clock based on Hg-201(+) in a configuration that uses a buffer gas to increase ion loading efficiency and counter ion heating from rf trapping fields. Traditionally, either helium or neon is used as the buffer gas at approx. 10(exp -5) torr to confine mercury ions near room temperature. In addition to the buffer gas, other residual background gasses such as H2O, N2, O2, CO, CO2, and CH2 may be present in trace quantities. Collisions between trapped ions and buffer gas or background gas atoms/molecules produce a momentary shift of the ion clock transition frequency and constitute one of the largest systematic effects in this type of clock. Here we report an initial measurement of the He pressure shift in Hg-201(+) and compare this to Hg-199(+).

  20. Prognostic significance of normal quantitative planar thallium-201 stress scintigraphy in patients with chest pain

    International Nuclear Information System (INIS)

    The prognostic significance of normal quantitative planar thallium-201 stress scintigraphy was evaluated in patients with a chest pain syndrome. The prevalence of cardiac events during follow-up was related to the pretest (that is, before stress scintigraphy) likelihood of coronary artery disease determined on the basis of symptoms, age, sex and stress electrocardiography. In a consecutive series of 344 patients who had adequate thallium-201 stress scintigrams, 95 had unequivocally normal studies by quantitative analysis. The pretest likelihood of coronary artery disease in the 95 patients had a bimodal distribution. During a mean follow-up period of 22 +/- 3 months, no patient died. Three patients (3%) had a cardiac event: two of these patients (pretest likelihood of coronary artery disease 54 and 94%) had a nonfatal myocardial infarction 8 and 22 months, respectively, after stress scintigraphy, and one patient (pretest likelihood 98%) underwent percutaneous transluminal coronary angioplasty 16 months after stress scintigraphy for persisting anginal complaints. Three patients were lost to follow-up; all three had a low pretest likelihood of coronary artery disease. It is concluded that patients with chest pain and normal findings on quantitative thallium-201 scintigraphy have an excellent prognosis. Cardiac events are rare (infarction rate 1% per year) and occur in patients with a moderate to high pretest likelihood of coronary artery disease

  1. Quantitative analysis of tomographic stress thallium-201 myocardial scintigrams: A multicenter trial

    International Nuclear Information System (INIS)

    The accuracy of the previously developed and validated Cedars-Sinai Medical Center (CSMC) computer program for quantitative analysis of thallium-201 (201TI) stress myocardial tomograms was assessed in a multicenter trial consisting of 242 patients with coronary angiography and 76 with a low likelihood (LL) of coronary artery disease (CAD) involving various cameras, computers, and operators. The program utilized gender-matched normal limits developed from 35 LL patients at CSMC. The multicenter results as compared to those of 168 patients from CSMC were not significantly different with respect to the overall sensitivities (94% versus 95%) and specificities (44% versus 56%) for identification of CAD and normalcy rates which were determined in LL patients (82% for both) and with respect to identification of individual diseased arteries. The results indicate that our method for quantifying tomographic 201TI stress scintigrams utilizing standard normal limits can be applied at other institutions by different operators, using a variety of cameras and computers, with similar accuracy to that currently obtained at our institution

  2. Optimum technique for /sup 201/Tl tomography of myocardium: an investigation using phantoms

    Energy Technology Data Exchange (ETDEWEB)

    Laird, E.E.; Williams, E.D.

    1987-08-01

    Rotating gamma-camera tomography is used for /sup 201/Tl perfusion imaging to detect myocardial ischaemia or infarction. Variables which can affect the utility of the images include acquisition time, collimator sensitivity and resolution, spatial filtering, reconstruction matrix and display parameters. An 'Iowa' design myocardial phantom containing /sup 201/Tl, with a defect representing an unperfused area, was used to study the effect of these variables. Receiver operator characteristic (ROC) curves and contrast ratios indicated that filtering the acquisition data with a count-dependent (Metz) filter before reconstruction and using a narrow slice width gave best results. No single collimator was superior for all four defect locations investigated but low-energy general purpose and high-resolution collimators were preferred to those with greater sensitivity. Reducing acquisition time by a factor of four compared with that for routine patient imaging affected contrast ratio, uniformity and area under ROC curves insignificantly, provided the optimum reconstruction was used. Displaying tomographic sections in colour gave no improvement in ROC curves over monochrome images. Data acquisition time or administered /sup 201/Tl radioactivity might therefore be reduced below the 25 min and 80 MBq often used for patient studies.

  3. Differential diagnosis in patients with ring-like thallium-201 uptake in brain SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Kinuya, Keiko; Ohashi, Masahiro; Itoh, Syotaro [Tonami General Hospital, Toyama (Japan)] (and others)

    2002-09-01

    This study was performed to investigate lesions with ring-like thallium-201 ({sup 201}Tl) uptake and to determine whether SPECT provides any information in differential diagnosis. A total of 244 {sup 201}Tl SPECT images were reviewed. In each study, early (15 min postinjection) and late (3 hr) brain SPECT images were obtained with 111 MBq of {sup 201}Tl. The early uptake ratio (ER; lesion to normal brain average count ratio) and the late uptake ratio (LR) and the L/E ratio (ratio of LR to ER) were calculated. Ring-like uptake was observed in pre-therapeutic 26 SPECT images, including ten glioblastoma multiformes (ER, 3.45{+-}0.64; LR, 2.74{+-}0.54; L/E ratio 0.80{+-}0.13), five meningiomas (6.48{+-}2.34; 4.41{+-}1.41; 0.72{+-}0.19), four metastatic lung cancers (3.47{+-}1.23; 2.40{+-}0.98; 0.70{+-}0.14), four brain abscesses (2.48{+-}1.06; 1.59{+-}0.30; 0.78{+-}0.15), one invasive lesion of squamous cell carcinoma from the ethmoid sinus (1.54; 1.52; 0.99), one medulloblastoma (3.53; 3.52; 1.00) and one hematoma (3.32; 2.36; 0.71). The ER of meningioma was significantly higher than those of glioblastoma multiforme (p<0.0005), metastatic lung cancer (p<0.005) and brain abscess (p<0.0005). There were no significant differences among these three entities. The LR of meningioma was significantly higher than those of glioblastoma multiforme (p<0.005), metastatic lung cancer (p<0.005) and brain abscess (p<0.0001). The LR of brain abscess was significantly lower than that of glioblastoma multiforme (p<0.05). The L/E ratio could not differentiate these four entities. High ER and high LR in a lesion with ring-like uptake is likely an indicator of meningioma. The LR of brain abscess was significantly lower than that of glioblastoma multiforme, but {sup 201}Tl SPECT has still difficulty in differentiating abscess from brain tumor. (author)

  4. Ectopic Expression of BnaC.CP20.1 Results in Premature Tapetal Programmed Cell Death in Arabidopsis.

    Science.gov (United States)

    Song, Liping; Zhou, Zhengfu; Tang, Shan; Zhang, Zhiqiang; Xia, Shengqian; Qin, Maomao; Li, Bao; Wen, Jing; Yi, Bin; Shen, Jinxiong; Ma, Chaozhi; Fu, Tingdong; Tu, Jinxing

    2016-09-01

    Tapetal programmed cell death (PCD) is essential in pollen grain development, and cysteine proteases are ubiquitous enzymes participating in plant PCD. Although the major papain-like cysteine proteases (PLCPs) have been investigated, the exact functions of many PLCPs are still poorly understood in PCD. Here, we identified a PLCP gene, BnaC.CP20.1, which was closely related to XP_013596648.1 from Brassica oleracea. Quantitative real-time PCR analysis revealed that BnaC.CP20.1 expression was down-regulated in male-sterile lines in oilseed rape, suggesting a connection between this gene and male sterility. BnaC.CP20.1 is especially active in the tapetum and microspores in Brassica napus from the uninucleate stage until formation of mature pollen grains during anther development. On expression of BnaC.CP20.1 prior to the tetrad stage, BnA9::BnaC.CP20.1 transgenic lines in Arabidopsis thaliana showed a male-sterile phenotype with shortened siliques containing fewer or no seeds by self-crossing. Scanning electron microscopy indicated that the reticulate exine was defective in aborted microspores. Callose degradation was delayed and microspores were not released from the tetrad in a timely fashion. Additionally, the terminal deoxynucleotidyl transferase-mediated dUTP nick-end labeling (TUNEL) assay indicated that BnaC.CP20.1 ectopic expression led to premature tapetal PCD. Transmission electron microscopy analyses further demonstrated that the pollen abortion was due to the absence of tectum connections to the bacula in the transgenic anthers. These findings suggest that timely expression of BnaC.CP20.1 is necessary for tapetal degeneration and pollen wall formation. PMID:27388342

  5. Kinetic analysis of 18F-fluorodihydrorotenone as a deposited myocardial flow tracer: Comparison to thallium-201.

    Energy Technology Data Exchange (ETDEWEB)

    Marshall, Robert C.; Powers-Risius, Patricia; Reutter, Bryan W.; O' Neil, James P.; La Belle, Michael; Huesman, Ronald H.; VanBrocklin, Henry F.

    2004-03-01

    The goal of this investigation was to assess the accuracy of 18F-fluorodihydrorotenone (18F-FDHR) as a new deposited myocardial flow tracer and compare the results to those for 201Tl. Methods. The kinetics of these flow tracers were evaluated in 22 isolated, erythrocyte- and albumin-perfused rabbit hearts over a flow range encountered in patients. The two flow tracers plus a vascular reference tracer (131I-albumin) were introduced as a bolus through a port just above the aortic cannula. Myocardial extraction, retention, washout, and uptake parameters were computed from the venous outflow curves using the multiple indicator dilution technique and spectral analysis. Results. The mean initial extraction fractions of 18F-FDHR (0.85 +- 0.07) and 201Tl (0.87 +- 0.05) were not significantly different, although the initial extraction fraction for 18F-FDHR declined with flow (P < 0.0001), whereas the initial extraction fraction of 201Tl did not. Washout of 201Tl was faster (P < 0.001) and more affected by flow (P < 0.05) than 18F-FDHR washout. Except for initial extraction fraction, 18F-FDHR retention was greater (P < 0.001) and less affected by flow (P < 0.05) than 201Tl retention. Reflecting its superior retention, net uptake of 18F-FDHR was better correlated with flow than 201Tl uptake at both one and fifteen minutes after tracer introduction (P < 0.0001 for both comparisons). Conclusion. The superior correlation of 18F-FDHR uptake with flow indicates that it is a better flow tracer than 201Tl in the isolated rabbit heart. Compared to the other currently available positron-emitting flow tracers (82Rb, 13N-ammonia, and 15O-water), 18F-FDHR has the potential of providing excellent image resolution without the need for an on-site cyclotron.

  6. Prognostic significance of normal quantitative Tl-201 stress scintigraphy in relation to pretest likelihood of coronary artery disease

    International Nuclear Information System (INIS)

    A previous study reported an excellent prognosis and low cardiac event rate in patients(pts) with chest pain and normal quantitative T1-201 scintigraphy(SC). Such result would not be unexpected if the population under study had a predominance of pts with low pre-T1-201 likelihood(L) of significant coronary artery disease (CAD). Hence, the authors undertook telephone follow-up in pts with chest pain syndrome and normal quantitative T1-201 exercise SC, and related outcome to pretest L of CAD. Pretest L was determined by serial L analysis on the basis of: symptoms, age, sex, and exercise ECG. All pts had T1-201 SC immediately post exercise and 2 hrs later. After interpolative background correction, circumferential count and washout profiles were generated. All pts had unequivocally normal studies. Of a total of 96 pts studied in 1981-82, 20 pts were lost to follow-up. Of the remaining 76 pts, 45 were males and 31 females. The pretest L of CAD had an inverted Gaussian distribution: thirty-four pts(47%) had 66% L of CAD. Mean follow-up was 22+- 3 months. No deaths occurred. Two pts(3%) (with pretest L of 54% and 94%) had myocardial infarctions, 8 and 22 months respectively after T1-201 stress SC. One pt underwent percutaneous transluminal coronary angioplasty (PTCA) 16 months after T1-201 stress SC. These findings confirm excellent prognostic significance of normal quantitative T1-201 stress scintigraphy

  7. 简析美国对外贸易政策的201、301、406条款%Analysis on USA Foreign Trade Policies" Article 201, 301 and 406

    Institute of Scientific and Technical Information of China (English)

    周旋

    2011-01-01

    In USA foreign trade policies, the Article 201,301 and 406 are often used, this paper analyzes their connotation, origin, substance and apocalypse.%在美国对外贸易政策中,经常会启动201条款、301条款及406条款。本文对美国对外贸易政策中的201、301、406条款的内涵、渊源、实质及其启示作了简要的分析。一、美国20l条款、301条款、406条款的内涵1.201条款的内涵201条款,又称为“保障条款”或“进口救济法案”,也称“例外条款”,是指现收在美国法典225l一2254节的条款,这4节总的题目是“受进口损害的。

  8. Comparison of adenosine and treadmill exercise thallium-201 stress tests for the detection of coronary artery disease.

    Science.gov (United States)

    Abe, S; Takeishi, Y; Chiba, J; Ikeda, K; Tomoike, H

    1993-12-01

    To determine the clinical usefulness of adenosine Tl-201 imaging for the evaluation of coronary artery disease, 22 patients with suspected coronary artery disease who underwent adenosine and exercise Tl-201 single photon emission computed tomography (SPECT) were studied. The peak levels of heart rate (83 vs 123 bpm, p pressure products (10220 vs 20410 bpm x mmHg, p < 0.001) were markedly smaller during adenosine infusion than during exercise. Segmental agreements between adenosine and exercise tests were 90% (218 of 242 segments) regarding the presence of perfusion defects and 89% (215 of 242 segments) regarding the presence of redistribution. Regional Tl-201 uptake (r = 0.85, p < 0.001) and the extent (r = 0.75, p < 0.001) and intensity (r = 0.83, p < 0.001) of Tl-201 defects during adenosine testing were closely correlated with those of exercise testing. Adenosine and exercise tests showed similar sensitivities for the identification of individual coronary stenosis (85% vs 78%). However, in patients who were unable to perform adequate exercise (maximal heart rate < 120 bpm), the sensitivity of adenosine imaging tended to be higher than that of exercise imaging (92% vs 69%, p = 0.07). Adenosine Tl-201 imaging is an alternative to the exercise test for assessing the severity and loci of coronary artery disease, especially in patients who are unable to perform adequate physical exercise. PMID:8283603

  9. Thallium-201 single photon emission computed tomography (SPECT) in patients with Duchenne's progressive muscular dystrophy. A histopathologic correlation study

    International Nuclear Information System (INIS)

    The pathomorphologic mechanism responsible for abnormal perfusion imaging during thallium-201 myocardial single photon emission computed tomography (201Tl-SPECT) in patients with Duchenne's progressive muscular dystrophy (DMD) was investigated. Hearts from 7 patients with DMD were evaluated histopathologically at autopsy and the results correlated with findings on initial and delayed resting 201Tl-SPECT images. The location of segments with perfusion defects correlated with the histopathologically abnormal segments in the hearts. Both the extent and degree of myocardial fibrosis were severe, especially in the posterolateral segment of the left ventricle. Severe transmural fibrosis and severe fatty infiltration were common in segments with perfusion defects. In areas of redistribution, the degree of fibrosis appeared to be greater than in areas of normal perfusion; and intermuscular edema was prominent. Thus, the degree and extent of perfusion defects detected by 201Tl-SPECT were compatible with the histopathology. The presence of the redistribution phenomenon may indicate ongoing fibrosis. Initial and delayed resting 201Tl-SPECT images can predict the site and progress of myocardial degeneration in patients with DMD. (author)

  10. Removal of {sup 99m}Tc and {sup 201}Tl by means of Lemna Gibba; Remocion de {sup 99m}Tc y {sup 201}Tl mediante Lemna Gibba

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez R, E.; Carreno de L, M. C.; Cuevas S, J. C.; Hernadez T, U. O. [Instituto Tecnologico de Toluca, Av. Tecnologico s/n, Fraccionamiento La Virgen, 52149 Metepec, Estado de Mexico (Mexico); Monroy G, F., E-mail: edelmiraf@yahoo.com [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2012-10-15

    In this work the capacity of the water macrophyte Lemna gibba coming from San Pedro Tultepec in the Mexico State was studied to remove the radioisotopes {sup 99m}Tc and {sup 201}Tl, in order to show the capacity of this macrophyte for to treat some radioactive waste flowing that could contain this radioisotopes type. The removal capacity of {sup 99m}Tc and {sup 201}Tl of the macrophyte Lemna gibba was determined using the batch method. In accordance with the values of the obtained K{sub d}, the Lemna gibba with a size of particle diameter among 1mm - 300 {mu}m presents a better adsorption of {sup 99m}Tc. The {sup 201}Tl is adsorbed better in the bioadsorbent when it has a size of particle diameter <150{mu}m. (Author)

  11. Development and Production of a 201 MHz, 5.0 MW Peak Power Klystron

    Energy Technology Data Exchange (ETDEWEB)

    Aymar, Galen [Communications & Power Industries, Palo Alto, CA (United States); Eisen, Edward [Communications & Power Industries, Palo Alto, CA (United States); Stockwell, Brad [Communications & Power Industries, Palo Alto, CA (United States); Begum, rasheda [Communications & Power Industries, Palo Alto, CA (United States); Lenci, Steve [Communications & Power Industries, Palo Alto, CA (United States); Eisner, Rick [Communications & Power Industries, Palo Alto, CA (United States); Cesca, Eugene [Communications & Power Industries, Palo Alto, CA (United States)

    2016-01-01

    Communications & Power Industries LLC has designed and manufactured the VKP-8201A, a high peak power, high gain, VHF band klystron. The klystron operates at 201.25 MHz, with 5.0 MW peak output power, 34 kW average output power, and a gain of 36 dB. The klystron is designed to operate between 1.0 MW and 4.5 MW in the linear range of the transfer curve. The klystron utilizes a unique magnetic field which enables the use of a proven electron gun design with a larger electron beam requirement. Experimental and predicted performance data are compared.

  12. Application of Seismic Data to Reservoir Modeling of the Chegu 201 Block

    Institute of Scientific and Technical Information of China (English)

    CaiYi; ZhangXiangzhong; ZhangXinshang

    2005-01-01

    Great uncertainty exists in reservoir models built for blocks where well spacing is uneven or large. The uncertainty in reservoir models can be significantly reduced by using Coordinate Cokriging Sequential Gaussian Simulation technology, in combination with the restriction of seismic characteristic data. Satisfactory reservoir parameter interpolation results, which are more accurate than those derived only from borehole data, are obtained, giving rise to a reasonable combination of widespread and dense-sampled seismic (soft data) data with borehole data (hard data). A significant effect has been made in reservoir parameter modeling in the Chegu 201 block of the Futai Oilfield by using this technology.

  13. Reactions sup 58,64 Ni( p ,. pi. sup + ) at 201 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Badala, A.; Barbera, R.; Palmeri, A.; Pappalardo, G.S.; Bonasera, A. (Istituto Nazionale di Fisica Nucleare, Corso Italia 57, 95129 Catania (Italy)); Riggi, F.; Adorno, A. (Istituto Nazionale di Fisica Nucleare and Dipartimento di Fisica dell' Universita di Catania, Corso Italia 57, 95129 Catania (Italy)); Bimbot, L. (Institut de Physique Nucleaire, Boite Postale 1, 91406 Orsay CEDEX (France))

    1992-08-01

    The production of positive and negative pions induced by 201 MeV protons on {sup 58}Ni and {sup 64}Ni isotopes has been studied. The double differential cross sections have been measured at the laboratory angles 22{degree}, 35{degree}, 55{degree}, 72{degree}, 90{degree}, 105{degree}, 120{degree}, 138{degree}, 155{degree} and from 20 MeV kinetic energy up to the kinematical limit. Features of the double differential cross sections relative to the two targets are discussed and compared to results obtained at higher incident energies.

  14. ACCUMULATION OF POLYHYDROXYALKANOIC ACIDS BY AZOTOBACTER CHROOCOCCUM MAL-201 FROM ORGANIC WASTE

    OpenAIRE

    Soma Pal Saha; A. Patra; P. B. Ghosh; A.K. Paul

    2013-01-01

    Azotobacter chroococcum MAL-201 (MTCC 3853), a free-living nitrogen-fixing bacterium accumulated intracellular poly(3-hydroxybutyric acid) [P(3HB)] accounting 69% of cell dry weight (CDW) when grown in nitrogrn-free Stockdale medium containing 2% (w/v) glucose. It also produced copolymer of poly(3-hydroxybutyrate co-3-hydroxyvalerate) [P(3HB-co-3HV)] using glucose as primary carbon source and valerate cas cosubstrate. To make the polymer production cost effective four types of waste material ...

  15. 饲用甜菜新品种——中饲甜201

    Institute of Scientific and Technical Information of China (English)

    王红旗; 郭爱华; 李红侠

    2007-01-01

    高生产力饲用甜菜(Beta vulgaris var.macrorhiza L.亦称Fodder beet)新品种——中饲甜201是中国农业科学院甜菜研究所和黑龙江大学农学院共同选育的.于2005年11月通过全国牧草饲料作物品种审定委员会的评议审定,正式命名推广.

  16. Development of moving target detection algorithm using ADSP TS201 DSP Processor

    Directory of Open Access Journals (Sweden)

    Babu rao Kodavati

    2010-08-01

    Full Text Available This paper presents detect the presence of a target within a specified range(2 to 30m. The present work generally relates to a radar system and more particularly, to improve range resolution (3 m and minimum detection time (2 msec. Speed and accuracy are two important evaluation indicators in target detecting system. The challenges in developing the algorithm is finding the Doppler frequency and give caution signal to chief at an optimum instant of time to cause target kill. Time management serves to maintain a priority queue of all the tasks. In this work we have taken up issue of developing an algorithm using ADSP TS 201 DSP Processor.

  17. LPIC-2 Linux Professional Institute Certification Study Guide Exams 201 and 202

    CERN Document Server

    Smith, Roderick W

    2011-01-01

    The first book to cover the LPIC-2 certification Linux allows developers to update source code freely, making it an excellent, low-cost, secure alternative to alternate, more expensive operating systems. It is for this reason that the demand for IT professionals to have an LPI certification is so strong. This study guide provides unparalleled coverage of the LPIC-2 objectives for exams 201 and 202. Clear and concise coverage examines all Linux administration topics while practical, real-world examples enhance your learning process. On the CD, you'll find the Sybex Test Engine, electronic flash

  18. TigerSHARC Ts201中Cache的原理及应用

    Institute of Scientific and Technical Information of China (English)

    刘学; 李少谦

    2005-01-01

    本文详细论述了TigerSHARC Ts201中cache的结构和运行原理,并给出了在DSP复位后对cache进行初始化和打开cache使其处于工作状态的汇编程序,最后通过常用的FFT程序使用cache前后DSP所消耗的时间显示了cache在提高DSP性能方面起到的重要作用。

  19. Activity determination of a {sup 201}Tl solution by 4πβ-γ and sum-peak coincidence methods

    Energy Technology Data Exchange (ETDEWEB)

    Ruzzarin, Anelise; Lopes, Ricardo Tadeu, E-mail: aruzzarin@nuclear.ufrj.br [Coordenacao dos Cursos de Pos-Graduacao em Engenharia (LIN/PEN/COPPE/UFRJ), RJ (Brazil). Programa de Engenharia Nuclear. Lab. de Instrumentacao Nuclear; Silva, Monica A. L. da [Comissao Nacional de Energia Nuclear (CNEN), Rio de Janeiro, RJ (Brazil); Iwahara, Akira; Silva, Ronaldo L. da; Filho, Octavio L.T.; Poledna, Roberto [Instituto de Radioprotecao e Dosimetria (LNMRI/IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Lab. Nacional de Metrologia das Radiacoes Ionizantes

    2015-07-01

    {sup 201}Tl is used in nuclear medicine in cardiac imaging for evaluating the injury level in cardiac muscle at rest and exercise. In this work the activity concentration of a {sup 201}Tl radioactive solution has been absolutely determined using the 4πβ-γ coincidence and sum-peak coincidence methods. The presence of {sup 202}Tl radioactive impurity that imposes some difficult in the activity measurements was taken into account in the measurements. In the sum-peak method a planar germanium detector was used. The half-lives were evaluated by the reference source method and the results obtained were (3.033 ± 0.004) d and (12.320 ± 0.163) d, respectively, for {sup 201}Tl and {sup 202}Tl. (author)

  20. Pharmacological profile of the abeorphine 201-678, a potent orally active and long lasting dopamine agonist

    Energy Technology Data Exchange (ETDEWEB)

    Jaton, A.L.; Giger, R.K.A.; Vigouret, J.M.; Enz, A.; Frick, W.; Closse, A.; Markstein, R.

    1986-01-13

    The central dopaminergic effects of an abeorphine derivative 201-678 were compared to those of apomorphine and bromocriptine in different model systems. After oral administration, this compound induced contralateral turning in rats with 6-hydroxydopamine induced nigral lesions and exhibited strong anti-akinetic properties in rats with 6-hydroxydopamine induced hypothalamic lesions. It decreased dopamine metabolism in striatum and cortex, but did not modify noradrenaline and serotonin metabolism in the rat brain. 201-678 counteracted the in vivo increase of tyrosine hydroxylase activity induced by ..gamma..-butyrolactone. In vitro it stimulated DA-sensitive adenylate cyclase and inhibited acetylcholine release from rat striatal slices. This compound had high affinity for /sup 3/H-dopamine and /sup 3/H-clonidine binding sites. These results indicate that 201-678 is a potent, orally active dopamine agonist with a long duration of action. Furthermore it appears more selective than other dopaminergic drugs. 29 references, 5 figures, 3 tables.

  1. A case of thymoma misdiagnosed ad parathyroid adenoma on Tc-99m pertechnetate/Tl-201 subtraction scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Yong An; Yoo, Ie Ryung; Kim, Sung Hoon; Chung, Soo Kyo; Wang, Young Pil; Jung, Ji Han; Lee, Kyo Young; Kim, Byung Kee [The Catholic University of Korea, Seoul (Korea, Republic of)

    2001-08-01

    A large superior mediastinal mass was found incidentally by ultrasonography in a 60-year-old man. There was an abnormal accumulation of 71-201 in the lower pole of left thyroid gland, extending into left superior mediastinum on Tc-99m pertechnetate/Tl-201 subtraction scan. Laboratory findings relating thyroid and parathyroid were all within normal range. We considered the mass as a non-functioning parathyroid adenoma tentatively. However, subsequent surgery and pathologic examination revealed the mass to be a benign mixed thymoma. We report a case of patient with thymoma showing unusual Tc-99m pertechnetate/Tl-201 subtraction imaging and laboratory findings, and suggest to consider the possibility of other mediastinal tumors rather than parathyroid adenoma.

  2. Activity determination of a 201Tl solution by 4πβ-γ and sum-peak coincidence methods

    International Nuclear Information System (INIS)

    201Tl is used in nuclear medicine in cardiac imaging for evaluating the injury level in cardiac muscle at rest and exercise. In this work the activity concentration of a 201Tl radioactive solution has been absolutely determined using the 4πβ-γ coincidence and sum-peak coincidence methods. The presence of 202Tl radioactive impurity that imposes some difficult in the activity measurements was taken into account in the measurements. In the sum-peak method a planar germanium detector was used. The half-lives were evaluated by the reference source method and the results obtained were (3.033 ± 0.004) d and (12.320 ± 0.163) d, respectively, for 201Tl and 202Tl. (author)

  3. Complete Genome Sequence of a Gluconacetobacter hansenii ATCC 23769 Isolate, AY201, Producer of Bacterial Cellulose and Important Model Organism for the Study of Cellulose Biosynthesis.

    Science.gov (United States)

    Pfeffer, Sarah; Mehta, Kalpa; Brown, R Malcolm

    2016-08-11

    The cellulose producer and model organism used for the study of cellulose biosynthesis, Gluconacetobacter hansenii AY201, is a variant of G. hansenii ATCC 23769. We report here the complete nucleotide sequence of G. hansenii AY201, information which may be utilized to further the research into understanding the genes necessary for cellulose biosynthesis.

  4. Complete Genome Sequence of a Gluconacetobacter hansenii ATCC 23769 Isolate, AY201, Producer of Bacterial Cellulose and Important Model Organism for the Study of Cellulose Biosynthesis

    Science.gov (United States)

    Mehta, Kalpa

    2016-01-01

    The cellulose producer and model organism used for the study of cellulose biosynthesis, Gluconacetobacter hansenii AY201, is a variant of G. hansenii ATCC 23769. We report here the complete nucleotide sequence of G. hansenii AY201, information which may be utilized to further the research into understanding the genes necessary for cellulose biosynthesis. PMID:27516506

  5. Complete Genome Sequence of a Gluconacetobacter hansenii ATCC 23769 Isolate, AY201, Producer of Bacterial Cellulose and Important Model Organism for the Study of Cellulose Biosynthesis.

    Science.gov (United States)

    Pfeffer, Sarah; Mehta, Kalpa; Brown, R Malcolm

    2016-01-01

    The cellulose producer and model organism used for the study of cellulose biosynthesis, Gluconacetobacter hansenii AY201, is a variant of G. hansenii ATCC 23769. We report here the complete nucleotide sequence of G. hansenii AY201, information which may be utilized to further the research into understanding the genes necessary for cellulose biosynthesis. PMID:27516506

  6. Draft Genome Sequence of a Moderately Halophilic Bacillus megaterium Strain, MSP20.1, Isolated from a Saltern of the Little Rann of Kutch, India

    Science.gov (United States)

    Dey, Rinku; Sherathia, Dharmesh; Vanpariya, Sejal; Patel, Ilaxi; Dalsania, Trupti; Savsani, Kinjal; Sukhadiya, Bhoomika; Mandaliya, Mona; Thomas, Manesh; Ghorai, Sucheta; Rupapara, Rupal; Rawal, Priya; Shah, Abhi; Bhayani, Sharmila

    2014-01-01

    The 4.37-Mbp draft genome of a moderately halophilic Bacillus megaterium strain, MSP20.1, isolated from a saltern of the Little Rann of Kutch, India, is reported here. To understand the mechanism(s) of moderate halophilism and to isolate the gene(s) involved in osmotolerance and adaptation, the genome of MSP20.1 was sequenced. PMID:24407642

  7. Inhibitory effect of bombesin and SMS 201-995 on DNA synthesis in the rat thyroid lobes incubated in vitro

    International Nuclear Information System (INIS)

    The effects of 4-h incubation in the presence of bombesin on the incorporation of [3H]-thymidine into DNA of the rat thyroid lobes, collected from animals treated in vivo with a long-acting somatostatin analog (SMS 201-995) or with 0.9% NaCl, were investigated. It was shown that not only in vivo injections of SMS 201-995, but also, unexpectedly, in vitro incubation with bombesin inhibited [3H]-thymidine incorporation. The two examined substances did not reveal any additive action in their inhibitory effects on the thyroid growth

  8. Development of [{sup 201}Tl](III)-DTPA-human polyclonal antibody complex for inflammation detection

    Energy Technology Data Exchange (ETDEWEB)

    Jalilian, A.R.; Kamali-Dehghan, M.; Kamrani, Y.Y. [Nuclear Research Center for Agriculture and Medicine, Karaj (Iran). Cyclotron and Nuclear Medicine Dept.; Khorrami, A.; Tavakoli, M.B. [Medical Sciences Univ. of Isfahan (Iran). Medical Physics and Engineering Dept.

    2007-07-01

    Thallium-201 (T{sub 1/2}=3.04 d) in Tl{sup +} form was converted to Tl{sup 3+} cation in presence of O{sub 3} in 6 M HCl controlled by RTLC/gel electrophoresis methods and used in the labeling of human polyclonal antibody (HIgG) after conjugation with freshly prepared cyclic DTPA-dianhydride. The best results of the conjugation were obtained by the addition of 1 mL of a HIgG pharmaceutical solution (5 mg/ml, in phosphate buffer, pH=7) to a glass tube pre-coated with DTPA-dianhydride (0.01 mg) at 25 C with continuous mild stirring for 30 min. The final isotonic [{sup 201}Tl](III)-DTPA-HIgG complex was checked by radio-TLC using several solvent systems to ensure the formation of only one species followed by filtration through a 0.22 {mu} filter (specific activity= 33.7 TBq/mM, radiochemical purity >95%). Preliminary bio-distribution studies in normal and inflammation-bearing rats were performed. The target/skin and target/blood ratios were 4 and 6 after 28 h respectively, showing the selectivity of the radiopharmaceutical for the inflammatory lesions. (orig.)

  9. Refurbishment plan and utilization program of educational reactor AGN-201 in Korea

    International Nuclear Information System (INIS)

    AGN-201 has been used for an educational purpose in Kyunghee University since December 1982. Because of low neutron flux level at core (about 3.0X106 /cm2-sec at rated thermal power, 0.1 watt), reactor was open only for students with a limited number of experimental courses. A refurbishing project is now on going with government support in order to increase availability of reactor for general students and researchers in Korea. There is a need of student experiments national wide, about 150 students every year for the requisite course. The main goals of refurbishing of AGN-201 are summarized as three goals. The first is to up-rate flux level by 100 times and to build an additional shielding structure. The second is to have an additional digital operating console parallel to renovated original analog console. The third is to set up various experimental courses besides reactor experiments, such as on-line digital neutron radiography and NAA

  10. Evaluation of myocardial involvement in Duchenne progressive muscular dystrophy with thallium-201 myocardial perfusion imaging

    International Nuclear Information System (INIS)

    Myocardial involvement in progressive muscular dystrophy of the Duchenne type was evaluated in 19 patients using thallium-201 myocardial perfusion imaging. The qualitative analysis was performed in anterior, 3 left anterior oblique and left lateral projection images by three experienced physicians. Distinct perfusion defects were shown in 13 patients, especially in LV posterolateral or posterior walls (11 patients). There was no significant relationship between the presence of perfusion defects and the skeletal muscle changes or thoracic deformities assessed by transmission computed tomography. Slightly increased thallium-201 activity in RV free wall and lungs was shown in nine and one patient, respectively. The extensive perfusion defects were shown in 2 patients who died of congestive heart failure 1 to 2 years after the scintigraphic study. The myocardial scintigraphic changes were considered to be minimal in 7 of 9 patients who underwent two serial scintigraphic studies in 2 to 3 years. It was concluded that the thallium myocardial perfusion imaging was a useful clinical technique to evaluate the cardiomyopathy in Duchenne progressive muscular dystrophy. (author)

  11. Evaluation of cardiomyopathy in Duchenne muscular dystrophy by Tl-201 myocardial SPECT

    International Nuclear Information System (INIS)

    Clinical evaluation of Tl-201 myocardial SPECT in patients with cardiomyopathy of Duchenne type progressive muscular dystrophy (DMD) was reported. Cases subjected to study were 14 DMD and 8 normal. Using a rotating gamma camera system (ZLC7500 and Scintipac 70A), SPECT data were collected for 16 minutes (32 angles x 30 sec/angle, 1800). The hypoperfusion areas of the left ventricular muscle were observed in 10 patients (71 %), which was in posterior wall (71 %), inferior wall (57 %), lateral and anterior wall (43 %) in the order of frequency. The hypoperfusion area became wider with age and stage, exept for some patients. It was suggested that myocardial degeneration in DMD started in posterior wall and then spread in other areas. For the purpose of quantitative evaluation of myocardial damage, Tl-201 myocardial uptake ratio (MUR) and left ventricular muscle volume (LVMV) were calculated using the results obtained by phantom studies. MUR and LVMV were higher in DMD than those of normal individuals (3.6 +- 1.0 %: 2.7 +- 0.3 %, p < 0.05, 190.2 +- 67.5 ml: 157.8 +- 21.5 ml, n.s., respectively). (author)

  12. Thallium-201: Autoradiography in pigmented mice and melanin-binding in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Tjaelve, H.; Nilsson, M.; Larsson, B. (Uppsala Univ. (Sweden))

    1982-01-01

    Autoradiography with /sup 201/Tl/sup +/ in C57Bl mice showed a strong labelling of the eye melanin and of pigmented hair follicles. An analysis of the affinity of thallium for pigment from cow eyes indicated a binding to three groups of sites and showed a marked sensitivity to the addition of H/sup +/-ions. The results are consistent with the conception that a binding of thallium occurs to the free carboxyl groups of the melanin and that the structure of the polymer has a marked influence on the affinity. Similar results have previously been obtained with other cations. There was no indication that the strong in vivo affinity of thallium to melanin is due to a more firm binding than for other cations which do not localize on melanin in vivo. Instead, the ability of cations to pass the melanocyte membranes and reach the melanin granules is probably decisive for whether a melanin-binding will take place in vivo. Toxic effects on the eye and epilation are symptoms of thallium intoxication which may be related to its melanin-binding. The fate of /sup 201/Tl/sup +/ in some other tissues is also described and discussed.

  13. Management of patients with thyroid carcinoma: Application of thallium-201 scintigraphy and magnetic resonance imaging

    Energy Technology Data Exchange (ETDEWEB)

    Burman, K.D.; Anderson, J.H.; Wartofsky, L.; Mong, D.P.; Jelinek, J.J. (Walter Reed Army Medical Center, Washington, DC (USA))

    1990-12-01

    Thyroid carcinoma has the ability to concentrate radioiodine, an attribute that can be used both for detection of thyroid cells and for treatment. Unfortunately, however, radioiodine uptake is not observed in all patients and a radioiodine scan requires that the patient be rendered hypothyroid for 4-6 wk. In the present study, we analyzed the utility of thallium-201 scanning and the usefulness of magnetic resonance imaging (MRI) in the detection of thyroid cancer. Nineteen patients with thyroid cancer had a total of 24 radioiodine scans, 33 thallium scans, and 10 MRI examinations. Of the 19 patients in the study, 17 had differentiated thyroid carcinoma. In these 17 cases, all paired studies were concordant for the presence (n = 7) or absence (n = 10) of disease. However, in one case (Patient 10), the {sup 201}Tl studies showed far more extensive disease than was observed on the {sup 131}I scan. Thyroid cancer was also detected on seven MRI studies. In summary, thallium and MRI scans are adjunctive techniques to radioiodine scanning that can either confirm the presence of neck bed activity, residual disease or metastatic cancer and may delineate tumor deposits not detected by radioiodine scanning. Thallium may be capable of detecting tumor deposits even while a patient remains euthyroid.

  14. Emission computed tomography using rotating gamma cameras for stress 201Tl myocardial imaging

    International Nuclear Information System (INIS)

    The purpose of this study is to evaluate the efficacy of emission computed tomography (ECT) for stress 201Tl myocardial imaging to localize coronary artery disease (CAD) in comparison with planar (PL) images. In a series of 14 normal subjects and 53 patients with CAD proved coronary arteriography, ECT and PL imaging were performed successively. ECT data were collected for 90 projections in a 64 x 64 matrix form with a total aquisition time of 6 munutes over 1800 of opposed dual cameras ratation and tomographic sections oriented perpendicular and parallel to the long axis of left ventricle were reconstructed. PL images were obtained for left lateral, left anterior oblique (300 and 450) and anterior projections. Both ECT and PL myocardial images were divided into 8 segments and segmental analysis was performed by visual interpretation. The ECT images remarkably increased sensitivity over the PL images in left anterior descending (LAD) artery (from 56% to 76%), right coronary artery (RCA) (from 50% to 96%), and circumflex artery (CX) (from 56% to 69%) lesions. The specificity for ECT images, as compared with PL images, was higher in LAD (88% against 85%) but slightly lower in RCA (70% ag ainst 72%) and CX (84% against 88%). Overall accuracy, therefore, was improved in LAD (from 67% to 81%) and RCA (from 64% to 79%) but equal in CX (81%). We conclude that stress 201Tl ECT imaging result in a remarkable improvement in the localization of CAD, especially in patients with RCA lesions and multi-vessel disease. (author)

  15. Qualitative evaluation of coronary flow during anesthetic induction using thallium-201 perfusion scans

    Energy Technology Data Exchange (ETDEWEB)

    Kleinman, B.; Henkin, R.E.; Glisson, S.N.; el-Etr, A.A.; Bakhos, M.; Sullivan, H.J.; Montoya, A.; Pifarre, R.

    1986-02-01

    Qualitative distribution of coronary flow using thallium-201 perfusion scans immediately postintubation was studied in 22 patients scheduled for elective coronary artery bypass surgery. Ten patients received a thiopental (4 mg/kg) and halothane induction. Twelve patients received a fentanyl (100 micrograms/kg) induction. Baseline thallium-201 perfusion scans were performed 24 h prior to surgery. These scans were compared with the scans performed postintubation. A thallium-positive scan was accepted as evidence of relative hypoperfusion. Baseline hemodynamic and ECG data were obtained prior to induction of anesthesia. These data were compared with the data obtained postintubation. Ten patients developed postintubation thallium-perfusion scan defects (thallium-positive scan), even though there was no statistical difference between their baseline hemodynamics and hemodynamics at the time of intubation. There was no difference in the incidence of thallium-positive scans between those patients anesthetized by fentanyl and those patients anesthetized with thiopental-halothane. The authors conclude that relative hypoperfusion, and possibly ischemia, occurred in 45% of patients studied, despite stable hemodynamics, and that the incidence of these events was the same with two different anesthetic techniques.

  16. Evaluation of myocardial abnormalities in collagen diseases by thallium-201 myocardial scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Yamano, Shigeru; Kagoshima, Tadashi; Sugihara, Kiyotaka (Nara Medical Univ., Kashihara (Japan)) (and others)

    1993-12-01

    This study was performed to evaluate myocardial abnormalities in patients with collagen diseases by exercise and rest thallium-201 myocardial scintigrams. A total of 65 patients without ischemic ECG changes, consisting of 18 with systemic lupus erythematosus (SLE), 18 with polymyositis (PM), 8 with progressive systemic sclerosis (PSS), and 21 with Sjoegren's syndrome (SjS), was enrolled in this study. Reversible exercise-induced defects scintigraphically suggesting myocardial ischemia were noted in 8 cases of SLE, 4 cases of PM, 4 cases of PSS, and 3 cases of SjS. Nineteen patients had exercise-induced defects and underwent cardiac catheterization, 8 of whom had normal coronary angiograms. Fixed hypoperfusion areas were observed in one case of SLE, 6 cases of PM and 3 cases of SjS. Rest thallium-201 myocardial scintigram disclosed hypoperfusion areas which were not induced by exercise in 2 cases of SLE, 3 cases of PM, one case of PSS and 5 cases of SjS. Echocardiogram showed no significant differences in ejection fraction and % fractional shortening between the disease groups and healthy control group. These findings suggest that patients with collagen diseases have abnormalities of coronary circulation at the level of the intramural vasculature before cardiac function impairment, myocardial fibrosis and functional abnormalities at the cell membrane. (author).

  17. Evaluation of myocardial involvement in Duchenne progressive muscular dystrophy with thallium-201 myocardial perfusion imaging

    Energy Technology Data Exchange (ETDEWEB)

    Kawai, Naoki; Yamamoto, Shuhei; Okada, Mitsuhiro (Nagoya Univ. (Japan). Faculty of Medicine)

    1983-12-01

    Myocardial involvement in progressive muscular dystrophy of the Duchenne type was evaluated in 19 patients using thallium-201 myocardial perfusion imaging. The qualitative analysis was performed in anterior, 3 left anterior oblique and left lateral projection images by three experienced physicians. Distinct perfusion defects were shown in 13 patients, especially in LV posterolateral or posterior walls (11 patients). There was no significant relationship between the presence of perfusion defects and the skeletal muscle changes or thoracic deformities assessed by transmission computed tomography. Slightly increased thallium-201 activity in RV free wall and lungs was shown in nine and one patient, respectively. The extensive perfusion defects were shown in 2 patients who died of congestive heart failure 1 to 2 years after the scintigraphic study. The myocardial scintigraphic changes were considered to be minimal in 7 of 9 patients who underwent two serial scintigraphic studies in 2 to 3 years. It was concluded that the thallium myocardial perfusion imaging was a useful clinical technique to evaluate the cardiomyopathy in Duchenne progressive muscular dystrophy.

  18. 梅奇酵母XY201对冬枣采后病原真菌的抑制效果%Inhibitory Effect of Metschnikowia zizyphicola XY201 on Fungal Pathogens of Postharvest Jnjube Fruits

    Institute of Scientific and Technical Information of China (English)

    施俊凤; 薛梦林; 张晓宇; 王亮; 王春生

    2010-01-01

    本文对梅奇酵母 Metschnikowia ziryphicola XY201进行了生物量最大值培养时间、不同环境条件下的活力变化及其对冬枣采后病原真菌抑制效果的研究.结果表明,梅奇酵母 XY201菌株在NYDB培养基中培养96h后,菌体生物量达最大值3.84×100cfu/ml.XY201在20℃、4℃和0℃三个不同温度和不同介质条件下的生活力变化不同,0℃培养液菌体生活力最强,240d时菌液浓度为6.46×107cfu/ml.XY201能显著抑制冬枣采后病原菌扩展青霉 Penicillium expansum、细极链格孢 Altemaria alternata、黑曲霉 Aspergillus niger 和黑根霉Rhizopus nigricans的孢子萌发和菌丝伸长;当酵母菌浓度为5×10scfu/ml时,对病原菌的抑制率可达100%.对峙培养结果显示XY201对A.alternata生长的抑制率为42.59%.

  19. 7 CFR 201.58 - Substrata, temperature, duration of test, and certain other specific directions for testing for...

    Science.gov (United States)

    2010-01-01

    .... Editorial Note: For Federal Register citations affecting § 201.58, see the List of CFR Sections Affected... at 15 °C for 24 hrs Hemp B, T 20-30 3 7 Indiangrass, yellow P, TS 20-30 7 14 Light; KNO3 Prechill...

  20. Rules implementing Sections 201 and 210 of the Public Utility Regulatory Policies Act of 1978: a regulatory history

    Energy Technology Data Exchange (ETDEWEB)

    Danziger, R.N.; Caples, P.W.; Huning, J.R.

    1980-09-15

    An analysis is made of the rules implementing Sections 201 and 210 of the Public Utility Regulatory Policies Act of 1978 (PURPA). The act provides that utilities must purchase power from qualifying producers of electricity at nondiscriminatory rates, and it exempts private generators from virtually all state and Federal utility regulations. Most of the analysis presented is taken from the perspective of photovoltaics (PV) and solar thermal electric point-focusing distributed receivers (pfdr). It is felt, however, that the analysis is applicable both to cogeneration and other emerging technologies. Chapters presented are: The FERC Response to Oral Comments on the Proposed Rules Implementing Sections 201 and 210 of PURPA; Additional Changes Made or Not Made That Were Addressed in Other Than Oral Testimony; View on the Proposed Rules Implementing Sections 201 and 210 of PURPA; Response to Comments on the Proposed 201 and 210 Rules; and Summary Analysis of the Environmental Assessment of the Rules. Pertinent reference material is provided in the Appendices, including the text of the rules. (MCW)

  1. Quantitative comparison of technetium-99m tetrofosmin and thallium-201 images of the thyroid and abnormal parathyroid glands

    Energy Technology Data Exchange (ETDEWEB)

    Giordano, A.; Meduri, G.; Calcagni, M.L. [Catholic University of the Sacred Heart, Department of Nuclear Medicine, Roma (Italy); Marozzi, P.; Ficola, U.; Vaccaro, A. [Department of Nuclear Medicine, Cervello Hospital, Palermo (Italy); Rubini, G. [Department of Nuclear Medicine of the University, Bari (Italy); Attard, M.; Li Puma, M. [Department of Endocrinology, Cervello Hospital, Palermo (Italy); Ricci, R. [Department of Pathology, Catholic University of the Sacred Heart, Rome (Italy); Corsello, S. [Department of Endocrinology, Catholic University of the Sacred Heart, Rome (Italy)

    1999-08-01

    The aim of the study was to quantitatively compare the scintigraphic images of the thyroid and abnormal parathyroid glands obtained with technetium-99m tetrofosmin and thallium-201 in patients with hyperparathyroidism. Forty-six patients with hyperparathyroidism underwent {sup 201}Tl (74 MBq), {sup 99m}Tc-pertechnetate (74 MBq) and {sup 99m}Tc-tetrofosmin (555-740 MBq) scintigraphy in a single session. Image analysis included the computation of the thyroid/background ratio in the whole study population and the parathyroid/background ratio, parathyroid/thyroid ratio and diagnostic sensitivity in 17 patients who underwent parathyroid surgery. The pertechnetate subtraction technique was used. {sup 201}Tl and {sup 99m}Tc-tetrofosmin showed a similar thyroid/background ratio (1.79{+-}0.41 and 1.81{+-}0.47, respectively, P=NS); however, {sup 99m}Tc-tetrofosmin showed a higher parathyroid/background ratio than {sup 201}Tl (2.06{+-}0.54 vs 1.79{+-} 0.50, P=0.007). Despite the superior quality of {sup 99m}Tc-tetrofosmin images, both tracers showed identical sensitivity in detecting enlarged parathyroid glands in patients with primary hyperparathyroidism (89%) and in those with secondary hyperparathyroidism (50%). (orig.) With 2 figs., 3 tabs., 15 refs.

  2. 12 CFR 201.107 - Eligibility of demand paper for discount and as security for advances by Reserve Banks.

    Science.gov (United States)

    2010-01-01

    ... well settled as a matter of law, however, that demand paper is due and payable on the date of its issue... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Eligibility of demand paper for discount and as... (REGULATION A) Interpretations § 201.107 Eligibility of demand paper for discount and as security for...

  3. 34 CFR 403.201 - What are the State's responsibilities for developing and implementing a statewide system of core...

    Science.gov (United States)

    2010-07-01

    ... VOCATIONAL AND ADULT EDUCATION, DEPARTMENT OF EDUCATION STATE VOCATIONAL AND APPLIED TECHNOLOGY EDUCATION... Technology Education Program? § 403.201 What are the State's responsibilities for developing and implementing... 34 Education 3 2010-07-01 2010-07-01 false What are the State's responsibilities for...

  4. 40 CFR 57.705 - Contents of SIP Compliance Schedule required by § 57.201(d) (2) and (3).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Contents of SIP Compliance Schedule... Requirements § 57.705 Contents of SIP Compliance Schedule required by § 57.201(d) (2) and (3). This section applies to smelters which are required to submit a SIP Compliance Schedule as discussed below. (a)...

  5. 9 CFR 201.94 - Information as to business; furnishing of by packers, swine contractors, live poultry dealers...

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Information as to business; furnishing of by packers, swine contractors, live poultry dealers, stockyard owners, market agencies, and... STOCKYARDS ACT General § 201.94 Information as to business; furnishing of by packers, swine contractors,...

  6. [Thallium-201 myocardial perfusion imaging during adenosine-induced coronary vasodilation in patients with ischemic heart disease].

    Science.gov (United States)

    Takeishi, Y; Chiba, J; Abe, S; Ikeda, K; Tonooka, I; Komatani, A; Takahashi, K; Nakagawa, Y; Shiraishi, T; Tomoike, H

    1992-09-01

    201Tl myocardial perfusion imaging during adenosine infusion was performed in consecutive 55 patients with suspected coronary artery disease. Adenosine was infused intravenously at a rate of 0.14 mg/kg/min for 6 minutes and a dose of 111 MBq of 201Tl was administered in a separate vein at the end of third minute of infusion. Myocardial SPECT imaging was begun 5 minutes and 3 hours after the end of adenosine infusion. For evaluating the presence of perfusion defects, 2 short axis images at the basal and apical levels and a vertical long axis image at the mid left ventricle were used. The regions with decreased 201Tl uptake were assessed semi-quantitatively. Adenosine infusion caused a slight reduction in systolic blood pressure and an increase in heart rate. The rate pressure products increased slightly (9314 +/- 2377 vs. 10360 +/- 2148, p < 0.001). Chest pain (24%) and headache (13%) were the frequent side effects. The second-degree atrioventricular block was developed in 11 of 55 (20%) patients. All symptoms and hemodynamic changes were well tolerated and disappeared within 1 or 2 minutes after discontinuing adenosine infusion. The sensitivity and specificity for the detection of patients with coronary artery disease were 100% (31/31) and 88% (7/8), respectively. 201Tl myocardial imaging during adenosine infusion was considered to be safe and useful for evaluating the patients with ischemic heart disease. PMID:1453559

  7. Tl-201 myocardial SPECT in patients with Duchenne's muscular dystrophy: A long-term follow-up

    International Nuclear Information System (INIS)

    Tl-201 SPECT was used to evaluate myocardial involvement in 13 patients with Duchenne's muscular dystrophy. Serial studies of 9 patients were done at two-year intervals. The hypoperfused areas of the left ventricle became more prominent with age and severity

  8. Absorbed radiation to the nuclear medicine nurses from patients administered 201Tl and 99mTc- MIBI

    International Nuclear Information System (INIS)

    People who have administrated radiopharmaceuticals could be a source of radiation to their relatives, medical nurses, and people who have contact them. In this study, the dose rates at various distances of 5, 10,50 and 100cm from 70 patients, who were administered diagnostic amounts of 201Tl-Chloride and 99mTc-MIBI, was measured using an ionization chamber. For determination of external radiation dose to the nurses the radiations in three deferent interval times have measured. The maximum values of external dose rates of 201Tl and 99mTc- MIBI were 11.2μSv/h ±2.3 and 43.1μSv/h ±11.9 respectively at 5cm from the patients. Significant exposure from patients after injection of 99mTc-MIBI was limited on the day of administration. Departure doses rate of 201Tl fell gradually so by 3 days after administration was significant. Maximum and average absorbed dose of nuclear medicine staff for one 201Tl scan was 4.6 and 2.7μSv/h, and for 99mTc-MIBI was 18.1 and 9.8μSv/h in a working day. (author)

  9. Characterization of Pseudomonas chlororaphis myovirus 201φ2-1 via genomic sequencing, mass spectrometry, and electron microscopy

    International Nuclear Information System (INIS)

    Pseudomonas chlororaphis phage 201φ2-1 is a relative of Pseudomonas aeruginosa myovirus φKZ. Phage 201φ2-1 was examined by complete genomic sequencing (316,674 bp), by a comprehensive mass spectrometry survey of its virion proteins and by electron microscopy. Seventy-six proteins, of which at least 69 have homologues in φKZ, were identified by mass spectrometry. Eight proteins, in addition to the major head, tail sheath and tail tube proteins, are abundant in the virion. Electron microscopy of 201φ2-1 revealed a multitude of long, fine fibers apparently decorating the tail sheath protein. Among the less abundant virion proteins are three homologues to RNA polymerase β or β' subunits. Comparison between the genomes of 201φ2-1 and φKZ revealed substantial conservation of the genome plan, and a large region with an especially high rate of gene replacement. The φKZ-like phages exhibited a two-fold higher rate of divergence than for T4-like phages or host genomes

  10. 21 CFR 201.57 - Specific requirements on content and format of labeling for human prescription drug and...

    Science.gov (United States)

    2010-04-01

    ..., and Cosmetic Act (the act) or, for biological products, the proper name (as defined in § 600.3 of this... may be required by FDA in accordance with sections 201(n) and 502(a) of the act if the drug is... situation, e.g., for a sedating drug, it could be stated that: Sedating drugs may cause confusion and...

  11. 75 FR 27372 - University of New Mexico; University of New Mexico AGN-201M Reactor; Environmental Assessment and...

    Science.gov (United States)

    2010-05-14

    ... reactor is housed in the Nuclear Energy Laboratory (NEL) located near the southwest corner of the..., dispersed in a polyethylene matrix. The reactor core consists of nine fuel discs that are separated at the...-tight aluminum cylindrical tank. The AGN-201M reactor has two safety rods, one coarse control rod,...

  12. 21 CFR 201.308 - Ipecac syrup; warnings and directions for use for over-the-counter sale.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Ipecac syrup; warnings and directions for use for... Specific Drug Products § 201.308 Ipecac syrup; warnings and directions for use for over-the-counter sale... poisonings, ipecac syrup is considered the emetic of choice. The immediate availability of this drug for...

  13. 37 CFR 201.18 - Notice of intention to obtain a compulsory license for making and distributing phonorecords of...

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Notice of intention to obtain... AND PROCEDURES GENERAL PROVISIONS § 201.18 Notice of intention to obtain a compulsory license for... Intention” is a Notice identified in section 115(b) of title 17 of the United States Code, and required...

  14. Mental Disorders Top The List Of The Most Costly Conditions In The United States: $201 Billion.

    Science.gov (United States)

    Roehrig, Charles

    2016-06-01

    Estimates of annual health spending for a comprehensive set of medical conditions are presented for the entire US population and with totals benchmarked to the National Health Expenditure Accounts. In 2013 mental disorders topped the list of most costly conditions, with spending at $201 billion. PMID:27193027

  15. 7 CFR 201.29a - Germination of vegetable seed in containers of more than 1 pound.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination of vegetable seed in containers of more... AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Vegetable Seeds § 201.29a Germination of vegetable seed in containers of more than 1 pound. Each variety of vegetable seeds...

  16. Discovery of ODM-201, a new-generation androgen receptor inhibitor targeting resistance mechanisms to androgen signaling-directed prostate cancer therapies.

    Science.gov (United States)

    Moilanen, Anu-Maarit; Riikonen, Reetta; Oksala, Riikka; Ravanti, Laura; Aho, Eija; Wohlfahrt, Gerd; Nykänen, Pirjo S; Törmäkangas, Olli P; Palvimo, Jorma J; Kallio, Pekka J

    2015-07-03

    Activation of androgen receptor (AR) is crucial for prostate cancer growth. Remarkably, also castration-resistant prostate cancer (CRPC) is dependent on functional AR, and several mechanisms have been proposed to explain the addiction. Known causes of CRPC include gene amplification and overexpression as well as point mutations of AR. We report here the pharmacological profile of ODM-201, a novel AR inhibitor that showed significant antitumor activity and a favorable safety profile in phase 1/2 studies in men with CRPC. ODM-201 is a full and high-affinity AR antagonist that, similar to second-generation antiandrogens enzalutamide and ARN-509, inhibits testosterone-induced nuclear translocation of AR. Importantly, ODM-201 also blocks the activity of the tested mutant ARs arising in response to antiandrogen therapies, including the F876L mutation that confers resistance to enzalutamide and ARN-509. In addition, ODM-201 reduces the growth of AR-overexpressing VCaP prostate cancer cells both in vitro and in a castration-resistant VCaP xenograft model. In contrast to other antiandrogens, ODM-201 shows negligible brain penetrance and does not increase serum testosterone levels in mice. In conclusion, ODM-201 is a potent AR inhibitor that overcomes resistance to AR-targeted therapies by antagonizing both overexpressed and mutated ARs. ODM-201 is currently in a phase 3 trial in CRPC.

  17. Combined 201Tl and 67Ga brain SPECT in patients with suspected central nervous system lymphoma or germinoma. Clinical and economic value

    International Nuclear Information System (INIS)

    Surgical resection is costly and an unfavorable prognostic factor for primary central nervous system (CNS) lymphoma and germinoma patients. The purpose of this study was to assess the diagnostic and economic impact of combined 201Tl and 67Ga brain SPECT on the management of patients suspected of having CNS lymphoma or germinoma. Sequential 201Tl and 67Ga brain SPECT was performed in 40 patients with cranial tumors to assess the diagnostic and economic impact of combined 201Tl and 67Ga SPECT on the management of patients suspected of having CNS lymphoma or germinoma. All intracranial masses were pathologically confirmed. The final diagnoses of a total of 47 foci were: 11 non-Hodgkin's lymphomas in 10 patients, 3 germinomas in 2 patients, 10 glioblastomas in 9 patients, 10 cerebral metastases in 8 patients, 13 meningiomas in 11 patients. Decision-tree sensitivity analysis for pretest probability regarding expected cost saving was performed for introduction of the combined study. All but one focus of CNS lymphomas or germinomas (92.9%, 13/14) exhibited more intense uptake of 67Ga than of 201Tl (p201Tl than of 67Ga (p67Ga-positive and 201Tl-positive pattern with more intense uptake of 67Ga than 201Tl probably suggests CNS lymphoma or germinoma. This combination study appears to be cost-effective only in patients highly suspected of having CNS lymphoma or germinoma. (author)

  18. Improvement of myocardial perfusion detected by 201Tl scintigraphy on cardiac rehabilitation for patients with coronary artery disease

    International Nuclear Information System (INIS)

    The effect of cardiac rehabilitation (mean 70±48 months) on myocardial perfusion was assessed using thallium-201 (201Tl) exercise study in 63 patients with coronary artery disease (CAD). Subjects were those in a rehabilitation group (Rh=42) participating in supervised sports training two to three times per week and the control group (Ct=21) not taking active daily exercise. The interval between two 201Tl SPECT studies was 19±16 months. After physical training, total duration of the exercise test increased from 443±112 to 536±121 seconds (+19%) in the Rh group, and from 484±129 to 432±115 seconds in the Ct group (-10.7%) (p2 to 269.8±58 x 102 in the Rh group and decreased from 218.7±40 x 102 to 216.6±76 x 102 (p201Tl myocardial perfusion defect on exercise improved more in 54.8% (stress 59.5%, rest 35.7%) in the Rh group than in the Ct group (9.5%, p201Tl perfusion defect decreased from 68 (23.1%) to 49 regions (16.7%) of 294 total myocardial regions in the Rh group on exercise. However. it increased from 39 (26.5%) to 44 (29.9%) regions of 147 regions in the Ct group (p<0.01). Thus, cardiac rehabilitation increases exercise tolerance with improvement of myocardial perfusion. suggesting that cardiac rehabilitation is an advisable and effective treatment for patients with ischemic heart disease. (author)

  19. Ability of dipyridamole-thallium-201 imaging one to four days after acute myocardial infarction to predict in-hospital and late recurrent myocardial ischemic events

    Energy Technology Data Exchange (ETDEWEB)

    Brown, K.A.; O' Meara, J.; Chambers, C.E.; Plante, D.A. (Univ. of Vermont College of Medicine, Burlington (USA))

    1990-01-15

    The ability of dipyridamole-thallium-201 imaging to predict in-hospital and late cardiac events when performed very early (62 +/- 21 hours, range 23 to 102) after acute myocardial infarction (AMI) was tested in 50 patients. During hospitalization, 1 patient developed recurrent AMI and 8 patients developed recurrent angina after MI associated with ST-segment depression at 60 +/- 42 hours after the dipyridamole-thallium-201 imaging; of these, 6 required urgent coronary revascularization. No patient died in-hospital. There were no serious adverse effects during the dipyridamole protocol. Using stepwise multivariate logistic regression analysis, the best and only statistically significant predictor of in-hospital ischemic cardiac events was the presence of thallium-201 redistribution within the infarct zone (p = 0.0001). Of 20 patients with infarct zone thallium-201 redistribution, 9 (45%) developed in-hospital ischemic cardiac events compared to 0 of 30 patients without infarct zone thallium-201 redistribution (p less than 0.0001). During a follow-up 12 +/- 7 months after discharge, 3 additional patients with infarct zone thallium-201 redistribution developed recurrent AMI or unstable angina, whereas no patient without infarct zone thallium-201 redistribution developed ischemic cardiac events. These data suggest that dipyridamole-thallium-201 imaging performed very early after AMI may identify a subgroup of patients at high risk for in-hospital and late ischemic cardiac events. Such patients may benefit from early cardiac catheterization and revascularization. Patients without infarct zone thallium-201 redistribution appear to be at very low risk for in-hospital and late ischemic cardiac events and may be candidates for early discharge.

  20. Comparison of positron tomography and scintigraphy with 201Tl for delineation of the myocardium

    International Nuclear Information System (INIS)

    Recent advances in nuclear medicine instrumentation have led to the development of improved positron-imaging systems which exceed in performance the earlier systems which were limited mainly by low count rate capability. This has led to renewed interest in positron imaging in general, primarily because such devices offer better resolution and higher sensitivity than conventional, mechanically collimated gamma cameras, as well as tomographic capability which may provide additional and more accurate information for the clinician. Furthermore, the unique capabilities of positrons for use in reconstructive imaging are beginning to be exploited. In the present report, results are presented from a preliminary study in which longitudinal tomographic myocardial images, produced with 81Rb as the positron-emitting label using the double camera coincidence system are compared with conventional myocardial images obtained with 201Tl and a gamma camera