WorldWideScience

Sample records for astatine 201

  1. Organic chemistry of astatine

    International Nuclear Information System (INIS)

    The paper surveys the investigations on the chemical behaviour of astatine in organic systems and deals with the preparation and identification of its organic compounds. A discussion is given on some of the physico-chemical properties of these compounds determined by extrapolation techniques as well as by direct measurement. The biomedical importance of 211At-labelled compounds is briefly referred to. (authors)

  2. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  3. Astatine-211: production and availability.

    Science.gov (United States)

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  4. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211At species, 211At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  5. Dosimetrical considerations in astatine-211 radioimmunotherapy

    International Nuclear Information System (INIS)

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  6. Discovery of the astatine, radon, francium, and radium isotopes

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    International Nuclear Information System (INIS)

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  8. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    International Nuclear Information System (INIS)

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  9. Scrutinizing "Invisible" astatine: A challenge for modern density functionals.

    Science.gov (United States)

    Sergentu, Dumitru-Claudiu; David, Grégoire; Montavon, Gilles; Maurice, Rémi; Galland, Nicolas

    2016-06-01

    The main-group 6p elements did not receive much attention in the development of recent density functionals. In many cases it is still difficult to choose among the modern ones a relevant functional for various applications. Here, we illustrate the case of astatine species (At, Z = 85) and we report the first, and quite complete, benchmark study on several properties concerning such species. Insights on geometries, transition energies and thermodynamic properties of a set of 19 astatine species, for which reference experimental or theoretical data has been reported, are obtained with relativistic (two-component) density functional theory calculations. An extensive set of widely used functionals is employed. The hybrid meta-generalized gradient approximation (meta-GGA) PW6B95 functional is overall the best choice. It is worth noting that the range-separated HSE06 functional as well as the old and very popular B3LYP and PBE0 hybrid-GGAs appear to perform quite well too. Moreover, we found that astatine chemistry in solution can accurately be predicted using implicit solvent models, provided that specific parameters are used to build At cavities. © 2016 Wiley Periodicals, Inc. PMID:27059181

  10. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  11. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates.

    Science.gov (United States)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Svedhem, Sofia; Lindegren, Sture

    2016-03-16

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single cancer cells. A promising radioactive nuclide for this type of therapy is astatine-211. Astatine-211 attached to tumor-specific antibodies as carrier molecules is a system currently under investigation for use in targeted alpha therapy. In the common radiolabeling procedure, astatine is coupled to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies. PMID:26791409

  12. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    International Nuclear Information System (INIS)

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  13. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    OpenAIRE

    Rothe, S.; A. N. Andreyev; Antalic, S; Borschevsky, A.; Capponi, L.; Cocolios, T.E.; Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the io...

  14. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    Science.gov (United States)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-07-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and physical properties for use in targeted therapies for cancer. Due to the very short range of the emitted α-particles, this therapy is particularly suited to treating occult, disseminated cancers. Astatine is not intrinsically tumour-specific; therefore, it requires an appropriate tumour-specific targeting vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method that combines dry distillation of astatine-211 and a synthesis module for producing radiopharmaceuticals into a process platform. This platform will standardize production of astatinated radiopharmaceuticals, and hence, it will facilitate large clinical studies focused on this promising, but chemically challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies.

  15. PSY 201 Uop Material - psy201dotcom

    OpenAIRE

    honey

    2015-01-01

    PSY 201 Entire Course New For more course tutorials visit www.psy201.com   PSY 201 Week 1 Assignment Perspectives of Psychology PSY 201 Week 1 DQ 1 and DQ 2 PSY 201 Week 2 Quiz PSY 201 Week 2 Assignment Structure and Functions of the Brain PSY 201 Week 2 DQ 1 and DQ 2 PSY 201 Week 3 Assignment Developmental Stages Matrix PSY 201 Week 3 Assignment Nature, Nurture, or an Interaction? PSY 201 Week 3 DQ 1 and DQ 2 PSY 201 Week 4 Assignment Dev...

  16. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom; Jensen, Holger; Palm, Stig; Lindegren, Sture

    2015-01-01

    vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method......To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical and...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  17. Study of Astatine (III) reactions with O, S and N ligands in solution

    International Nuclear Information System (INIS)

    Full text of publication follows. Astatine (At, Z=85: [Xe]4f145d106s26p5) belongs to the halogen group and is located below iodine in the periodic table. One of its isotopes (211At) appears promising as a therapeutic agent in nuclear medicine (Ref.1) owing to the energy of the alpha particles emitted during the disintegration of its nucleus and its short physical half-life (7.2 h). Since there are no stable isotopes of astatine, the chemistry of this element remains poorly understood. Generally, At is supposed to behave as a halogen (Ref.2) but it has been shown recently in our group that astatine presents a metallic behaviour in aqueous solution: it notably exists as At+ and AtO+ species under the oxidation states +I and +III (Ref.3). At the present time, the number of studies dealing with the complexation properties of the cationic forms of astatine remains limited (Ref.4), owing to its low availability. In this work, we have investigated the reactions of AtO+ species with different hetero-atomic (N, S, O) model ligands. A combined approach based on experimental and theoretical studies has been used (Ref.5). On account of the difficulties of experimental investigations of astatine species, the reactivity of AtO+ was explored using a competition method founded on astatine distributions between two distinct phases. Furthermore, for each AtO+/ ligand complex, the nature of the species formed and the associated thermodynamic constants were determined by computational modeling (DFT calculations). In this framework, an original computational methodology was developed to take into account the specificities of astatine, notably the associated relativistic effects. The computed equilibrium constants have been confronted with the experimental results. This comparison demonstrates an outstanding coherence between experience and theory. Furthermore, the analysis of the results shows a key role of solvent effects on astatine chemistry. Lastly, a specific reactivity for the

  18. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments (209At, 210At, 211At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  19. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    International Nuclear Information System (INIS)

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  20. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  1. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  2. 48 CFR 201.201 - Maintenance of the FAR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Maintenance of the FAR. 201.201 Section 201.201 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... the FAR....

  3. Labelling prospects of astatine-211 with immunoglobulins (IgG): some general considerations

    International Nuclear Information System (INIS)

    The tumour therapeutic potential of the short lived alpha emitting radiohalogen 211At has been already been well recognised in the field of radioimmuno therapy. There is no evidence as such to show that astatine itself is a tumour seeking isotope. Therefore it has to be tagged to tumour seeking compound such as a drug or a protein preferably an antibody (IgG). In this communication, the labelling parameters which are required to be investigated for obtaining a stable product which could be useful as radioimmuno therapeutic agent, are described. (author). 6 refs

  4. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron anity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photodetachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral linewidth of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in o-line tests by the clear observation of the photodetachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148 [1].

  5. Extraction of 211At-astatine from hydrochloric acid solutions by means of TOPO, TBP, and triphenylphosphine

    International Nuclear Information System (INIS)

    The extraction behaviour of astatine was studied under defined conditions from hydrochloride acid solutions (cHCl>0.1 M or 1 and 2M). Therefore other effects like adsorption, reduction or hydrolysis can be excluded. The present work describes the extraction with tri- n- octylphosphinoxide (TOPO), tri- n-butylphosphate (TBP) and tri-phenylphosphine in chloroform. (orig.)

  6. No-carrier-added astatination of N-succinimidyl-3-(tri-n-butylstannyl) benzoate (ATE) via electrophilic destannylation

    International Nuclear Information System (INIS)

    The no-carrier-added synthesis of N-succinimidyl 3-[211At]astato-benzoate from N-succinimidyl 3-(tri-n-butylstannyl)benzoate (ATE) is described. The nature of the solvent in which the 211At was isolated from the target was an important factor influencing both the radiochemical yields and the nature of the incorporated astatine activity. (orig.)

  7. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  8. Unexpected Behavior of the Heaviest Halogen Astatine in the Nucleophilic Substitution of Aryliodonium Salts.

    Science.gov (United States)

    Guérard, François; Lee, Yong-Sok; Baidoo, Kwamena; Gestin, Jean-François; Brechbiel, Martin W

    2016-08-22

    Aryliodonium salts have become precursors of choice for the synthesis of (18) F-labeled tracers for nuclear imaging. However, little is known on the reactivity of these compounds with heavy halides, that is, radioiodide and astatide, at the radiotracer scale. In the first comparative study of radiohalogenation of aryliodonium salts with (125) I(-) and (211) At(-) , initial experiments on a model compound highlight the higher reactivity of astatide compared to iodide, which could not be anticipated from the trends previously observed within the halogen series. Kinetic studies indicate a significant difference in activation energy (Ea =23.5 and 17.1 kcal mol(-1) with (125) I(-) and (211) At(-) , respectively). Quantum chemical calculations suggest that astatination occurs via the monomeric form of an iodonium complex whereas iodination occurs via a heterodimeric iodonium intermediate. The good to excellent regioselectivity of halogenation and high yields achieved with diversely substituted aryliodonium salts indicate that this class of compounds is a promising alternative to the stannane chemistry currently used for heavy radiohalogen labeling of tracers in nuclear medicine. PMID:27305065

  9. Main: SAD201 [AT Atlas

    Lifescience Database Archive (English)

    Full Text Available SAD201 SAD2 Diversification of protein structural analysis technologies by the SAIL... method Diversification of protein structural analysis technologies by the SAIL method Masatsune Kainosho Graduate School of Science, Nagoya University SAD201.csml ...

  10. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  11. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  12. Astatination of nanoparticles containing silver as possible carriers of 211At

    Czech Academy of Sciences Publication Activity Database

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  13. Process for producing thallium-201

    International Nuclear Information System (INIS)

    A storage plate of pure Pb-206 enriched up to 95% is irradiated with a 50 to 70 MeV proton beam. The plate is then dissolved in acid, and the Th-201 contained in the solution is oxydated and precipitated from the Pb solution. Traces of Pb retained in the solution are separated from the Th-201 by cation exchange, and the Th-201 is eluated using hydrochloric acid. (orig./PW)

  14. Main: PPD201 [AT Atlas

    Lifescience Database Archive (English)

    Full Text Available PPD201 PPD2 Overexpression of mammal origin membrane protein by high-density cultur...roaki Kato Graduate School of Pharmaceutical Sciences, Kyoto University Nat Protoc (2006)|Protein Expr. Purif. (2009)|Biotechnol. Prog. (1996) 17406338|8845106|18984054 PPD201.csml ...

  15. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  16. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  17. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  18. 7 CFR 201.42 - Small containers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Small containers. 201.42 Section 201.42 Agriculture... REGULATIONS Sampling in the Administration of the Act § 201.42 Small containers. In sampling seed in small containers that it is not practical to sample as required in § 201.41, a portion of one unopened container...

  19. Production of Thallium 201 for medical applications

    International Nuclear Information System (INIS)

    With the purpose of producing high purity carrier-free 201Tl, for medical use, a production and separation method was developed using the CV-28 Cyclotron of the Nuclear Engineering Institute in Rio de Janeiro, Brazil. 201Pb was produced by 24 MeV proton bombardment of natural Tl and allowed to decay to 201Tl. In the separation process the target is dissolved in HNO3, the 201Pb produced is separated by Fe(OH)3 coprecipitation, and the Fe is latter separated by anion exchange. The 201Pb is permited to decay during 32 hrs. 201Tl is then separated from remaining Pb by anion exchange. The chemical separation is done in a remote processing cell using manipulators, tongs, electric and pneumatic systems. The thick target yield of 201Pb is 1.7 mCi/μAhr. At the moment the production is restricted to 4 mCi of 201Tl for each irradiation. (Author)

  20. 21 CFR 201.70 - Calcium labeling.

    Science.gov (United States)

    2010-04-01

    ... product is more than 3.2 grams: “Ask a doctor before use if you have 1 kidney stones a calcium-restricted diet”. The warnings in §§ 201.64(c), 201.70(c), 201.71(c), and 201.72(c) may be combined, if applicable, provided the ingredients are listed in alphabetical order, e.g., a calcium or sodium restricted diet. 1...

  1. Stability and in vivo behavior of Rh[16aneS4-diol]211At complex: A potential precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Introduction: The heavy halogen 211At is of great interest for targeted radiotherapy because it decays by the emission of short-range, high-energy α-particles. However, many astatine compounds that have been synthesized are unstable in vivo, providing motivation for seeking other 211At labeling strategies. One relatively unexplored approach is to utilize prosthetic groups based on astatinated rhodium (III) complex stabilized with a tetrathioether macrocyclic ligand – Rh[16aneS4-diol]211At. The purpose of the current study was to evaluate the in vitro and in vivo stability of this complex in comparison to its iodine analog – Rh[16aneS4-diol]131I. Methods: Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I complexes were synthesized and purified by HPLC. The stability of both complexes was evaluated in vitro by incubation in phosphate-buffered saline (PBS) and human serum at different temperatures. The in vivo behavior of the two radiohalogenated complexes was assessed by a paired-label biodistribution study in normal Balb/c mice. Results: Both complexes were synthesized in high yield and purity. Almost no degradation was observed for Rh[16aneS4-diol]131I in PBS over a 72 h incubation. The astatinated analog exhibited good stability in PBS over 14 h. A slow decline in the percentage of intact complex was observed for both tracers in human serum. In the biodistribution study, retention of 211At in most tissues was higher than that of 131I at all time points, especially in spleen and lungs. Renal clearance of Rh[16aneS4-diol]211At and Rh[16aneS4-diol]131I predominated, with 84.1 ± 2.3% and 94.6 ± 0.9% of injected dose excreted via the urine at 4 h. Conclusions: The Rh[16aneS4-diol]211At complex might be useful for constructing prosthetic groups for the astatination of biomolecules and further studies are planned to evaluate this possibility

  2. 17 CFR 201.57 - Commission review.

    Science.gov (United States)

    2010-04-01

    ... Regulations Pertaining to the Equal Access to Justice Act § 201.57 Commission review. In accordance with the procedures set forth in 17 CFR 201.410 and 201.411, either the applicant or counsel for the Office or... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Commission review....

  3. 17 CFR 201.58 - Judicial review.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Judicial review. 201.58 Section 201.58 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Regulations Pertaining to the Equal Access to Justice Act § 201.58 Judicial review. Judicial review of...

  4. 48 CFR 1519.201 - Policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Policy. 1519.201 Section 1519.201 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 1519.201 Policy. Each program's Assistant or Associate...

  5. 48 CFR 1834.201 - Policy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Policy. 1834.201 Section 1834.201 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPECIAL CATEGORIES OF CONTRACTING MAJOR SYSTEM ACQUISITION Earned Value Management System 1834.201 Policy....

  6. 23 CFR 620.201 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Purpose. 620.201 Section 620.201 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION ENGINEERING AND TRAFFIC OPERATIONS ENGINEERING Relinquishment of Highway Facilities § 620.201 Purpose. To prescribe Federal Highway Administration...

  7. 31 CFR 800.201 - Business day.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Business day. 800.201 Section 800.201 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.201 Business day. The term business day means Monday through...

  8. 17 CFR 201.104 - Business hours.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Business hours. 201.104 Section 201.104 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice General Rules § 201.104 Business hours. The Headquarters office of the Commission,...

  9. 7 CFR 201.21 - Hard seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seed. 201.21 Section 201.21 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.21 Hard seed. The label shall show the percentage of hard...

  10. 7 CFR 201.30 - Hard seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seed. 201.30 Section 201.30 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Vegetable Seeds § 201.30 Hard seed. The label shall show the percentage of hard seed,...

  11. 7 CFR 201.50 - Weed seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seed. 201.50 Section 201.50 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.50 Weed seed. Seeds (including bulblets...

  12. 40 CFR 240.201-1 - Requirement.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirement. 240.201-1 Section 240.201-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.201-1...

  13. 40 CFR 201.22 - Measurement instrumentation.

    Science.gov (United States)

    2010-07-01

    ...) Instrument Measurement section Source Decibels 1 201.24 Locomotives 0 Rail cars 0 Locomotive load cell test stand 0 201.26 Retarder 4 Car coupling 2 201.27 Locomotive load cell test stand 0 Stationary locomotive... system that meets, as a minimum, all the requirements of American National Standard S1.4-1971 1 for...

  14. 5 CFR 353.201 - Introduction.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Introduction. 353.201 Section 353.201... UNIFORMED SERVICE OR COMPENSABLE INJURY Uniformed Service § 353.201 Introduction. The Uniformed Services... Rights law, made the Department of Labor responsible for investigating employee complaints, required...

  15. 7 CFR 201.19 - Inert matter.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Inert matter. 201.19 Section 201.19 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.19 Inert matter. The label shall show the percentage by weight of inert matter....

  16. 5 CFR 300.201 - Examinations.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Examinations. 300.201 Section 300.201...) Examinations and Related Subjects § 300.201 Examinations. (a) The Office makes available information that will... examinations. This includes the types of questions and the categories of knowledge or skill pertinent to...

  17. 28 CFR 31.201 - Audit.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Audit. 31.201 Section 31.201 Judicial Administration DEPARTMENT OF JUSTICE OJJDP GRANT PROGRAMS Formula Grants General Requirements § 31.201 Audit. The State must assure that it adheres to the audit requirements enumerated in the “Financial...

  18. 48 CFR 2131.201-5 - Credits.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Credits. 2131.201-5 Section... PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 2131.201-5 Credits. The provisions of FAR 31.201-5 shall apply to income, rebates and other credits resulting from benefit payments...

  19. 48 CFR 1631.201-70 - Credits.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Credits. 1631.201-70... AND PROCEDURES Contracts With Commercial Organizations 1631.201-70 Credits. The provisions of FAR 31.201-5 shall apply to income, rebates, allowances, and other credits resulting from benefit...

  20. 28 CFR 20.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Purpose. 20.1 Section 20.1 Judicial Administration DEPARTMENT OF JUSTICE CRIMINAL JUSTICE INFORMATION SYSTEMS General Provisions § 20.1 Purpose. It is the purpose of these regulations to assure that criminal history record information wherever...

  1. 7 CFR 201.3 - Administrator.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Administrator. 201.3 Section 201.3 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS Administration § 201.3 Administrator. The Administrator of the Agricultural Marketing Service...

  2. 7 CFR 718.201 - Farm constitution.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Farm constitution. 718.201 Section 718.201 Agriculture... Reconstitution of Farms, Allotments, Quotas, and Bases § 718.201 Farm constitution. (a) In order to implement... this section. The constitution and identification of land as a farm for the first time and...

  3. 43 CFR 20.201 - Ethics officials.

    Science.gov (United States)

    2010-10-01

    ... Department Ethics Program § 20.201 Ethics officials. (a) Designated Agency Ethics Official refers to the official designated under 5 CFR 2638.201 to coordinate and manage the Department's ethics program. (b) The... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Ethics officials. 20.201 Section...

  4. 14 CFR 1214.201 - Definition.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Definition. 1214.201 Section 1214.201... the STS Program § 1214.201 Definition. For the purpose of this subpart, the term users means: (a) For... observer nations participating in Spacelab development, and Canada, when conducting experimental science...

  5. 5 CFR 731.201 - Standard.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Standard. 731.201 Section 731.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) SUITABILITY Suitability Determinations and Actions § 731.201 Standard. The standard for a suitability...

  6. 40 CFR 243.201 - Safety.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety....

  7. 19 CFR 201.0 - Seal.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Seal. 201.0 Section 201.0 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION § 201.0 Seal. (a) Pursuant to... Trade Commission has adopted an official seal, the depiction of which follows: EC05OC91.026 (b)...

  8. 24 CFR 201.10 - Loan amounts.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Loan amounts. 201.10 Section 201.10... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.10 Loan amounts. (a)...

  9. 4 CFR 201.8 - Fees.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Fees. 201.8 Section 201.8 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.8 Fees. (a) General. The Board shall... records. Overhead expenses, such as the cost of space, heating, and lighting, are not included....

  10. 7 CFR 201.63 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.63 Section 201.63 Agriculture... REGULATIONS Tolerances § 201.63 Germination. The following tolerances are applicable to the percentage of germination and also to the sum of the germination plus the hard seed when 400 or more seeds are tested....

  11. 7 CFR 201.6 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.6 Section 201.6 Agriculture... REGULATIONS Records for Agricultural and Vegetable Seeds § 201.6 Germination. The complete record shall include the records of all laboratory tests for germination and hard seed for each lot of seed offered...

  12. 7 CFR 201.20 - Germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination. 201.20 Section 201.20 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.20 Germination. The label shall show the percentage of germination each kind, or kind and variety, or kind and type, or kind and hybrid of agricultural seed...

  13. 48 CFR 1318.201 - Contingency operation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contingency operation. 1318.201 Section 1318.201 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 1318.201...

  14. 7 CFR 201.15 - Weed seeds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation...

  15. 49 CFR 393.201 - Frames.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Frames. 393.201 Section 393.201 Transportation... SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393.201 Frames. (a) The frame or chassis of each commercial motor vehicle shall not be cracked, loose, sagging...

  16. 7 CFR 1260.201 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1260.201 Section 1260.201 Agriculture... Promotion and Research Order Reports, Books and Records § 1260.201 Reports. Each importer, person marketing... shall report to the Board periodically information required by regulations prescribed by the Board...

  17. 21 CFR 201.71 - Magnesium labeling.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Magnesium labeling. 201.71 Section 201.71 Food and... LABELING Labeling Requirements for Over-the-Counter Drugs § 201.71 Magnesium labeling. (a) The labeling of over-the-counter (OTC) drug products intended for oral ingestion shall contain the magnesium...

  18. 5 CFR 891.201 - Election.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Election. 891.201 Section 891.201... FEDERAL EMPLOYEES HEALTH BENEFITS Election and Change of Election § 891.201 Election. (a) The original period for election by each eligible retired employee was during the months of March and April...

  19. 7 CFR 97.201 - Protest proceedings.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Protest proceedings. 97.201 Section 97.201 Agriculture... PLANT VARIETY AND PROTECTION Protest Proceedings § 97.201 Protest proceedings. (a) Opposition shall be made by submitting in writing a petition for protest proceedings, which petition shall be supported...

  20. Dicty_cDB: CHR201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR201 (Link to dictyBase) - - - Contig-U16427-1 CHR201P (Link to Original site) CHR...201F 614 CHR201Z 157 CHR201P 751 - - Show CHR201 Library CH (Link to library) Clone ID CHR... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHR2-A/CHR201Q.Seq.d/ Representative seq. ID CHR...201P (Link to Original site) Representative DNA sequence >CHR201 (CHR201Q) /CSM/CH/CHR2-A/CHR2...xr*i*ric*kx Frame B: fncvivlcvyfg*ytlyiyiiq*nviffrtdfrkdgfhr*ry*ihgns*sck*irkryf*

  1. 7 CFR 201.11a - Hybrid.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hybrid. 201.11a Section 201.11a Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.11a Hybrid. If any one kind or kind and variety of seed present in excess of 5 percent is “hybrid” seed, it shall be designated “hybrid” on the label. The...

  2. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D., Scott

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  3. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    International Nuclear Information System (INIS)

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET α-emitter astatine-211 (211At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 (123I), 340-fold for technetium-99m pertechnetate (99mTcO4-) and 60-fold for 211At. Cellular 211At accumulation was found to be dependent on extracellular Na+ ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and 99mTcO4- uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated 211At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and 211At were rapidly (apparent t1/2 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times (123I), 25 times (99mTcO4-) and 10 times (211At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of 123I and 211At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for 123I, 5.2 h for 211At) and preliminary dosimetric calculations indicate high tumour absorbed doses (3.5 Gy/MBqtumour for 131I and 50.3 Gy/MBqtumour for 211At). In

  4. Study of 201Tl uptake by bone and bone marrow on 201Tl scintigraphy

    International Nuclear Information System (INIS)

    Thallium-201 (Tl-201) uptake in the bone and bone marrow was examined in a total of 93 patients with various diseases. Sternal uptake of Tl-201 was observed when patients had bone marrow abnormality especially associated with hematopoietic disease. It was associated with proliferation of immature cells and of various types of bone marrow cells, especially erythroblastic and plasma cells. Whole-body Tl-201 scanning showed a high uptake (82%) in the sternum, chest, lumbar vertebrae, and pelvis. Thallium-201 was definitively taken up by the sternum in polycythemia (5/41), hemolytic anemia (2/2), iron deficiency anemia (2/2), and multiple myeloma (2/5). For leukemia, Tl-201 uptake was slight or negative. Thallium-201 scanning proved useful in visualizing bone marrow abnormality, although careful interpretation of bone and bone marrow uptake is required. (Namekawa, K)

  5. 15 CFR 2011.201 - General.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false General. 2011.201 Section 2011.201 Commerce and Foreign Trade Regulations Relating to Foreign Trade Agreements OFFICE OF THE UNITED STATES TRADE REPRESENTATIVE ALLOCATION OF TARIFF-RATE QUOTA ON IMPORTED SUGARS, SYRUPS AND MOLASSES...

  6. 7 CFR 1430.201 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1430.201 Section 1430.201 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... Administration. (a) This program is administered under the general supervision of the Executive Vice...

  7. 7 CFR 1206.201 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Definitions. 1206.201 Section 1206.201 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE MANGO PROMOTION, RESEARCH,...

  8. 7 CFR 1219.201 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Definitions. 1219.201 Section 1219.201 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE HASS AVOCADO PROMOTION,...

  9. 27 CFR 555.201 - General.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false General. 555.201 Section 555.201 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES... prevent the recurrence of accidental explosions in which explosive materials were involved. The...

  10. Brain SPECT with Tl-201 DDC

    International Nuclear Information System (INIS)

    The development, animal and human experiments and the first clinical results of a new blood flow tracer thallium-201 diethyldithiocarbamate (Tl-201 DDC) are discussed for functional brain imaging with single-photon emission computed tomography (SPECT). 325 refs.; 43 figs.; 22 tabs

  11. 27 CFR 40.201 - Inventories.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Inventories. 40.201... PROCESSED TOBACCO Operations by Manufacturers of Tobacco Products Inventories and Reports § 40.201 Inventories. Every manufacturer of tobacco products shall make true and accurate inventories on Form...

  12. 5 CFR 179.201 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... the Office of Personnel Management (OPM) on July 3, 1984 (49 FR 27470) in 5 CFR part 550, subpart K. ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Purpose. 179.201 Section 179.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION...

  13. 48 CFR 201.170 - Peer Reviews.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Peer Reviews. 201.170... OF DEFENSE GENERAL FEDERAL ACQUISITION REGULATIONS SYSTEM Purpose, Authority, Issuance 201.170 Peer... Procurement and Acquisition Policy, will organize teams of reviewers and facilitate Peer Reviews...

  14. 48 CFR 31.201-5 - Credits.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Credits. 31.201-5 Section... REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 31.201-5 Credits. The applicable portion of any income, rebate, allowance, or other credit relating to any...

  15. 9 CFR 205.201 - System operator.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false System operator. 205.201 Section 205.201 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE CLEAR TITLE-PROTECTION FOR PURCHASERS OF FARM...

  16. 11 CFR 201.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... candidate or committee applying for or participating in the public funding process, or (2) Any ongoing audit... rulemaking, an advisory opinion request, an audit being conducted pursuant to 26 U.S.C. 9007 (a) and (b... 11 Federal Elections 1 2010-01-01 2010-01-01 false Definitions. 201.2 Section 201.2...

  17. 24 CFR 201.31 - Insurance charge.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance charge. 201.31 Section... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Insurance of Loans § 201.31 Insurance charge....

  18. 5 CFR 362.201 - Agency programs.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Agency programs. 362.201 Section 362.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PRESIDENTIAL MANAGEMENT FELLOWS... short-, medium-, and long-term senior leadership and related (senior policy, professional,...

  19. 44 CFR 201.3 - Responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Responsibilities. 201.3... HOMELAND SECURITY DISASTER ASSISTANCE MITIGATION PLANNING § 201.3 Responsibilities. (a) General. This section identifies the key responsibilities of FEMA, States, and local/tribal governments in carrying...

  20. 10 CFR 434.201 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... thermal, chemical, or electrical energy derived from direct conversion of incident solar radiation at the...: an automatic vent damper device dependent for operation exclusively upon the direct conversion of the... 10 Energy 3 2010-01-01 2010-01-01 false Definitions. 434.201 Section 434.201 Energy DEPARTMENT...

  1. 21 CFR 155.201 - Canned mushrooms.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned mushrooms. 155.201 Section 155.201 Food and... mushrooms. (a) Identity—(1) Definition. Canned mushrooms is the food properly prepared from the caps and stems of succulent mushrooms conforming to the characteristics of the species Agaricus...

  2. 29 CFR 1952.201 - Developmental schedule.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Developmental schedule. 1952.201 Section 1952.201 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... schedule. (a) Retraining of present occupational safety and health personnel during March-May 1973;...

  3. 27 CFR 24.201 - Formula required.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Formula required. 24.201... OF THE TREASURY LIQUORS WINE Production of Agricultural Wine § 24.201 Formula required. Before producing any agricultural wine, the proprietor shall obtain an approval of the formula and process by...

  4. 48 CFR 419.201-73 - Reports.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Reports. 419.201-73... SMALL BUSINESS PROGRAMS Policies 419.201-73 Reports. The Director, OSDBU, shall be responsible for submitting reports concerning USDA's progress and achievements in the procurement preference program....

  5. 5 CFR 412.201 - Management succession.

    Science.gov (United States)

    2010-01-01

    ... pursuant to 5 CFR 410.202. ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Management succession. 412.201 Section..., MANAGEMENT, AND EXECUTIVE DEVELOPMENT Succession Planning § 412.201 Management succession. The head of...

  6. 18 CFR 375.201 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Purpose. 375.201 Section 375.201 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... provisions set forth in this subpart to the extent authorized by law....

  7. 31 CFR 0.201 - Political activity.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Political activity. 0.201 Section 0... EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.201 Political activity. (a) Employees may: (1) Take an active part in political management or in political campaigns to the extent permitted by law (5...

  8. Establishment of radioactive astatine and iodine uptake in cancer cell lines expressing the human sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Petrich, T.; Helmeke, H.-J.; Meyer, G.J.; Knapp, W.H.; Poetter, E. [Department of Nuclear Medicine, Medizinische Hochschule Hannover (Germany)

    2002-07-01

    The sodium/iodide symporter (NIS) has been recognized as an attractive target for radioiodine-mediated cancer gene therapy. In this study we investigated the role of human NIS for cellular uptake of the high LET {alpha}-emitter astatine-211 ({sup 211}At) in comparison with radioiodine as a potential radionuclide for future applications. A mammalian NIS expression vector was constructed and used to generate six stable NIS-expressing cancer cell lines (three derived from thyroid carcinoma, two from colon carcinoma, one from glioblastoma). Compared with the respective control cell lines, steady state radionuclide uptake of NIS-expressing cell lines increased up to 350-fold for iodine-123 ({sup 123}I), 340-fold for technetium-99m pertechnetate ({sup 99m}TcO{sub 4}{sup -}) and 60-fold for {sup 211}At. Cellular {sup 211}At accumulation was found to be dependent on extracellular Na{sup +} ions and displayed a similar sensitivity towards sodium perchlorate inhibition as radioiodide and {sup 99m}TcO{sub 4}{sup -} uptake. Heterologous competition with unlabelled NaI decreased NIS-mediated {sup 211}At uptake to levels of NIS-negative control cells. Following uptake both radioiodide and {sup 211}At were rapidly (apparent t{sub 1/2} 3-15 min) released by the cells as determined by wash-out experiments. Data of scintigraphic tumour imaging in a xenograft nude mice model of transplanted NIS-modified thyroid cells indicated that radionuclide uptake in NIS-expressing tumours was up to 70 times ({sup 123}I), 25 times ({sup 99m}TcO{sub 4}{sup -}) and 10 times ({sup 211}At) higher than in control tumours or normal tissues except stomach (3-5 times) and thyroid gland (5-10 times). Thirty-four percent and 14% of the administered activity of {sup 123}I and {sup 211}At, respectively, was found in NIS tumours by region of interest analysis (n=2). Compared with cell culture experiments, the effective half-life in vivo was greatly prolonged (6.5 h for {sup 123}I, 5.2 h for {sup 211}At) and

  9. 22 CFR 201.51 - Methods of financing.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Methods of financing. 201.51 Section 201.51... TRANSACTIONS FINANCED BY USAID Payment and Reimbursement § 201.51 Methods of financing. Under procurements subject to this part 201, the following methods of financing may be employed by USAID In each case,...

  10. Dicty_cDB: VHO201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT

  11. 201Tl labelled myocardium tomoscanning

    International Nuclear Information System (INIS)

    A new device, the J and P Tomoscanner, enables us to obtain the transverse scintigraphic section of any organ labelled by a single photon emitting radionuclide. For the time being, this technique has been used mainly for brain and liver studies. This work explores the ability of this tomograph to furnish sections of the 201Tl labelled myocardium by comparing them with the scintillation gamma-camera images. Towards this aim, witnesses and patients with documented anterior or lateral infarctus have been studied. Our actual results show a high correlation between the two explorations. But, by means of the section, both the site and size of the necrosis are visualized. However, only a single tomographic image was obtained in each patient because of the time necessary for its retranscription on paper. In the near future, when it will be possible to perform routinely several sections, a better size estimation will be possible

  12. Excitation functions of reactions of production of radioisotopes 201Tl, 201Pb, 201Bi (experimental and theoretical data)

    International Nuclear Information System (INIS)

    The results of calculations of charged particle induced reactions for the production of neutron deficient radioisotopes 201Tl, 201Pb, 201Bi and concomitant ones are discussed. The excitation functions for reactions 202Hg(p,xn), 197Au(a,xn), 203,205Tl(p,xn), 203,205Tl(d,xn), 203,205Tl(p,pxn), 204Pb(p,xn), 204Pb(p,p3n), 206Pb(p,6n), 206Pb(p,p5n), 207Pb(p,7n), 207Pb(p,p6n), 208Pb(p,xn) and 208Pb(p,p7n) are calculated on the base of statistical model in energy range up to 80 MeV. For the most reactions producing 201Tl the data on the calculated and practical yields under optimum conditions are given and the main admixture levels are pointed out. 30 refs., 9 figs

  13. Production of thallium 201 for medical use

    International Nuclear Information System (INIS)

    An important product among the radiopharmaceuticals currently used in cardiology is T1 201 chloride, due to its nuclear-physical properties and its clinical value as a diagnostic tool. The authors explain and discuss the basic characteristics which determine the radiopharmaceutical quality of T1 201: its radiochemical purity and its chemical impurity content, which depend on the target-irradiation conditions - type of nuclear reaction, target material and design, particle energy, irradiation time - and the reprocessing technology. A production flow chart is presented which shows that ions are accelerated within a wide mass and energy range suitable for the production of T1 201 in different nuclear reactions. Cyclotron reconstruction for T1 201 production is discussed

  14. Determination of [{sup 201}Tl]Tl(III) in [{sup 201}Tl]TlCl solutions using HPLC

    Energy Technology Data Exchange (ETDEWEB)

    Akhlaghi, M. [Nuclear Medicine Group, Agriculture, Medicine and Industrial Research School (AMIRS), Nuclear Science and Technology Research Institute, Moazzen Blvd., Rajaeeshahr, P.O. Box 31485-498, Karaj (Iran, Islamic Republic of)], E-mail: makhlaghi@nrcam.org; Kamalidehghan, M.; Jalilian, A.R.; Shadanpoor, N. [Nuclear Medicine Group, Agriculture, Medicine and Industrial Research School (AMIRS), Nuclear Science and Technology Research Institute, Moazzen Blvd., Rajaeeshahr, P.O. Box 31485-498, Karaj (Iran, Islamic Republic of)

    2008-04-15

    A high-performance liquid chromatography technique has been presented to measure the [{sup 201}Tl]TlCl{sub 3} impurity in [{sup 201}Tl]TlCl radiopharmaceutical for precise determination of radiochemical purity. Diethylene tetraamine pentaacetic acid (DTPA) has been used for complete complexation of [{sup 201}Tl]Tl(III). [{sup 201}Tl]Tl(III)-DTPA was analyzed in the presence of [{sup 201}Tl]Tl(I) using a cation exchange HPLC column.

  15. Standardization and decay scheme of 201Tl

    International Nuclear Information System (INIS)

    An intercomparison exercise was conducted among three national standards laboratories and a commercial supplier to determine the degree of agreement between directly determined values of the activity concentration of a solution of 201Tl. The γ-ray emission probabilities of 201Tl were also determined, providing an emission probability for the 167.4 keV γ ray of 0.1000±0.0006. (author)

  16. Dicty_cDB: SHC201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHC201 (Link to dictyBase) - - - Contig-U16405-1 SHC201P (Link to Original ... ikyc*glyi*cfgfsilsksiqfei**ktkniw*ryshywlifk iiwws*fpy *fh*ck*tf--- ---TFIGVRSGPSTTLTYIKPMISEIPTIENKIEKGIL ...

  17. Studies on 201Th myocardial scintiscanning

    International Nuclear Information System (INIS)

    The diagnostical evidence of myocardial scintiscanning with thallium-201 was tested on 98 patients with coronary heart disease. 2 mCi thallium-201 were injected into an arm vene and then scintigrams of the heart were registered partly with a scanner, partly with a gamma camera in several views. The healthy myocardium was found in the thallium-201-scintigram to be a rather homogeneous, horeshoe-shaped activity pattern with intramyocardial activity differences of up to 20% of the maximal thallium-201-activity above the myocard which can be declared to be physiological. In dependency on the local blood flow conditions, thallium-201 is stored only in the healthy, but not in the ischaemic or infarcted myocardium. In the scintigram, these regions are seen as regions with reduced radioactivity. A comparison of the localisation of the infarction in the scintigram with those in the electrocardiagram and coronary angiogram showed a good congrucucy. Scintigrams taken at different times after the infarction brought a decrease in the number of diagnosed storage failures, from 90% to 68% in infarctions older than 6 weeks. A scintigraphical differentiation between fresh and old infarctions was not possible. In cases of angiographically established coronary heart disease without infarction, pathological storage reductions were observed. By comparing the findings obtained by scintiscanning with the results of laevocardiography it was seen that hypokinetic regions in the thallium-201-myocardial scintigram showed in only 6% of the cases a pathological storage defect; akinetic, dyskinetic, and aneurysmatic regions, however, were seen in 65% of the cases as clear activity reductions or failures. (orig./MG)

  18. 48 CFR 1427.201-2 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1427.201-2 Section 1427.201-2 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 1427.201-2 Contract...

  19. 19 CFR 201.110 - Self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Self-evaluation. 201.110 Section 201.110 Customs... Commission § 201.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies... in the self-evaluation process by submitting comments (both oral and written). (c) The agency...

  20. 9 CFR 201.17 - Requirements for filing tariffs.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Requirements for filing tariffs. 201.17 Section 201.17 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION... ACT Schedules of Rates and Charges § 201.17 Requirements for filing tariffs. (a) Schedules of...

  1. 46 CFR 201.144 - Offer of proof.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Offer of proof. 201.144 Section 201.144 Shipping... PROCEDURE Evidence (Rule 14) § 201.144 Offer of proof. An offer of proof made in connection with an... accompany the record as the offer of proof....

  2. 7 CFR 201.64 - Pure live seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Pure live seed. 201.64 Section 201.64 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.64 Pure live seed. The tolerance for pure live seed shall be determined...

  3. 7 CFR 201.24a - Inoculated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Inoculated seed. 201.24a Section 201.24a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.24a Inoculated seed. Seed claimed to be inoculated shall...

  4. 7 CFR 201.7a - Treated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Treated seed. 201.7a Section 201.7a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Records for Agricultural and Vegetable Seeds § 201.7a Treated seed. The complete record for...

  5. 7 CFR 201.47a - Seed unit.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Seed unit. 201.47a Section 201.47a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.47a Seed unit. The seed unit is...

  6. 7 CFR 201.31a - Labeling treated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Labeling treated seed. 201.31a Section 201.31a..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling in General § 201.31a Labeling treated seed. (a) Contents of label. Any agricultural...

  7. 7 CFR 201.69 - Classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Classes of certified seed. 201.69 Section 201.69..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.69 Classes of certified seed. (a) Classes of certified seed are as...

  8. 7 CFR 201.49 - Other crop seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Other crop seed. 201.49 Section 201.49 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.49 Other crop seed. (a) Seeds of...

  9. 46 CFR 108.201 - Size of sleeping spaces.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Size of sleeping spaces. 108.201 Section 108.201... AND EQUIPMENT Construction and Arrangement Accommodation Spaces § 108.201 Size of sleeping spaces. (a) No sleeping space may berth more than four persons, except that a sleeping space for personnel...

  10. 40 CFR 246.201-4 - Recommended procedures: Market study.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Market study. 246.201-4 Section 246.201-4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 246.201-4 Recommended procedures: Market study. An investigation of markets should be made for...

  11. 48 CFR 601.201 - Maintenance of the FAR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Maintenance of the FAR. 601.201 Section 601.201 Federal Acquisition Regulations System DEPARTMENT OF STATE GENERAL DEPARTMENT OF STATE ACQUISITION REGULATIONS SYSTEM Administration 601.201 Maintenance of the FAR....

  12. 48 CFR 1201.201 - Maintenance of the FAR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Maintenance of the FAR. 1201.201 Section 1201.201 Federal Acquisition Regulations System DEPARTMENT OF TRANSPORTATION GENERAL FEDERAL ACQUISITION REGULATIONS SYSTEM Administration 1201.201 Maintenance of the FAR....

  13. 48 CFR 801.201 - Maintenance of the FAR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Maintenance of the FAR. 801.201 Section 801.201 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS GENERAL DEPARTMENT OF VETERANS AFFAIRS ACQUISITION REGULATION SYSTEM Administration 801.201 Maintenance of the FAR....

  14. 48 CFR 401.201 - Maintenance of the FAR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Maintenance of the FAR. 401.201 Section 401.201 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL AGRICULTURE ACQUISITION REGULATION SYSTEM Administration 401.201 Maintenance of the FAR....

  15. 48 CFR 1.201 - Maintenance of the FAR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Maintenance of the FAR. 1.201 Section 1.201 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL FEDERAL ACQUISITION REGULATIONS SYSTEM Administration 1.201 Maintenance of the FAR....

  16. 46 CFR 201.131 - Presentation of evidence.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Presentation of evidence. 201.131 Section 201.131... PRACTICE AND PROCEDURE Hearing Procedures (Rule 13) § 201.131 Presentation of evidence. (a) Testimony... specifically encouraged to cooperate with each other in joint presentations particularly in such items as...

  17. 46 CFR 201.8 - Use of gender and number.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Use of gender and number. 201.8 Section 201.8 Shipping... PROCEDURE General Information (Rule 1) § 201.8 Use of gender and number. Words importing the singular number... the singular; and words importing the masculine gender may be applied to females....

  18. 14 CFR 1206.201 - Records which have been published.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Records which have been published. 1206.201 Section 1206.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION AVAILABILITY OF AGENCY RECORDS TO MEMBERS OF THE PUBLIC Records Available § 1206.201 Records which have been...

  19. 7 CFR 201.36c - Hermetically-sealed containers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Hermetically-sealed containers. 201.36c Section 201... ACT FEDERAL SEED ACT REGULATIONS Advertising § 201.36c Hermetically-sealed containers. The 5-month... been met: (a) The seed was packaged within 9 months after harvest; (b) The container used does...

  20. 21 CFR 201.61 - Statement of identity.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.61 Section 201.61 Food...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.61 Statement of identity. (a) The... features a statement of the identity of the commodity. (b) Such statement of identity shall be in terms...

  1. 46 CFR 201.55 - Postponement of hearing.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Postponement of hearing. 201.55 Section 201.55 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Time (Rule 5) § 201.55 Postponement of hearing. Applications for postponement of any hearing...

  2. 30 CFR 77.201 - Methane content in surface installations.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Methane content in surface installations. 77.201 Section 77.201 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL... UNDERGROUND COAL MINES Surface Installations § 77.201 Methane content in surface installations. The...

  3. 48 CFR 36.201 - Evaluation of contractor performance.

    Science.gov (United States)

    2010-10-01

    ... Contracting for Construction 36.201 Evaluation of contractor performance. See 42.1502(e) for the requirements... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Evaluation of contractor performance. 36.201 Section 36.201 Federal Acquisition Regulations System FEDERAL ACQUISITION...

  4. 48 CFR 2936.201 - Evaluation of contractor performance.

    Science.gov (United States)

    2010-10-01

    ... Construction 2936.201 Evaluation of contractor performance. The HCA must establish procedures to evaluate... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Evaluation of contractor performance. 2936.201 Section 2936.201 Federal Acquisition Regulations System DEPARTMENT OF LABOR...

  5. 48 CFR 3036.201 - Evaluation of contractor performance.

    Science.gov (United States)

    2010-10-01

    ...) 48 CFR 36.201. Access to reports is through the CPS or the government-wide system, Past Performance... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Evaluation of contractor performance. 3036.201 Section 3036.201 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND...

  6. 46 CFR 201.9 - Suspension, amendment, etc., of rules.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Suspension, amendment, etc., of rules. 201.9 Section 201.9 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE General Information (Rule 1) § 201.9 Suspension, amendment, etc.,...

  7. Thallium-201 uptake in Langerhans` cell histiocytosis of bone

    Energy Technology Data Exchange (ETDEWEB)

    Bar-Sever, Z. [Division of Nuclear Medicine, Department of Radiology, Children`s Hospital and Harvard Medical School, Boston, MA (United States); Connolly, L.P. [Division of Nuclear Medicine, Department of Radiology, Children`s Hospital and Harvard Medical School, Boston, MA (United States); Jaramillo, D. [Division of Nuclear Medicine, Department of Radiology, Children`s Hospital and Harvard Medical School, Boston, MA (United States); Treves, S.T. [Division of Nuclear Medicine, Department of Radiology, Children`s Hospital and Harvard Medical School, Boston, MA (United States)

    1996-10-01

    A case in which there was thallium-201 ({sup 201}Tl) uptake in Langerhans` cell histiocytosis (LCH) of the left femoral diaphysis is presented. The authors propose that {sup 201}Tl scintigraphy is potentially useful in the diagnosis and follow-up of patients with LCH. (orig.). With 4 figs.

  8. Thallium-201 uptake in Langerhans' cell histiocytosis of bone

    International Nuclear Information System (INIS)

    A case in which there was thallium-201 (201Tl) uptake in Langerhans' cell histiocytosis (LCH) of the left femoral diaphysis is presented. The authors propose that 201Tl scintigraphy is potentially useful in the diagnosis and follow-up of patients with LCH. (orig.). With 4 figs

  9. 46 CFR 201.117 - Inclusion in record.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part...

  10. 14 CFR 23.201 - Wings level stall.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Wings level stall. 23.201 Section 23.201... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Flight Stalls § 23.201 Wings level... airplane stalls. (b) The wings level stall characteristics must be demonstrated in flight as...

  11. 7 CFR 201.53 - Source of seeds for germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Source of seeds for germination. 201.53 Section 201.53... REGULATIONS Germination Tests in the Administration of the Act § 201.53 Source of seeds for germination. (a) When both purity and germination tests are required, seeds for germination shall be taken from...

  12. 7 CFR 201.54 - Number of seeds for germination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Number of seeds for germination. 201.54 Section 201.54... REGULATIONS Germination Tests in the Administration of the Act § 201.54 Number of seeds for germination. At least 400 seeds shall be tested for germination; except that in mixtures, 200 seeds of each of...

  13. 7 CFR 201.52 - Noxious-weed seeds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds. 201.52 Section 201.52 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.52 Noxious-weed seeds. (a) The determination of the number of seeds, bulblets, or tubers of individual noxious weeds present per unit...

  14. 9 CFR 201.72 - Scales; testing of.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Scales; testing of. 201.72 Section 201.72 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND... § 201.72 Scales; testing of. (a) Each stockyard owner, market agency, dealer, packer, or live...

  15. 7 CFR 201.43 - Size of sample.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Size of sample. 201.43 Section 201.43 Agriculture... REGULATIONS Sampling in the Administration of the Act § 201.43 Size of sample. The following are minimum sizes..., ryegrass, bromegrass, millet, flax, rape, or seeds of similar size. (c) One pound (454 grams) of...

  16. 14 CFR 1203.201 - Information security objectives.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Information security objectives. 1203.201 Section 1203.201 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INFORMATION SECURITY PROGRAM NASA Information Security Program § 1203.201 Information security objectives. The objectives...

  17. Dicty_cDB: CFJ201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ndsgnckcdtqtkgltceesrlliesldsinskggti niigyfgnttslltikigesqcknikvfnettlkcdigegkgihnitiidddlsftaink fqyldektkiskisrgaiagivvgcvvavsligs...ink fqyldektkiskisrgaiagivvgcvvavsligsiafyyhhknkkvnlsskn*nki*plg f Translated Amino Acid sequen...ces producing significant alignments: (bits) Value N AC117072 |AC117072.2 Dictyostelium di...ive seq. ID CFJ201P (Link to Original site) Representative DNA sequence >CFJ201 (CFJ201Q) /CSM/CF/CFJ2-A/CFJ...ckhkcstkhgicdndsgnckcdtqtkgltceesrlliesldsinskggti niigyfgnttslltikigesqcknikvfnettlkcdigegkgihnitiidddlsfta

  18. 21 CFR 201.6 - Drugs; misleading statements.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs; misleading statements. 201.6 Section 201.6 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING General Labeling Provisions § 201.6 Drugs; misleading statements. (a)...

  19. Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT

    Energy Technology Data Exchange (ETDEWEB)

    Tonami, N.; Matsuda, H.; Ooba, H.; Yokoyama, K.; Hisada, K.; Ikeda, K.; Yamashita, J. (Kanazawa Univ. (Japan))

    1990-06-01

    The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared.

  20. Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT

    International Nuclear Information System (INIS)

    The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared

  1. 7 CFR 1437.201 - Prevented planting acreage.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Prevented planting acreage. 1437.201 Section 1437.201... Determining Coverage for Prevented Planted Acreage § 1437.201 Prevented planting acreage. (a) In addition to... determining losses under this section: (1) Producers must be prevented from planting more than 35 percent...

  2. 5 CFR 870.201 - Types of insurance.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Types of insurance. 870.201 Section 870.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES' GROUP LIFE INSURANCE PROGRAM Types and Amount of Insurance § 870.201 Types of insurance. (a) There are two types of...

  3. 21 CFR 201.127 - Drugs; expiration of exemptions.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs; expiration of exemptions. 201.127 Section 201.127 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.127 Drugs;...

  4. 37 CFR 201.7 - Cancellation of completed registrations.

    Science.gov (United States)

    2010-07-01

    ... requirements of the law and Copyright Office regulations, and the Office is unable to get the defect corrected... registrations. 201.7 Section 201.7 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.7 Cancellation of completed registrations....

  5. 46 CFR 201.6 - Documents in foreign languages.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Documents in foreign languages. 201.6 Section 201.6... PRACTICE AND PROCEDURE General Information (Rule 1) § 201.6 Documents in foreign languages. Every document, exhibit, or other paper written in a language other than English and filed with the Administration...

  6. 46 CFR 201.20 - Attorneys at law.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Attorneys at law. 201.20 Section 201.20 Shipping... PROCEDURE Appearance and Practice Before the Administration (Rule 2) § 201.20 Attorneys at law. Attorneys at law who are admitted to practice before the Federal courts or before the courts of any State...

  7. 48 CFR 1327.201 - Patent and copyright infringement liability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Patent and copyright infringement liability. 1327.201 Section 1327.201 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 1327.201 Patent...

  8. Dicty_cDB: VHN201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available itii dddlsftainkfqyldektkiskisrgaiagivvgcvvavsligsiafyyhhknkkvifs skn Homology vs CSM-cDNA Score E Sequen...ive seq. ID VHN201P (Link to Original site) Representative DNA sequence >VHN201 (VHN201Q) /CSM/VH/VHN2-A/VHN...ngceikfieckhkcstkhgicdndsgnckcdtqtkgltceesrllies ldsinskggtiniigyfgnttslltikigesqcknikvfnettlkcdigegkgihn...ces producing significant alignments: (bits) Value VHN201 (VHN201Q) /CSM/VH/VHN2-A/V...q.d/ 1368 0.0 own update 2004.12.25 Homology vs DNA Score E Sequences producing significant alignment

  9. 7 CFR 201.51 - Inert matter.

    Science.gov (United States)

    2010-01-01

    ..., such as occur in but not limited to the following plant families: Sedge (Cyperaceae), buckwheat... devoid of the husk and pass through a 1/13th-inch, round-hole sieve. (ii) Bulblets which show evident damage to the basal end, whether husk is present or absent. Refer to § 201.50(c) for wild onion and...

  10. 48 CFR 9903.201-5 - Waiver

    Science.gov (United States)

    2010-10-01

    ...), Disclosure and Consistency of Cost Accounting Practices, with respect to a contract subject to the Cost... 9903.201-5 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING...

  11. Clinical features and applications of thallium-201

    International Nuclear Information System (INIS)

    Thallium-201 is not only used widely in myocardial imaging but also has a great potential in other various nuclear medicine imaging studies. This paper presents clinical features and applications of thallium-201, focusing on clinical trials with thallium-201 at the Shinshu University School of Medicine. Thallium-201 myocardial scintigraphy offers information on 1) ventricular position and morphology, 2) hypertrophy or dilatation of the left ventricle, 3) hypertrophy or dilatation of the right ventricle, 4) site and extent of myocardial ischemia and infarct, 5) myocardial blood flow, 6) pulmonary congestion or interstitial pulmonary edema, and 7) pericardial effusion. It can be used in the following evaluation or diagnosis: 1) acute or old myocardial infarction, 2) angina pectoris, 3) treatment strategy or prognosis of ischemic heart disease, 4) treatment strategy or observation of bypass graft or drug therapy, 5) hypertrophic or dilated idiopathic cardiomyopathy, 6) myocardial lesions induced by sarcoidosis, collagen disease, and neuro-muscular disease, 7) ventricular hypertrophy and pulmonary edema, and 9) pericarditis, pericardial effusion, and systolic pericarditis associated with underlying disease. The significance of tumor, liver, bone marrow scintigraphies is also referred to. (Namekawa, K) 69 refs

  12. Tank 241-U-201 tank characterization plan

    Energy Technology Data Exchange (ETDEWEB)

    Schreiber, R.D.

    1995-02-21

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, and WHC 22-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-U-201.

  13. 27 CFR 46.201 - General.

    Science.gov (United States)

    2010-04-01

    ... dealer must take the physical inventory or record (book) inventory not earlier than March 26, 2009 and not later than April 10, 2009. (b) Reconciliation. If the dealer takes a physical inventory on any day... Sale on April 1, 2009 Inventories § 46.201 General. (a) Date. The dealer must take an inventory...

  14. 48 CFR 18.201 - Contingency operation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contingency operation. 18... METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 18.201 Contingency operation. (a) Contingency operation is defined in 2.101. (b) Micro-purchase threshold. The...

  15. Standardization of Tl-201 radioactive solution

    International Nuclear Information System (INIS)

    The standardization of 201Tl, using the 4π(PC)-NaI(Tl) coincidence system, is presented. The disintegration rate was determined by the extrapolation technique, using two methods: electronic discrimination and external absorbers. A Monte Carlo simulation program, developed in our laboratory, which predicts the behavior of the extrapolation curve, was applied and the results were compared with experimental values. (author)

  16. 19 CFR 201.103 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... CFR 1613.702(f), which is made applicable to this part by § 201.140. Section 504 means section 504 of the Rehabilitation Act of 1973 (Pub. L. 93-112, 87 Stat. 394 (29 U.S.C. 794)), as amended by the... following body systems: Neurological; musculoskeletal; special sense organs; respiratory, including...

  17. 7 CFR 201.10 - Variety.

    Science.gov (United States)

    2010-01-01

    ...-sudangrass, Soybean; Sudangrass; Sunflower; Tobacco; Trefoil, birdsfoot; Triticale; Wheat, common; Wheat... § 201.11a. If separate percentages for the kind and the variety or hybrid are shown, the name of the kind and the name of the variety or the term “hybrid” shall be clearly associated with the...

  18. 47 CFR 25.201 - Definitions.

    Science.gov (United States)

    2010-10-01

    ..., such as the public switched telephone network (PSTN) and/or Internet networks. (2) Shall not be for the... § 25.226. Editorial Note: For Federal Register citations affecting § 25.201, see the List of CFR... communications network used in conjunction with a qualifying satellite network system authorized pursuant...

  19. 42 CFR 59.201 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR FAMILY PLANNING SERVICES Grants for Family Planning Service Training § 59.201 Applicability. The regulations in this subpart are...) to provide the training for personnel to carry out family planning service programs described...

  20. 19 CFR 201.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Miscellaneous § 201.2 Definitions. As used in this chapter— (a) Commission means the United States International Trade Commission... Act of 1930, 19 U.S.C. 1202-1677j, 1677m-n; (d) Trade Expansion Act means the Trade Expansion Act...

  1. Durable donor engraftment after radioimmunotherapy using α-emitter astatine-211-labeled anti-CD45 antibody for conditioning in allogeneic hematopoietic cell transplantation.

    Science.gov (United States)

    Chen, Yun; Kornblit, Brian; Hamlin, Donald K; Sale, George E; Santos, Erlinda B; Wilbur, D Scott; Storer, Barry E; Storb, Rainer; Sandmaier, Brenda M

    2012-02-01

    To reduce toxicity associated with external γ-beam radiation, we investigated radioimmunotherapy with an anti-CD45 mAb labeled with the α-emitter, astatine-211 ((211)At), as a conditioning regimen in dog leukocyte antigen-identical hematopoietic cell transplantation (HCT). Dose-finding studies in 6 dogs treated with 100 to 618 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) without HCT rescue demonstrated dose-dependent myelosuppression with subsequent autologous recovery, and transient liver toxicity in dogs treated with (211)At doses less than or equal to 405 μCi/kg. Higher doses of (211)At induced clinical liver failure. Subsequently, 8 dogs were conditioned with 155 to 625 μCi/kg (211)At-labeled anti-CD45 mAb (0.5 mg/kg) before HCT with dog leukocyte antigen-identical bone marrow followed by a short course of cyclosporine and mycophenolate mofetil immunosuppression. Neutropenia (1-146 cells/μL), lymphopenia (0-270 cells/μL), and thrombocytopenia (1500-6560 platelets/μL) with prompt recovery was observed. Seven dogs had long-term donor mononuclear cell chimerism (19%-58%), whereas 1 dog treated with the lowest (211)At dose (155 μCi/kg) had low donor mononuclear cell chimerism (5%). At the end of follow-up (18-53 weeks), only transient liver toxicity and no renal toxicity had been observed. In conclusion, conditioning with (211)At-labeled anti-CD45 mAb is safe and efficacious and provides a platform for future clinical trials of nonmyeloablative transplantation with radioimmunotherapy-based conditioning. PMID:22134165

  2. 7 CFR 201.26 - Kind, variety, and hybrid.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Kind, variety, and hybrid. 201.26 Section 201.26... REGULATIONS Labeling Vegetable Seeds § 201.26 Kind, variety, and hybrid. The label shall bear the name of each... kind or variety named on the label is “hybrid” seed, it shall be so designated on the label. If two...

  3. Clearance of thallium-201 from the peripheral blood: comparison of immediate and standard thallium-201 reinjection

    International Nuclear Information System (INIS)

    We investigated whether the kinetics of thallium-201 would differ between the standard stress-redistribution-reinjection approach and the stress-immediate reinjection approach. In 53 patients with undiagnosed chest pain, 75 MBq (2 mCi) 201Tl was injected at maximal exercise. In 26 patients (group I), 37 MBq (1 mCi) 201Tl was reinjected immediately after completing the exercise images and in 27 patients (group II), 37 MBq (1 mCi) 201Tl was reinjected after completing 3-h redistribution images. Mean peak 201Tl blood activity after exercise was 17.7±12.5 kBq/ml (4.8±3.4 mCi/ml) for group I versus 16.4±9.2 kBq/ml (4.4±2.5 mCi/ml) for group II (NS). The relative increase in 201Tl blood activity after reinjection of half the initial dose [37 MBq (1 mCi)] exceeded 50% of the initial peak in both groups. The relative amount of 201Tl delivered to the myocardium was assessed by the area under the curve after both exercise and reinjection, and was 117%±72% for group I and 112%±73% for group II (NS). Blood clearance of 201Tl was at least biexponential. Mean early decay constants (λ1) after exercise and reinjection were 0.30±0.18 min-1 and 0.22±0.046 min-1 resp. for group I, and 0.30±0.12 min-1 and 0.24±0.07 min-1 resp. for group II. For both procedures no significant differences were found between λ1 after exercise and λ1 after injection. The mean late clearance (λ2) from the blood was 0.032±0.056 min-1 and 0.012±0.012 min-1 resp. for group I, and 0.036±0.030 min-1 and 0.014±0.014 min-1 resp. for group II. Also, no significant differences were found between λ2 after exercise for both groups and between λ2 after reinjection for both groups. (orig./MG)

  4. 20 CFR 345.201 - Individual employer record defined.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Individual employer record defined. 345.201... INSURANCE ACT EMPLOYERS' CONTRIBUTIONS AND CONTRIBUTION REPORTS Individual Employer Records § 345.201 Individual employer record defined. Effective January 1, 1990, the Board will establish and maintain a...

  5. 48 CFR 871.201-4 - Letter contracts.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Letter contracts. 871.201... Rehabilitation and Employment Service 871.201-4 Letter contracts. Letter contracts are authorized for use in... formal contract with an approved educational institution before the enrollment of eligible veterans...

  6. 29 CFR 530.201 - Conflict with State law.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Conflict with State law. 530.201 Section 530.201 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS EMPLOYMENT... Conflict with State law. No certificate will be issued pursuant to § 530.101 of subpart B above...

  7. 22 CFR 201.67 - Maximum freight charges.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Maximum freight charges. 201.67 Section 201.67 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES AND PROCEDURES APPLICABLE TO COMMODITY... identity of the shipper or the circumstance that the shipment is or is not financed by the Government...

  8. 5 CFR 950.201 - National/international eligibility.

    Science.gov (United States)

    2010-01-01

    ....201 Section 950.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) SOLICITATION OF FEDERAL CIVILIAN AND UNIFORMED SERVICE PERSONNEL FOR CONTRIBUTIONS TO... accordance with these regulations. The Charity List will include each organization's CFC code and...

  9. 17 CFR 201.65 - Identity and signature.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Identity and signature. 201.65... of 1934 § 201.65 Identity and signature. Applications pursuant to this subpart may omit the identity, mailing address, and signature of the applicant; provided, that such identity, mailing address...

  10. 9 CFR 93.201 - General prohibitions; exceptions.

    Science.gov (United States)

    2010-01-01

    ....201 Section 93.201 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... such poultry are handled as follows: 3 Such permit may be obtained from the Animal and Plant Health... aboard an aircraft, ocean vessel, or other means of conveyance; or (ii) Except for poultry in...

  11. 48 CFR 1.201-2 - FAR Secretariat.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false FAR Secretariat. 1.201-2... ACQUISITION REGULATIONS SYSTEM Administration 1.201-2 FAR Secretariat. (a) The General Services Administration is responsible for establishing and operating the FAR Secretariat to print, publish, and...

  12. 22 CFR 201.63 - Maximum prices for commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Maximum prices for commodities. 201.63 Section... COMMODITY TRANSACTIONS FINANCED BY USAID Price Provisions § 201.63 Maximum prices for commodities. (a) U.S. prevailing market price—U.S. source. The purchase price for a commodity, the source of which is the...

  13. 22 CFR 201.11 - Eligibility of commodities.

    Science.gov (United States)

    2010-04-01

    ... Department Foreign Assets, Sanctions, Transactions and Funds Control Regulations published in 31 CFR parts... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Eligibility of commodities. 201.11 Section 201... COMMODITY TRANSACTIONS FINANCED BY USAID Conditions Governing the Eligibility of Procurement...

  14. Effect of thallium-201 blood levels on reversible myocardial defects

    International Nuclear Information System (INIS)

    To determine if 201Tl plasma blood levels correlate with the presence of reversible myocardial defects during exercise testing, 14 patients with stable coronary artery disease underwent two separate exercise 201Tl stress tests. Between initial and delayed imaging, on one test the patients drank an instant breakfast drink (eating) and on the other they drank an equivalent volume of water as a control (H2O). Thallium-201 imaging was performed immediately postexercise, immediately after eating/H2O and 210 min after eating/H2O. Between initial and immediate post eating/H2O images 201Tl reversible defects occurred in 27/38 regions in the H2O test versus 15/38 regions in the eating test (p = 0.02). Over this early time period, plasma 201Tl activity was significantly higher in the H2O test than eating test (p less than 0.05). In conclusion, early reversal of 201Tl defects may, in part, be the result of higher plasma 201Tl activity early after initial postexercise 201Tl imaging

  15. 27 CFR 26.201 - Products exempt from tax.

    Science.gov (United States)

    2010-04-01

    .... 26.201 Section 26.201 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU...) Industrial spirits. A distiller of industrial spirits who qualifies under regulations issued by the Governor... requirements of subpart O of this part. (c) Denatured spirits. A distiller who qualifies under the...

  16. 48 CFR 871.201-3 - Medical services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Medical services. 871.201... Rehabilitation and Employment Service 871.201-3 Medical services. The medical services provided trainees under... any other medical service under the jurisdiction of the Veterans Health Administration to which...

  17. 21 CFR 201.50 - Statement of identity.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.50 Section 201.50 Food... identity. (a) The label of prescription and insulin-containing drugs in package form shall bear as one of its principal features a statement of the identity of the drug. (b) Such statement of identity...

  18. Dicty_cDB: AFK201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK201 (Link to dictyBase) - - - Contig-U16294-1 AFK201P (Link to Original ... filfsn**n*ik*nviky*ks*ri*x*smg*kyftntfkiy*nsksitii*crm ... gnqwlyrrsnsiiremdlstryqryfm*n*kn*rintnyfhgsrsnqn*k ...

  19. 48 CFR 436.201 - Evaluation of contractor performance.

    Science.gov (United States)

    2010-10-01

    ... Construction 436.201 Evaluation of contractor performance. Preparation of performance evaluation reports. In addition to the requirements of FAR 36.201, performance evaluation reports shall be prepared for indefinite... of services to be ordered exceeds $500,000.00. For these contracts, performance evaluation...

  20. 19 CFR 201.27 - Special procedures: Medical records.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Special procedures: Medical records. 201.27... APPLICATION Safeguarding Individual Privacy Pursuant to 5 U.S.C. 552a § 201.27 Special procedures: Medical... maintained by the Commission which pertain to him or her, medical and psychological records merit...

  1. 7 CFR 201.25 - Contents of the label.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Contents of the label. 201.25 Section 201.25 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED...

  2. 7 CFR 201.8 - Contents of the label.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Contents of the label. 201.8 Section 201.8 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED...

  3. 5 CFR 250.201 - Coverage and purpose.

    Science.gov (United States)

    2010-01-01

    ....201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERSONNEL MANAGEMENT IN AGENCIES Strategic Human Capital Management § 250.201 Coverage and purpose. The Chief Human... effective and efficient operation of Government. As a part of OPM's overall leadership responsibilities...

  4. 24 CFR 1003.201 - Basic eligible activities.

    Science.gov (United States)

    2010-04-01

    ... equipment for use as part of a solid waste facility is eligible. In addition, the purchase of fire... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Basic eligible activities. 1003.201 Section 1003.201 Housing and Urban Development Regulations Relating to Housing and Urban...

  5. 17 CFR 201.233 - Depositions upon oral examination.

    Science.gov (United States)

    2010-04-01

    ... examination. 201.233 Section 201.233 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... upon oral examination. (a) Procedure. Any party desiring to take the testimony of a witness by.... Examination and cross-examination of deponents may proceed as permitted at a hearing. The witness...

  6. 7 CFR 201.61 - Fluorescence percentages in ryegrasses.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Fluorescence percentages in ryegrasses. 201.61 Section... ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.61 Fluorescence percentages in ryegrasses. Tolerances for 400-seed fluorescence tests shall be those set forth in the following table plus one-half...

  7. 50 CFR 223.201 - Guadalupe fur seal.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Guadalupe fur seal. 223.201 Section 223... Applicable to Threatened Marine and Anadromous Species § 223.201 Guadalupe fur seal. (a) Prohibitions. The... seal except as provided in paragraph (b) of this section. (b) Exceptions. (1) The...

  8. 30 CFR 218.201 - Method of payment.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 218.201 Section 218.201... Method of payment. You must tender all payments in accordance with § 218.51, except as follows: (a) For... and your customer document identification numbers on your payment document, rather than...

  9. 22 CFR 201.22 - Procurement under public sector procedures.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Procurement under public sector procedures. 201... APPLICABLE TO COMMODITY TRANSACTIONS FINANCED BY USAID Procurement Procedures; Responsibilities of Importers § 201.22 Procurement under public sector procedures. (a) General requirements. When the importer is...

  10. 46 CFR 201.76 - Applications for Government aid.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Applications for Government aid. 201.76 Section 201.76... Government aid. Applications for operating-differential subsidies, charter of Government-owned vessels, and other types of Government aid shall conform to the requirements set forth in the various general...

  11. 20 CFR 802.201 - Who may file an appeal.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Who may file an appeal. 802.201 Section 802... Prereview Procedures Commencing Appeal: Parties § 802.201 Who may file an appeal. (a) A party. (1) Any party... administrative law judge or deputy commissioner to the Board by filing a notice of appeal pursuant to...

  12. 48 CFR 1646.201 - Contract Quality Policy.

    Science.gov (United States)

    2010-10-01

    .... 1646.201 Section 1646.201 Federal Acquisition Regulations System OFFICE OF PERSONNEL MANAGEMENT FEDERAL EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION CONTRACT MANAGEMENT QUALITY ASSURANCE Contract Quality... consistent with the requirements set forth in the contract. After the initial review, subsequent reviews...

  13. 40 CFR 600.201-86 - General applicability.

    Science.gov (United States)

    2010-07-01

    ... Section 600.201-86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.201-86...

  14. 40 CFR 600.201-08 - General applicability.

    Science.gov (United States)

    2010-07-01

    ... Section 600.201-08 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.201-08...

  15. 40 CFR 600.201-93 - General applicability.

    Science.gov (United States)

    2010-07-01

    ... Section 600.201-93 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.201-93...

  16. 40 CFR 600.201-12 - General applicability.

    Science.gov (United States)

    2010-07-01

    ... Section 600.201-12 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures for Calculating Fuel Economy Values § 600.201-12...

  17. 37 CFR 201.25 - Visual Arts Registry.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Visual Arts Registry. 201.25... AND PROCEDURES GENERAL PROVISIONS § 201.25 Visual Arts Registry. (a) General. This section prescribes the procedures relating to the submission of Visual Arts Registry Statements by visual artists...

  18. 21 CFR 201.17 - Drugs; location of expiration date.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs; location of expiration date. 201.17 Section...) DRUGS: GENERAL LABELING General Labeling Provisions § 201.17 Drugs; location of expiration date. When an expiration date of a drug is required, e.g., expiration dating of drug products required by § 211.137 of...

  19. 49 CFR 174.201 - Class 2 (gases) material cylinders.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Class 2 (gases) material cylinders. 174.201... RAIL Detailed Requirements for Class 2 (Gases) Materials § 174.201 Class 2 (gases) material cylinders. (a) Except as provided in paragraphs (b) and (c) of this section, cylinders containing Class 2...

  20. Clinical usefulness of 201Tl SPECT in diagnosing nasopharyngeal tumor

    International Nuclear Information System (INIS)

    201Tl SPECT was performed on 54 patients suspected of nasopharyngeal tumor using a three-head rotating gamma camera and its clinical usefulness was evaluated. 201Tl accumulations were shown in 53 of the 54 patients (50 nasopharyngeal carcinoma, 1 malignant melanoma and 2 lymphoid hyperplasia) before treatment. In 48 of 50 patients with nasopharyngeal carcinoma, the effectiveness for treatment response could be assessed after treatment. 201Tl SPECT was concordant with MRI and CT in 26 patients (15 complete response (CR), 11 partial response (PR)), whereas it was discordant in 22 patients who showed CR in 201Tl SPECT but PR in MRI and CT. Follow-up MRI and 201Tl SPECT studies of 16 of these 22 patients from 6 to 33 months (mean 13 months) after treatment revealed that the tumor gradually decreased and finally vanished. Recurrent and metastatic lesions occurred in 8 patients from 9 to 69 months (mean 24 months) after treatment, and 201Tl SPECT could detect all 10 lesions in 8 patients. From the results obtained, it was concluded that 201Tl SPECT is very useful in the initial evaluation, in the assessment of treatment response and in detecting recurrent and metastatic lesions of nasopharyngeal tumor. (author)

  1. Thallium-201 scintigraphy in diagnosis of coronary stenosis

    International Nuclear Information System (INIS)

    The sensitivity of rest and exercise thallium-201 scintigraphy for the detection of significant coronary artery disease and myocardial ischaemia was compared with rest and exercise electrocardiography in 46 patients with chest pain. Of 26 patients with greater that 70 per cent coronary stenosis, 16 had abnormal rest thallium-201 scintigrams and 13 had Q waves. Myocardial perfusion defects in the resting scintigram correlated very well with evidence of previous myocardial infarction (16 of 17 patients, 94%) significant Q waves were present in 13 of these 17 patients (76%). After exercise, abnormal thallium-201 scintigrams consistent with ischaemia were found in 21 patients (81%). Abnormal exercise electrocardiograms were present in 15 patients (58%). The combination of abnormal exercise thallium-201 scintigrams or exercise electrocardiograms (23/26, 88%) exceeded abnormal exercise electrocardiograms alone (15/26, 58%). The two procedures were thus complementary. Abnormal rest or exercise thallium-201 scintigrams were obtained in 25/26 patients (96%) compared with abnormal rest or exercise electrocardiograms in 21/26 patients (84%). Twenty patients with less than 50 per cent coronary stenosis had normal rest thallium-201 scintigrams and no Q waves. Two had abnormal exercise thallium-201 scintigrams and 7 had abnormal exercise electrocardiograms. Thus,exercise thallium scintigraphy has higher sensitivity than exercise electrocardiography in detecting exercise induced ischaemia and is more specific. Scintigraphy appears to have a higher sensitivity than electrocardiography in detecting coronary artery disease. (author)

  2. Venous uptake of 201Tl as thallous chloride

    International Nuclear Information System (INIS)

    Thallium-201, injected as thallous chloride, has been found to adhere to or be taken up by the vein into which it is injected, permitting images to be obtained of human veins up to 4 h following injection. A digoxin-insensitive rat vein model also retained 201Tl but for shorter periods of time. 201Tl uptake is independent of the solution into which it is introduced, whether 5% dextrose or 0.9% sodium chloride. This technique permits multiple delayed views of normal veins to be obtained but is of uncertain value in the evaluation of thrombophlebitis of the calf because of rather poor resolution and high cost. (author)

  3. Clinical use of 201Tl myocardial scintigraphy

    International Nuclear Information System (INIS)

    Myocardial imaging with 201Tl and scinticamera was studied experimentally using specially designed phantoms and clinically in 23 patients with myocardial infarction or other heart disease. In the phantom experiment, quality of image, accumulative count rate, and detectability of the defect were compared to obtain the best technique for their detection, using four different collimators, i.e., converging, pin-hole, 4000-hole, and 140 keV high-resolution, at two photopeak levels of 201Tl of 75 and 167 keV, and combining a radiation absorber. In patient examination, myocardial images taken at different periods after injection, different detecting conditions of the scinticamera, and various detecting projections were compared. Images of the converging collimator at the 75 keV photopeak revealed considerably higher accumulative counts and relatively higher quality than those of other detecting conditions. It was necessary to take as many images as possible in various projections, in order to detect the location and size of the myocardial ischemic lesion because the lesion was demonstrated as a clear defect only in profile. It became evident that images taken between about 25 and 90 min delineated the myocardium more clearly than those taken in other periods. Normal images taken in 8 patients without ischemic heart disease appeared in the shape of a doughnut of horseshoe, demonstrating mainly the left venticular myocardium. The image was faint in the region of the aortic or mitral valve and thin in the region of the apical wall. A faint image of the right ventricular myocardium was sometimes seen. In 3 patients with valvular heart disease, findings suggested changes in the thickness of myocardium and the distribution of coronary blood flow. In 11 of 12 patients with old myocardial infarction, the location and size of the lesion was detected. (Evans, J.)

  4. 38 CFR 1.201 - Employee's duty to report.

    Science.gov (United States)

    2010-07-01

    ... PROVISIONS Referrals of Information Regarding Criminal Violations § 1.201 Employee's duty to report. All VA employees with knowledge or information about actual or possible violations of criminal law related to...

  5. 5 CFR 330.201 - Establishment and maintenance of RPL.

    Science.gov (United States)

    2010-01-01

    ... RECRUITMENT, SELECTION, AND PLACEMENT (GENERAL) Reemployment Priority List (RPL) § 330.201 Establishment and... registrants before considering internal candidates. (b) Each agency is required to establish and maintain...

  6. 42 CFR 447.201 - State plan requirements.

    Science.gov (United States)

    2010-10-01

    ... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS PAYMENTS FOR SERVICES Payment Methods: General Provisions § 447.201...) The plan must describe the policy and the methods to be used in setting payment rates for each type...

  7. 48 CFR 27.201 - Patent and copyright infringement liability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Patent and copyright... REGULATION GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 27.201 Patent and copyright infringement liability....

  8. 48 CFR 1427.201 - Patent and copyright infringement liability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Patent and copyright... INTERIOR GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 1427.201 Patent and copyright infringement liability....

  9. 31 CFR 546.201 - Prohibited transactions involving blocked property.

    Science.gov (United States)

    2010-07-01

    ... conflict in Darfur that violates international law; (iv) To be responsible for heinous conduct with respect... paragraph (a) of § 546.201: Section 203 of the International Emergency Economic Powers Act (50 U.S.C....

  10. 29 CFR 553.201 - Statutory provisions: section 7(k).

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Statutory provisions: section 7(k). 553.201 Section 553.201...: section 7(k). (a) Section 7(k) of the Act provides a partial overtime pay exemption for fire protection.... (b) As specified in §§ 553.20 through 553.28 of subpart A, workers employed under section 7(k)...

  11. Standardization and decay scheme of sup 201 Tl

    Energy Technology Data Exchange (ETDEWEB)

    Coursey, B.M.; Hoppes, D.D.; Hirschfeld, A.T. (National Inst. of Standards and Technology, Gaithersburg, MD (USA)); Judge, S.M.; Woods, D.H.; Woods, M.J. (National Physical Lab., Teddington (UK)); Funck, E.; Schrader, H. (Physikalisch-Technische Bundesanstalt, Braunschweig (Germany, F.R.)); Tuck, A.G. (Amersham International Ltd. (UK))

    1990-01-01

    An intercomparison exercise was conducted among three national standards laboratories and a commercial supplier to determine the degree of agreement between directly determined values of the activity concentration of a solution of {sup 201}Tl. The {gamma}-ray emission probabilities of {sup 201}Tl were also determined, providing an emission probability for the 167.4 keV {gamma} ray of 0.1000{plus minus}0.0006. (author).

  12. Myocardial viability assessed by Tl-201 SPECT. Redistribution versus reinjection

    International Nuclear Information System (INIS)

    The purpose of this study was to verify if a third series of images acquired by reinjection thallium-201, 24 h after conventional myocardial perfusion with the radioisotope, improves the identification of myocardial viability segments. The methods: we studied 30 patients, mean age 57.7 ±9.4 years, with old myocardial infarction using thallium (Tl)-201 SPECT, and we obtained three series of images (stress, redistribution after 4 h and reinjection after 24 h. Cardiac images were divided in 5 segments (apical, lateral, anterior, septal and inferior) and each one received a value by a score system according to the Tl-201 myocardial uptake (0=normal uptake; 1=mild hypoperfusion; 2=moderate hypoperfusion; 3=severe hypoperfusion or no myocardial uptake). We considered viable myocardium when the uptake of Tl-201 in the segment related to te myocardial infarction increases at least 1 point in two different axis of Tl-201 SPECT. The results: seven (23,3%) patients demonstrated increase of Tl-201 uptake only at reinjection images, showing a high efficacy of the method. Nine (30%) patients showed persistent hypoperfusion at all series of images suggesting only fibrosis in the are related to the infarction. Fourteen (46,7%) patients showed increase of Tl-201 concentration at redistribution images; among these patients, six showed improvement of myocardial uptake at reinjection. This condition was interpreted as regional chronic ischemic process: hibernating myocardium. The conclusion was that Tl-201 hypoperfusion at redistribution images without significant changes in relation to the stress images do not represent fibrosis at all. The reinjection technic was better than conventional redistribution in the detection of viable myocardium. This data allows a better therapeutic orientation. (author)

  13. Pre-deploy operations with SPARTAN-201 during STS-64

    Science.gov (United States)

    1994-01-01

    The astronauts onboard the Space Shuttle Discovery used a 70mm camera to capture this view of the pre-deply operations with the Shuttle Pointed Autonomous Research Tool for Astronomy (SPARTAN-201). In the grasp of the robot arm device of the Remote Manipulator System (RMS), Spartan-201 hovers above Discovery's cargo bay prior to its two days of free-flight, some 40 miles away from the parent spacecraft.

  14. Subcriticality measurement method for AGN-201 reactor

    International Nuclear Information System (INIS)

    In order to verify the feasibility and safety of reactor, reactor physics test is performed. The measurement of control rod worth occupies most of period of reactor physics test. For that reason, the new method has been studied for subcriticality measurement to reduce the test period from the economic point of view. Nevertheless, system that can measure or monitor correct subcriticality of nuclear reactor has not been developed yet. If the accurate subcriticality were measured, more efficient of operation would be available and an necessary conservativeness could be removed. In 1980s, the research about subcriticality measurement methodology was performed about subcritical reactor based accelerator, fast breeder reactor and critical experiment reactor. However, study for the Pressurized Water Reactor has been carried on recently. The crucial problem depends on how to correct the spatial effect about signal, neutron source, detector position and measured weak neutron. As the representative measurement methodology, there are Pulse Neutron Source method(PNM), Neutron Noise Analysis, neutron source multiplication method and so on. This paper shows the theoretical analysis of the modified Neutron Source multiplication method (modified NSM method) which is a subcriticality measurement methodology. In the future, measurement of subcriticality will be perform about AGN-201 reactor

  15. NOVA 201 ultrasonic thickness gage (NOVA Gage)

    Science.gov (United States)

    Garecht, Diane

    1990-01-01

    The measurement integrity of the NOVA 201 digital ultrasonic thickness gage (NOVA gage) was demonstrated by comparing the NOVA gage measurements to the thickness gage measurements, and determining the bias and uncertainty of the NOVA gage when measuring redesigned solid rocket motor (RSRM) hardware per engineering test plans (ETP). The NOVA gage was tested by three different operators on steel and aluminum RSRM hardware for wall thickness. The results show that the measurement bias is not consistent. The uncertainty of the bias is caused by the heterogeneous material properties of the RSRM components that influence the time of flight of ultrasonic waves. The measurement uncertainty inherent to the design and operation of the NOVA gage is less in comparison to the uncertainty of the bias. The total measurement uncertainty cannot be substantially reduced by taking more than one measurement. There is no correlation between bias and the surface finish range of this test unless 3-in-One oil is used as a couplant, in which case there appears to be a slight trend. There is no correlation between uncertainty and the surface finish range. The measurement uncertainty of the NOVA gage can be reduced using 3-in-One oil as a couplant.

  16. 201-Tl production studies by 203-Tl(p,3n)201-Pb and 202-Hg(p,2n) nuclear reactions

    Energy Technology Data Exchange (ETDEWEB)

    Birattari, C.; Bonardi, M.; Salomone, A. (Milan Univ. (Italy). Ist. di Fisica)

    Thallium 201 has been produced in the Milan university AVF cyclotron by a /sup 203/Tl(p,3n)/sup 201/Pb and /sup 202/Hg(p,2n) nuclear reactions. /sup 201/Tl//sup 201/Pb were separated radiochemically by the preparation of thallium as thallous iodide after complexation of the lead with EDTA. /sup 202/Hg and /sup 201/Tl were separated by washing the target and holder, to which the radiothallium adheres with 3HCl and adding NaOH. Quality control is by radiochromatography.

  17. Study on nucleodiagnosis of uterine tumors with 201thallium chloride

    International Nuclear Information System (INIS)

    A total of 50 cases, including 29 of myoma uteri, 8 of adenomyosis, 7 complicated with both of the diseases and 6 of carcinoma corporis uteri, were given 201thallium chloride (201Tl-Cl) intravenously, and were scanned by a gamma-camera 20 min later. The positive image of 201Tl-Cl accumulations was obtained in all cases. The minimal detectable size of the myoma nodules found in our studies was greater than 5 cm. The cases of adenomyosis and carcinoma corporis uteri had generally a slightly stronger accumulation of 201Tl+ than did the myoma. However, the objective diagnostic criteria for each tumor could not be established in the course of this study from the scanning images exclusively. The uterus was 1.7 to 1.9 times more radioactive than the background in the image analysis by the RI-minicomputer, and in the study of extirpated specimens, the myomatous lesion was 1.8 to 1.85 times more radioactive than the myometrium. The distribution of 201Tl+ was almost uniform in the myoma nodules. The accumulation of 201Tl+ was extremely rapid in tumors, and reached to saturation within 15 min after the intravenous administration. Tl+ as a K+ analog was thought to be incorporated by the tumor cells which were already in an advanced K+-metabolic state. Tumor scanning with 201Tl-Cl is useful for RI diagnosis in the gynecological field because it is a quick and safe method, and yields a relatively clear image. (author)

  18. Treatment of cultured glioma cells with the EGFR-TKI gefitinib (''Iressa'', ZD1839) increases the uptake of astatinated EGF despite the absence of gefitinib-mediated growth inhibition

    International Nuclear Information System (INIS)

    The EGFR-TKI (epidermal growth factor receptor tyrosine kinase inhibitor) gefitinib (''Iressa'', ZD1839), a reversible growth inhibitor of EGFR-expressing tumour cells, has been shown to enhance the antitumour effect of ionising radiation, and also to increase the uptake of radioiodinated EGF. Thus, combination of gefitinib treatment and radionuclide targeting is an interesting option for therapy of brain tumours that are difficult to treat with conventional methods. The aim of this study was to evaluate how pre-treatment with gefitinib affects binding of astatinated EGF (211At-EGF) to cultured glioma U343 cells, which express high levels of EGFR. The growth of U343 cells in the presence of gefitinib was investigated, and it was found that gefitinib does not significantly inhibit the growth of these cells. Nevertheless, the uptake of 211At-EGF in U343 cells was markedly increased (up to 3.5 times) in cells pre-treated with gefitinib (1 μM). This indicates that a combination of gefitinib treatment and radionuclide targeting to EGFR might be a useful therapeutic modality, even for patients who do not respond to treatment with gefitinib alone. (orig.)

  19. Serial Myocardial Imaging after a Single Dose of Thallium-201

    Directory of Open Access Journals (Sweden)

    Takahiko Kamata

    2014-10-01

    Full Text Available Although thallium-201 exercise scintigraphy has been established for the detection of myocardial ischemia and viability, little is known regarding the myocardial thallium-201 kinetics during angioplasty. Herein, we report a 77-year old man with angina pectoris, in whom serial myocardial imaging after a single dose of thallium-201 was helpful in identifying not only the culprit lesion and myocardial viability, but also the dynamic changes in myocardial perfusion during angioplasty. Thallium-201 images after exercise showed a perfusion defect in the inferior wall, with a trivial redistribution 3 hours after the exercise and a marked improvement 24 hours later. Coronary angiography, performed 27 hours after exercise scintigraphy, showed severe stenosis in the right coronary artery. Guidewire crossing of the lesion interrupted the antegrade flow, which was restored after balloon dilation and stent implantation. Thallium-201 images, 2 hours after angioplasty (i.e., 30 hours after exercise, showed a decreased tracer uptake in the inferior wall, which improved the next day (i.e., 48 hours after exercise. Cardiac biomarkers were negative in the clinical course.

  20. 49 CFR 179.201 - Individual specification requirements applicable to non-pressure tank car tanks.

    Science.gov (United States)

    2010-10-01

    ... to non-pressure tank car tanks. 179.201 Section 179.201 Transportation Other Regulations Relating to... MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS Specifications for Non-Pressure Tank Car Tanks (Classes... car tanks....

  1. Evaluation of infantile ventricular tachycardia by 201Tl myocardial SPECT

    International Nuclear Information System (INIS)

    201Tl myocardial SPECT findings in infantile ventricular tachycardia (VT) were examined. The subjects were 4 cases of infantile VT subjected exercise-loading 201Tl scintigraphy in 1990. These cases (3 males and 1 female) were aged 11-14 years, being persistent and non-persistent type VT (2 cases each). Echocardiography revealed no abnormal findings in these 4 cases. Exercise-loading was performed by means of sitting ergometer. ECG revealed sinus arrhythmia except for one case which throughout its course of treatment, had already been presenting ventricular extrasystole from before the excercise-loading. Myocardial SPECT revealed persistent defects (antero-septal wall defects in three cases). The above suggests that 201Tl myocardial SPECT enables us to search for etiology of VT, prognosis and the like. (author)

  2. 177Lu-OPS201 targeting somatostatin receptors

    DEFF Research Database (Denmark)

    Beykan, Seval; Dam, Jan S; Eberlein, Uta;

    2016-01-01

    kidneys (13.7 Gy), the osteogenic cells (3.9 Gy), the urinary bladder wall (1.8 Gy), and the liver (1.0 Gy). No metabolites of (177)Lu-OPS201 were found by radio HPLC analysis. None of the absorbed doses calculated will exceed organ toxicity levels. CONCLUSIONS: The (177)Lu-OPS201 was well tolerated and......-integrated activity coefficients were calculated for the organs showing visible uptake. Based on these data, the absorbed organ dose coefficients for a 70-kg patient were calculated with OLINDA/EXM. For humans after an injection of 5 GBq (177)Lu-OPS201, the highest predicted absorbed doses are obtained for the...

  3. Tank characterization report for single-shell Tank B-201

    International Nuclear Information System (INIS)

    The purpose of this report is to characterize the waste in single shell Tank B-201. Characterization includes the determination of the physical, chemical (e.g., concentrations of elements and organic species), and radiological properties of the waste. These determinations are made using analytical results from B-201 core samples as well as historical information about the tank. The main objective is to determine average waste properties: but in some cases, concentrations of analytes as a function of depth were also determined. This report also consolidates the available historical information regarding Tank B-201, arranges the analytical information from the recent core sampling in a useful format, and provides an interpretation of the data within the context of what is known about the tank

  4. Clinical significance of thallium-201 single-photon emission computerized tomography (Tl-201 SPECT) in the evaluation of viability of gliomas

    International Nuclear Information System (INIS)

    The clinical significance of thallium-201 single-photon emission computerized tomography (Tl-201 SPECT) in the evaluation of viability of gliomas was studied comparatively with histological examination of tumor tissue using Ki-67 and proliferative cell nuclear antigen (PCNA) monoclonal antibody. The relationship between radionuclide uptake of Tl-201 in tumor specimens and labeling indices of special staining using Ki-67 and PCNA monoclonal antibodies were also studied. The population studied consisted of 17 patients with glioma. Tl-201 indices obtained from early and delayed images and its washout rates were used for quantitative anlaysis of Tl-201 SPECT findings. Tl-201 indices showed high values according to the histological malignancy of giomas. Radionuclide uptake of Tl-201 in the tumor specimens were also high in those with high labeling indices of Ki-67 and PCNA. The lesions with marked Tl-201 uptake on early and delayed images had numerous Ki-67 and PCNA positive-stained cells. The lesion with low Tl-201 washout rate therefore reflected well the more viable lesion in the tumor tissue. It is concluded that the viability of giomas including anaplastic changes and response of gliomas to the treatment can be detected by serial study with Tl-201 SPECT. (author)

  5. Coronary spasm: 201Tl scintiscanning following pharmacological provocation

    International Nuclear Information System (INIS)

    According to the authors' experience so far, 201Tl myocardial scintiscanning is a sufficiently sensitive non-invasive method for detection of coronary vasospasm provoked by ergotamine administration. Mild incomplete and asymptotic forms of coronary vasospasm were detected by scintiscanning. Indications for myocardial scintiscanning of ergotamine-provoked vasospasm are: Cases of angina pectoris at rest in which electrocardiograms during spasm are not available; elleviated symptoms after nitroglycerine administration; exercise electrocardiograms without any sign of ischaemia; negative results of exercise 201Tl myocardial scintiscanning. (orig.)

  6. Studies about the stress transaxial myocardium tomography with thallium -201

    International Nuclear Information System (INIS)

    Since the time of earliest applications of SPECT technology to Thallium-201 myocardial perfusion imaging, there has been no agreement as to what constitutes the best procedures to follow in order to achieve the theoretical advantages of SPECT to diagnose coronary artery disease. The purpose of these studies are to show the results of experimental and clinical investigations, that, have helped to resolve most of some controversies. Myocardial perfusion SPECT with Thallium-201 is clinically useful procedure that is readily applicable for routine clinical application provided correct techniques are utilized. (author)

  7. 4 CFR 201.3 - Publicly available documents and electronic reading room.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Publicly available documents and electronic reading room. 201.3 Section 201.3 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PUBLIC INFORMATION AND REQUESTS § 201.3 Publicly available documents and electronic reading room. (a) Many Board records...

  8. 30 CFR 201.100 - Responsibilities of the Associate Director for Minerals Revenue Management.

    Science.gov (United States)

    2010-07-01

    ... Minerals Revenue Management. 201.100 Section 201.100 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT GENERAL Oil and Gas, Onshore § 201.100 Responsibilities of the Associate Director for Minerals Revenue Management. The Associate Director is...

  9. 7 CFR 201.73 - Processors and processing of all classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... seed. 201.73 Section 201.73 Agriculture Regulations of the Department of Agriculture (Continued... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.73 Processors and processing of all classes of certified seed. The following requirements must be met by processors of all...

  10. 7 CFR 201.51b - Purity procedures for coated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Purity procedures for coated seed. 201.51b Section 201... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.51b...

  11. 7 CFR 201.12a - Lawn and turf seed mixtures.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Lawn and turf seed mixtures. 201.12a Section 201.12a..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.12a Lawn and turf seed mixtures. Seed mixtures intended for...

  12. 7 CFR 201.71 - Establishing the source of all classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... seed. 201.71 Section 201.71 Agriculture Regulations of the Department of Agriculture (Continued... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.71 Establishing the source of all classes of certified seed. The certifying agency shall have evidence of the class and source...

  13. 47 CFR 54.201 - Definition of eligible telecommunications carriers, generally.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Definition of eligible telecommunications carriers, generally. 54.201 Section 54.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... § 54.201 Definition of eligible telecommunications carriers, generally. (a) Carriers eligible...

  14. 38 CFR 3.201 - Exchange of evidence; Social Security and Department of Veterans Affairs.

    Science.gov (United States)

    2010-07-01

    ... Compensation Evidence Requirements § 3.201 Exchange of evidence; Social Security and Department of Veterans... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Exchange of evidence; Social Security and Department of Veterans Affairs. 3.201 Section 3.201 Pensions, Bonuses, and...

  15. 48 CFR 339.201-70 - Required provision and contract clause.

    Science.gov (United States)

    2010-10-01

    ... contract clause. 339.201-70 Section 339.201-70 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES SPECIAL CATEGORIES OF CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Electronic and Information Technology 339.201-70 Required provision and contract clause. (a) The Contracting Officer shall insert...

  16. 48 CFR 1819.201 - General policy. (NASA supplements paragraphs (a), (c), (d), and (f))

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true General policy. (NASA supplements paragraphs (a), (c), (d), and (f)) 1819.201 Section 1819.201 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 1819.201 General policy....

  17. 37 CFR 201.2 - Information given by the Copyright Office.

    Science.gov (United States)

    2010-07-01

    ... an attorney, are not open to public inspection. (4) The Copyright Office will not respond to any... Copyright Office. 201.2 Section 201.2 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.2 Information given by the...

  18. 29 CFR 825.201 - Leave to care for a parent.

    Science.gov (United States)

    2010-07-01

    ... foster care, or to care for a parent, the husband and wife would each be entitled to the difference... 29 Labor 3 2010-07-01 2010-07-01 false Leave to care for a parent. 825.201 Section 825.201 Labor....201 Leave to care for a parent. (a) General rule. An eligible employee is entitled to FMLA leave...

  19. 21 CFR 250.201 - Preparations for the treatment of pernicious anemia.

    Science.gov (United States)

    2010-04-01

    ... anemia. 250.201 Section 250.201 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... Drugs and Foods § 250.201 Preparations for the treatment of pernicious anemia. (a) The ninth announcement of the Anti-anemia Preparations Advisory Board of the United States Pharmacopeia is concerned...

  20. 19 CFR 201.14 - Computation of time, additional hearings, postponements, continuances, and extensions of time.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Computation of time, additional hearings, postponements, continuances, and extensions of time. 201.14 Section 201.14 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Initiation and Conduct of Investigations § 201.14 Computation of time,...

  1. 46 CFR 201.88 - Postponement or change of place by presiding officer.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Postponement or change of place by presiding officer. 201.88 Section 201.88 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE...) § 201.88 Postponement or change of place by presiding officer. If, in the judgment of the...

  2. 31 CFR 560.201 - Prohibited importation of goods or services from Iran.

    Science.gov (United States)

    2010-07-01

    ... services from Iran. 560.201 Section 560.201 Money and Finance: Treasury Regulations Relating to Money and... REGULATIONS Prohibitions § 560.201 Prohibited importation of goods or services from Iran. Except as otherwise... origin or owned or controlled by the Government of Iran, other than information and...

  3. 17 CFR 274.201 - Form N-MFP, portfolio holdings of money market funds.

    Science.gov (United States)

    2010-04-01

    ... of money market funds. 274.201 Section 274.201 Commodity and Securities Exchanges SECURITIES AND... Statements § 274.201 Form N-MFP, portfolio holdings of money market funds. This form shall be used by registered open-end management investment companies that are regulated as money market funds under §...

  4. 37 CFR 201.23 - Transfer of unpublished copyright deposits to the Library of Congress.

    Science.gov (United States)

    2010-07-01

    ... copyright deposits to the Library of Congress. 201.23 Section 201.23 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.23 Transfer of unpublished copyright deposits to the Library of Congress. (a) General. This section...

  5. 21 CFR 20.1 - Testimony by Food and Drug Administration employees.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Testimony by Food and Drug Administration employees. 20.1 Section 20.1 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PUBLIC INFORMATION Official Testimony and Information § 20.1 Testimony by Food and...

  6. 17 CFR 201.440 - Appeal of determinations by the Public Company Accounting Oversight Board.

    Science.gov (United States)

    2010-04-01

    ... the Public Company Accounting Oversight Board. 201.440 Section 201.440 Commodity and Securities... and Commission Review § 201.440 Appeal of determinations by the Public Company Accounting Oversight....401(e) or upon its own motion. (d) Certification of the record; service of the index. Within...

  7. 21 CFR 201.2 - Drugs and devices; National Drug Code numbers.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs and devices; National Drug Code numbers. 201.2 Section 201.2 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING General Labeling Provisions § 201.2 Drugs and devices; National Drug...

  8. 21 CFR 201.115 - New drugs or new animal drugs.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false New drugs or new animal drugs. 201.115 Section 201.115 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.115 New drugs or new...

  9. 7 CFR 201.56-1 - Goosefoot family, Chenopodiaceae, and Carpetweed family, Aizoaceae.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Goosefoot family, Chenopodiaceae, and Carpetweed family, Aizoaceae. 201.56-1 Section 201.56-1 Agriculture Regulations of the Department of Agriculture... of the Act § 201.56-1 Goosefoot family, Chenopodiaceae, and Carpetweed family, Aizoaceae. Kinds...

  10. 48 CFR 9903.201-8 - Compliant accounting changes due to external restructuring activities.

    Science.gov (United States)

    2010-10-01

    ... changes due to external restructuring activities. 9903.201-8 Section 9903.201-8 Federal Acquisition... Requirements 9903.201-8 Compliant accounting changes due to external restructuring activities. The contract... practice changes directly associated with external restructuring activities that are subject to and...

  11. 22 CFR 201.47 - Use of marine insurance loss proceeds.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Use of marine insurance loss proceeds. 201.47... Commodity-Related Services § 201.47 Use of marine insurance loss proceeds. The borrower/grantee shall pay... marine insurance claim under a marine insurance policy financed pursuant to this part 201, if...

  12. 40 CFR 246.201-6 - Recommended procedures: Transportation to market.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Transportation to market. 246.201-6 Section 246.201-6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Procedures § 246.201-6 Recommended procedures: Transportation to market. Transportation to market may...

  13. 47 CFR 68.201 - Connection to the public switched telephone network.

    Science.gov (United States)

    2010-10-01

    ... network. 68.201 Section 68.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES (CONTINUED) CONNECTION OF TERMINAL EQUIPMENT TO THE TELEPHONE NETWORK Terminal Equipment Approval Procedures § 68.201 Connection to the public switched telephone network. Terminal equipment...

  14. 40 CFR 201.28 - Testing by railroad to determine probable compliance with the standard.

    Science.gov (United States)

    2010-07-01

    ...; INTERSTATE RAIL CARRIERS Measurement Criteria § 201.28 Testing by railroad to determine probable compliance... probable compliance with the standard. 201.28 Section 201.28 Protection of Environment ENVIRONMENTAL..., then there is probably compliance with the standard. (c) This procedure is set forth to assist...

  15. 27 CFR 44.201 - Return to manufacturer or customs warehouse proprietor.

    Science.gov (United States)

    2010-04-01

    ... customs warehouse proprietor. 44.201 Section 44.201 Alcohol, Tobacco Products and Firearms ALCOHOL AND... Proprietors Notice of Removal of Shipment § 44.201 Return to manufacturer or customs warehouse proprietor... to the factory, or cigars are removed from such a warehouse for return to a customs warehouse,...

  16. 46 CFR 201.137 - Rights of parties as to presentation of evidence.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Rights of parties as to presentation of evidence. 201.137 Section 201.137 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Evidence (Rule 14) § 201.137 Rights of parties as...

  17. Quality control 201TlCl solution obtained at IPEN-CNEN/SP through the direct method of 201Tl preparation

    International Nuclear Information System (INIS)

    The radiopharmaceutical 201TlCl is used in Nuclear medicine for myocardial visualization. The solution of 201TlCl was prepared using 201Tl obtained by irradiating a natural mercury target with protons. This radionuclide was subjected to different quality control processes to verify the purity required for its use in Medicine. Some of these controls concerned the determination of 200Tl, 201Tl and 202Tl; the chemical identification of 201Tl+1; the hydrazine concentration, mercury contamination and the presence of phosphate. Furthermore, the biologic distribution in Wistar rats and tests for sterility, pyrogens and for toxicity were carried out. It was verified that the solution obtained was in the form of thallous chloride. This radiopharmaceutical can give a good heart image in animals but due to the contamination of 201Tl with 200Tl and 202Tl its use in human beings is not possible unless enriched 202Hg is used as target of irradiation. (author)

  18. 7 CFR 201.56-9 - Mallow family, Malvaceae.

    Science.gov (United States)

    2010-01-01

    ..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.56-9 Mallow family, Malvaceae. Kinds of seed: Cotton, kenaf, and okra. (a) General description. (1) Germination habit: Epigeal dicot. (2)...

  19. 7 CFR 201.57a - Dormant seeds.

    Science.gov (United States)

    2010-01-01

    ..., or application of germination promoting chemicals. (b) The percentage of dormant seed, if present..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.57a Dormant seeds. Dormant seeds...

  20. 7 CFR 201.56-5 - Grass family, Poaceae (Gramineae).

    Science.gov (United States)

    2010-01-01

    ... ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.56-5 Grass.... During germination the scutellum remains inside the seed to absorb nutrients from the endosperm and... endosperm. During germination the scutellum remains inside the seed to absorb nutrients from the...

  1. Contribution to the study of thallium 201 myocardium scintigraphy

    International Nuclear Information System (INIS)

    In this work a new isotope was tested in the field of myocardium scintigraphy: thallium 201. The different radioisotopes used so far in myocardium scintigraphy are reviewed to begin with. The main biological and physical characteristics of thallium and the scintillation camera used for this work are described next. In our opinion thallium 201 owing to its biological behavior similar to that of potassium and to its physical characteristics, appears as one of the better -if not the best- known tracer suitable for use in myocardium scintigraphy. Its properties are suited to the use of a scintillation camera, which considerably shortens the examination time and thus allows an isotopic exploration of the myocardium from several incidences. The only disadvantage of this cyclotron-produced isotope seems to be its high price which will probably limit its use on a large scale. Fifty thallium 201 myocardium scintigraphs were practised on forty-eight coronary thrombosis patients. From this was established a precise topographic correlation between the electrocardiographic diagnosis and the scintigraph. The two corresponded in 47 cases out of 50. The few disagreements between ECG and scintigraphic results seem to be due either to poor-quality images or to an overall myocardium hypofixation connected with a very extensive necrosis. This means that thallium 201 myocardium scintigraphy is a reliable method of examination in the great majority of cases, giving a direct picture of the heart muscle and its necrotic lesions

  2. 22 CFR 201.32 - Suppliers of delivery services.

    Science.gov (United States)

    2010-04-01

    ... 201.32 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES AND PROCEDURES APPLICABLE TO..., flight or inland carrier run number), date of the bill(s) of lading, the identity and address of the assured, and the identity and address of the assignee of the assured to whom payment has actually...

  3. 12 CFR 201.3 - Extensions of credit generally.

    Science.gov (United States)

    2010-01-01

    ... institution must be secured to the satisfaction of the Federal Reserve Bank that makes the advance... securities, and business, consumer, and other customer notes. (3) If a Federal Reserve Bank concludes that a... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Extensions of credit generally. 201.3...

  4. 7 CFR 201.58a - Indistinguishable seeds.

    Science.gov (United States)

    2010-01-01

    ... ultraviolet light. Editorial Note: For Federal Register citations affecting § 201.58a, see the List of CFR... number of fluorescent seedlings determined under ultraviolet light at the end of the germination period... area where light from other sources is excluded. Seeds are considered fluorescent if the lemma or...

  5. 48 CFR 2901.201-1 - Maintenance of the FAR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Maintenance of the FAR... DEPARTMENT OF LABOR ACQUISITION REGULATION SYSTEM Administration 2901.201-1 Maintenance of the FAR. A member... regarding proposed FAR revisions and advocating revisions sought by DOL....

  6. 10 CFR 1015.201 - Aggressive agency collection activity.

    Science.gov (United States)

    2010-01-01

    ... establishing the amount due. (b) In accordance with 31 CFR Chapter IX parts 900-904 and this part, DOE will... DOJ for litigation. (See 31 CFR 285.12, Transfer of Debts to Treasury for Collection.) This... 10 Energy 4 2010-01-01 2010-01-01 false Aggressive agency collection activity. 1015.201...

  7. 48 CFR 814.201 - Preparation of invitations for bids.

    Science.gov (United States)

    2010-10-01

    ... assigned by the national system or VA's Electronic Contract Management System (eCMS). VHA shall use eCMS... AFFAIRS CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 814.201 Preparation of... accepted, and will become a contract in the same fiscal year but, because of procurement lead time,...

  8. 27 CFR 31.201 - Refilling of liquor bottles.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Refilling of liquor... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Reuse and Possession of Used Liquor Bottles § 31.201 Refilling of liquor bottles. No person who sells, or offers for sale, distilled...

  9. 19 CFR 201.40 - Records-retention requirements.

    Science.gov (United States)

    2010-04-01

    ... a vote under § 201.36(d). (b) The Secretary shall also maintain a copy of a statement from the... Secretary shall also maintain a complete transcript or electronic recording of the proceedings of each... Secretary shall also maintain a complete transcript or electronic recording of all deliberations...

  10. 48 CFR 14.201-1 - Uniform contract format.

    Science.gov (United States)

    2010-10-01

    ... uniform contract format applies shall include Parts I, II, III, and IV. If any section of the uniform... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Uniform contract format... CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.201-1 Uniform contract...

  11. 48 CFR 419.201-71 - Small business coordinators.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Small business... SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 419.201-71 Small business coordinators. The head of the contracting activity (HCA) or a representative of the HCA shall designate in writing a small...

  12. 48 CFR 31.201-6 - Accounting for unallowable costs.

    Science.gov (United States)

    2010-10-01

    ... accounting for and presentation of unallowable costs must be those described in 48 CFR 9904.405, Accounting... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Accounting for unallowable... Organizations 31.201-6 Accounting for unallowable costs. (a) Costs that are expressly unallowable or...

  13. 48 CFR 236.201 - Evaluation of contractor performance.

    Science.gov (United States)

    2010-10-01

    ... CONTRACTS Special Aspects of Contracting for Construction 236.201 Evaluation of contractor performance. (a) Preparation of performance evaluation reports. Use DD Form 2626, Performance Evaluation (Construction... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation of...

  14. 48 CFR 1536.201 - Evaluation of contracting performance.

    Science.gov (United States)

    2010-10-01

    ... Contracting for Construction 1536.201 Evaluation of contracting performance. (a) The Contracting Officer will... will file the form in the contractor performance evaluation files which it maintains. (e) The Quality... with EPA's Freedom of Information Act procedures at 40 CFR part 2....

  15. 48 CFR 614.201-70 - Use of English language.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Use of English language... METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 614.201-70 Use of English language. Use of English language solicitations and contracts is mandatory unless a deviation has been approved by...

  16. 18 CFR 367.2010 - Account 201, Common stock issued.

    Science.gov (United States)

    2010-04-01

    ..., FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED SERVICE COMPANIES SUBJECT TO THE PROVISIONS OF THE PUBLIC UTILITY HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2010 Account 201, Common...

  17. Clinical value of thallium 201 in a cardiology service

    International Nuclear Information System (INIS)

    At present the most widely used element in isotopic cardiology is undoubtedly 201Tl. In the few years since its appearance many publication testify to its growing use in the external detection of coronary thrombosis, the discovery of ischemia exertion, the non-traumatic observation of patients after an aortocoronary bridging operation, the diagnosis of coronary deficiency associated with another heart disease (aorta narrowing, mitral prolapsus, obstructive cardiomyopathy) and in combination with two other radioisotopic methods. The present work is intended as a modest contribution, still very recent, to the critical study of this new technique in all its present aspects. Part one presents the various characteristics responsible for the advantages and limits of 201Tl, then describes the techniques and apparatus used. The production, dosimetry, toxicity and biological behaviour of 201Tl are also discussed. A hundred and twenty-five examinations were performed in the Nuclear Medicine Service of the Limoges UHC between May 1977 and October 1978. The results are analysed in part two. This is followed by a discussion which attempts, in the light of our experience, to situate the place occupied by 201Tl in the range of complementary examinations useful in declared or assumed coronary cases. We then propose an examination procedure and precise indications we believe to be justified, accounting for economic problems before considering the future prospects of myocardium scintigraphy

  18. 48 CFR 9903.201-1 - CAS applicability.

    Science.gov (United States)

    2010-10-01

    ...-materials, and labor-hour contracts and subcontracts for the acquisition of commercial items. (7) Contracts...) shall be subject to CAS. A CAS-covered contract may be subject to full, modified or other types of CAS coverage. The rules for determining the applicable type of CAS coverage are in 9903.201-2. (b)...

  19. 19 CFR 201.21 - Availability of specific records.

    Science.gov (United States)

    2010-04-01

    ... need to prevent the expenditure of the United States government's time and money for private purposes... dissenting opinions, as well as orders, made in the adjudication of cases; (2) those statements of policy and... legislative body concerned, and confidential business data as defined in 18 U.S.C. 1905 and 19 CFR 201.06...

  20. 9 CFR 113.201 - Canine Distemper Vaccine, Killed Virus.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.201 Canine Distemper Vaccine, Killed Virus. Canine Distemper...

  1. SPECT-T1-201 cardiac imaging

    International Nuclear Information System (INIS)

    Topics of discussion include: limitations of planar thallium-201 imaging; tomographic acquisition protocol; quantitative analysis involving slice selection, circumferential profile generation, comparison to normal limits and polar display of results; sensitivity and specificity; sources of error involving patient motion and upward creep; and clinical applications

  2. 14 CFR 201.5 - Advertising and sales by applicants.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Advertising and sales by applicants. 201.5... amended certificate or commuter air carrier authority shall not: (1) Advertise, list schedules, or accept... advertise or publish schedule listings for the air transportation covered by its application after...

  3. 24 CFR 201.22 - Credit requirements for borrowers.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Credit requirements for borrowers... § 201.22 Credit requirements for borrowers. (a) Credit application and review. (1) Before making a loan... borrower and any co-maker or co-signer is solvent and an acceptable credit risk, with a reasonable...

  4. Verification of RESRAD-RDD. (Version 2.01)

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Jing-Jy [Argonne National Lab. (ANL), Argonne, IL (United States); Flood, Paul E. [Argonne National Lab. (ANL), Argonne, IL (United States); LePoire, David [Argonne National Lab. (ANL), Argonne, IL (United States); Kamboj, Sunita [Argonne National Lab. (ANL), Argonne, IL (United States); Yu, Charley [Argonne National Lab. (ANL), Argonne, IL (United States)

    2015-09-01

    In this report, the results generated by RESRAD-RDD version 2.01 are compared with those produced by RESRAD-RDD version 1.7 for different scenarios with different sets of input parameters. RESRAD-RDD version 1.7 is spreadsheet-driven, performing calculations with Microsoft Excel spreadsheets. RESRAD-RDD version 2.01 revamped version 1.7 by using command-driven programs designed with Visual Basic.NET to direct calculations with data saved in Microsoft Access database, and re-facing the graphical user interface (GUI) to provide more flexibility and choices in guideline derivation. Because version 1.7 and version 2.01 perform the same calculations, the comparison of their results serves as verification of both versions. The verification covered calculation results for 11 radionuclides included in both versions: Am-241, Cf-252, Cm-244, Co-60, Cs-137, Ir-192, Po-210, Pu-238, Pu-239, Ra-226, and Sr-90. At first, all nuclidespecific data used in both versions were compared to ensure that they are identical. Then generic operational guidelines and measurement-based radiation doses or stay times associated with a specific operational guideline group were calculated with both versions using different sets of input parameters, and the results obtained with the same set of input parameters were compared. A total of 12 sets of input parameters were used for the verification, and the comparison was performed for each operational guideline group, from A to G, sequentially. The verification shows that RESRAD-RDD version 1.7 and RESRAD-RDD version 2.01 generate almost identical results; the slight differences could be attributed to differences in numerical precision with Microsoft Excel and Visual Basic.NET. RESRAD-RDD version 2.01 allows the selection of different units for use in reporting calculation results. The results of SI units were obtained and compared with the base results (in traditional units) used for comparison with version 1.7. The comparison shows that RESRAD

  5. Uptake of thallium-201 in enlarged thyroid glands. Concise communication

    Energy Technology Data Exchange (ETDEWEB)

    Fukuchi, M.; Kido, A.; Hyodo, K.; Tachibana, K.; Onoue, K.; Morita, T.; Nagai, K.

    1979-08-01

    We have investigated the thyroid uptake of Tl-201 in 37 patients with various types of goiter, and in six with normal thyroids. Significant thallium uptake was found in all cases in which there was thyroid enlargement, including Graves' disease, toxic thyroid nodule, primary hypothyroidism, simple goiter, Hashimoto's disease, thyroid carcinoma, and thyroid adenoma. If goiter was absent, however, there was no demonstrable uptake - e.g., in secondary hypothyroidism, subacute thyroiditis, and the normal controls. Thallium uptake did not correlate with thyroid function tests such as BMR, T/sub 3/-RU, T/sub 3/, T/sub 4/, TSH, antithyroid antibodies, or the 24-hr I-131 uptake. In 23 patients with diffuse goiter, on the other hand, maximum Tl-201 uptake correlated well with thyroid weight: r = 0.836 (p < 0.001); y = 0.02 x + 0.06.

  6. Thallium-201 scintigraphy of the myocardium in connection with adenosine

    International Nuclear Information System (INIS)

    It is shown that thallium-201 SPECT studies of the myocardium performed subsequent to intravenous infusion of adenosine provide results at least as valuable as those from exercise thallium-201 scintigraphy in the diagnosis of coronary artery disease. The infusion of adenosine offers great advantages over exercise studies in that it is a standardized procedure uninfluenced by a patient's physical fitness, which can thus be used in all cases. There are quite a number of clinically tolerable untoward reactions that may be associated with discomfort but do not warrant discontinuation of the procedure. Serious, verifiable side-effects are rare and disappear immediately on termination of the infusion. The most recent research in this field has shown that newly developed compounds of 99mTc are also suitable for radionuclide studies of the myocardium with adenosine vasodilation. (orig.)

  7. Performance of the Microwave Anisotropy Probe AST-201 Star Trackers

    Science.gov (United States)

    Ward, David K.; vanBezooijen, Roelof; Bauer, Frank H. (Technical Monitor)

    2002-01-01

    The Microwave Anisotropy Probe (MAP) was launched to create a full-sky map of the cosmic microwave background. MAP incorporates two modified Lockheed Martin AST-201 (Autonomous Star Tracker) star trackers. The AST-201 employs an eight element radiation hardened lens assembly which is used to focus an image on a charge coupled device (CCD). The CCD image is then processed by a star identification algorithm which outputs a three-axis attitude. A CCD-shift algorithm called Time Delayed Integration (TDI) was also included in each star tracker. In order to provide some radiation effect filtering during MAP's three to five phasing loop passes through the Van Allen radiation belts, a simple pixel filtering scheme was implemented, rather than using a more complex, but more robust windowing algorithm. The trackers also include a fiber optic data interface. This paper details the ground testing that was accomplished on the MAP trackers.

  8. The clinical value of planar thallium-201 myocardial perfusion scintigraphy

    International Nuclear Information System (INIS)

    The clinical value of planar thalium-201 myocardial perfusion scintigraphy was examined, using visual and quantitative analysis, for the detection of presence, localization and extent of coronary disease, using coronary arteriography as gold standard. The indremental diagnostic yield of different noninvasive tests for the diagnosis and the severity of coronary artery disease was quantified by using multivariate discriminant analysis. (author). 284 refs.; 14 figs.; 37 tabs

  9. [Blunt abdominal trauma.--analysis of 201 cases (author's transl)].

    Science.gov (United States)

    Pannenborg, G; Wolf, O; Voigtsberger, P

    1978-01-01

    201 blunt abdominal traumata treated clinically at the surgical department of the Medical Academy in Erfurt from 1967 to 1976 are reported: No increase of blunt abdominal traumata within the period of the report in spite of considerable growth of trafficdensity and industrialization could be observed.--The percentage of severe secundary injuries remained approximately constant, too.--Intestinal lesions, combined hepatolienal ruptures caused the highest mortality especially in combination with severe craniocerebral lesions. PMID:685552

  10. Factor analysis in thallium-201 chloride thyroid studies

    International Nuclear Information System (INIS)

    Factor analysis was applied to thyroid thallium-201 imaging to get separated image of tumor from normal thyroid tissue. Thirty-eight patients with various thyroid tumors which were histologically confirmed were included in this study. Following intravenous injection of 111 MBq (3 mCi) of 201Tl chloride, thyroid images in 64 frames were taken for 30 to 60 minutes using Toshiba gamma camera system and data were analyzed by 2 or 3 factor analysis. In 28 of 38 patients separated images of the lesions from normal thyroid were obtained and time-activity curves of various shapes corresponding to the lesions were also obtained. When the curves were classified into 3 groups according to their shapes, increasing flat and decreasing, follicular carcinoma did not show increasing shape whilst neither of papillary carcinoma, squamous cell carcinoma and anaplastic carcinoma showed decreasing shape. The shapes of the curves were thought to be reflected in clearance of the agent from the lesions. Factor analysis in 201Tl chloride thyroid scan provided separated image of tumor from normal thyroid gland automatically and the obtained curves corresponding to the lesions provided information for estimating the characteristics of thyroid tumors. (author)

  11. Thallium-201 skeletal muscle imaging in myotonic muscular dystrophy

    International Nuclear Information System (INIS)

    A 34-year-old male with myotonic muscular dystrophy whose skeletal muscle involvement was demonstrated by thallium-201 whole body scintigraphy is described. The disease was diagnosed with physical examination, high serum CK level (120 - 450 i.u./ml) and typical electromyographic findings. Although he had very slight left limb weakness, his both legs showed well developed muscles without any atrophy or fasciculation and showed good pulsation of dorsalis pedis arteries. Muscle imaging was performed using digital gamma camera with twin opposed large rectangular detectors and on-line computer after intravenous injection of 2 mCi of thallium-201. Anterior and posterior data were obtained simultaneously with a 512 by 512 matrix format by the twin detectors both in front of and behind the patient. The two cameras scanned the whole body from head to feet in 15 minutes. And thallium-201 whole body image was reconstructed from the anterior and posterior data, by taking the geometric mean of the corresponding pixel values, after correction of photon attenuation of the posterior data. The whole body image showed symmetrical accumulation of thallium at scapular, deltoid, and gluteal muscles, and thallium uptake was selectively spared at left calf muscles. (author)

  12. Investigation of exercise stress whole-body thallium-201 scintigraphy

    International Nuclear Information System (INIS)

    Whole-body thallium-201 scintigraphy using supine and sitting exercise stress testings were performed to study the fractional distribution of cardiac output of the influences on exercise postures and transient myocardial ischemia in sixty-two patients with ischemic heart diseases. These patients were classified into two groups with and without transient myocardial ischemia by findings of exercise thallium-201 myocardial scintigraphy recorded at the same time. The regions of interest (ROI) were drawn over the whole body and each organ (heart, lung, liver and thigh), and then, the percent distribution (%D) was calculated in each organ. The %D of heart was little affected by transient ischemia, postures and duration of exercise, and its value was kept to be nearly 5 - 6 % in any condition. The %D of lung and liver were affected by postures, duration of exercise, transient ischemia, and %D of other organs, especially thigh. The %D of thigh was affected by duration of exercise and postures. The %D of thigh showed a reverse tendency to the %D of lung and liver. We conclude that whole-body thallium-201 scintigraphy is a useful means for evaluation of blood flow distribution induced by exercise and posture change. (author)

  13. Myocardial metabolic, hemodynamic, and electrocardiographic significance of reversible thallium-201 abnormalities in hypertrophic cardiomyopathy

    International Nuclear Information System (INIS)

    Exercise-induced abnormalities during thallium-201 scintigraphy that normalize at rest frequently occur in patients with hypertrophic cardiomyopathy. However, it is not known whether these abnormalities are indicative of myocardial ischemia. Fifty patients with hypertrophic cardiomyopathy underwent exercise 201Tl scintigraphy and, during the same week, measurement of myocardial lactate metabolism and hemodynamics during pacing stress. Thirty-seven patients (74%) had one or more 201Tl abnormalities that completely normalized after 3 hours of rest; 26 had regional myocardial 201Tl defects, and 26 had apparent left ventricular cavity dilatation with exercise, with 15 having coexistence of these abnormal findings. Of the 37 patients with reversible 201Tl abnormalities, 27 (73%) had metabolic evidence of myocardial ischemia during rapid atrial pacing compared with four of 13 patients (31%) with normal 201Tl scans (p less than 0.01). Eleven patients had apparent cavity dilatation as their only 201Tl abnormality; their mean postpacing left ventricular end-diastolic pressure was significantly higher than that of the 13 patients with normal 201Tl studies (33 +/- 5 versus 21 +/- 10 mm Hg, p less than 0.001). There was no correlation between the angiographic presence of systolic septal or epicardial coronary arterial compression and the presence or distribution of 201Tl abnormalities. Patients with ischemic ST segment responses to exercise had an 80% prevalence rate of reversible 201Tl abnormalities and a 70% prevalence rate of pacing-induced ischemia. However, 69% of patients with nonischemic ST segment responses had reversible 201Tl abnormalities, and 55% had pacing-induced ischemia. Reversible 201Tl abnormalities during exercise stress are markers of myocardial ischemia in hypertrophic cardiomyopathy and most likely identify relatively underperfused myocardium

  14. Thallium-201 distribution in the thyroid: relationship to thyroidal trapping function

    International Nuclear Information System (INIS)

    Experiments were undertaken to determine the behavior of thallium-201 in the thyroid in relation to the iodide-trapping mechanism in rats. Iodide trapping was compared to thyroidal thallium-201 trapping 30 minutes after intravenous injection. Thallium-201 uptake followed iodide uptake in control rats, TSH- and T3-treated rats but did not decrease in the same manner as iodide concentration in perchlorate-treated rats. These studies suggest that thallium-201 distribution in the thyroid may reflect the cationic side of the iodide pump or possible thyroidal blood flow

  15. Inhibition of meal stimulated gastric acid secretion by an octapeptide somatostatin analogue SMS 201-995.

    OpenAIRE

    Olsen, J A; Loud, F B; Christiansen, J

    1987-01-01

    A dose response study of the effect of an octapeptide somatostatin analogue, SMS 201-995, on meal stimulated gastric acid secretion was carried out in 12 healthy volunteers. Infusion of SMS 201-995 in a dose of 50 pmol/kg/h almost completely abolished the acid response to the meal. Pl-gastrin was significantly decreased during infusion of 10 pmol/kg/h of SMS 201-995 and insulin was significantly inhibited during infusion of 50 pmol/kg/h. SMS 201-995 in a dose of 50 pmol/kg/h inhibited basal a...

  16. Thallium-201 single-photon emission tomography in the treatment follow-up of nasopharyngeal carcinoma

    International Nuclear Information System (INIS)

    In order to assess the usefulness of thallium-201 single-photon emission tomography (SPET) in the treatment follow-up of nasopharyngeal carcinoma (NPC), a total of 75 201Tl SPET studies were performed in 18 patients with histologically proven NPC. The findings were compared with those of magnetic resonance imaging (MRI) before and after therapy. Four patients received radiotherapy alone while the other 14 received concurrent chemo-radiotherapy. Treatment response was classified as complete (CR) or partial (PR) based on the findings of MRI and 201Tl SPET. Intense 201Tl uptake by the tumour was seen in all 18 patients before treatment. After treatment, MRI showed seven CRs and 11 PRs, whereas 201Tl SPET showed 13 CRs and five PRs. In 12 patients, the results of 201Tl SPET were in agreement with those of MRI. In six patients MRI showed PR but 201Tl showed CR. Follow-up (mean 10.6 months) MRI and 201Tl SPET studies of these six patients revealed that tumour gradually decreased and finally vanished in three patients. This preliminary study indicates that 201Tl SPET has potential in the assessment of early response to treatment of patients with NPC when compared with MRI. (orig.)

  17. Clinical and experimental analysis of 201thallium uptake of the heart

    International Nuclear Information System (INIS)

    Studies were carried out in order to determine the factors influencing myocardial 201Tl uptake. A total of 158 patients was examined with regard to both 201Tl uptake and the assessment of left ventricular and coronary function. Moreover, 42 animal experiments were performed. The results demonstrate that: 1) 201Tl uptake in the normal and hypertrophied human heart is linearly correlated with the muscle mass of the left ventricle (LVMM); 2) 201Tl uptake is enhanced in the inner layer and is decreased in the outer layer of the left ventricular wall. The 201Tl uptake of the right ventricle is 40% lower in comparison to the left ventricle; 3) the basic correlation between 201Tl uptake and LVMM is influenced by alterations of both myocardial flow and myocardial oxygen consumption; and 4) inotropic interventions (isoproterenol, calcium, norepinephrine) as well as coronary dilatation (dipyridamole) may considerably augment 201Tl uptake in accordance with changes in myocardial oxygen consumption and/or myocardial flow. It is concluded that myocardial 201Tl uptake is determined by multiple factors. The major determinants have been shown to include muscle mass, myocardial flow and myocardial oxygen consumption. The clinical data obtained from patient groups with normal ventricular function, with coronary artery disease, with left ventricular wall motion abnormalities and with different degree of left ventricular hypertrophy are correlated with quantitated myocardial 201Tl uptake. (orig./MG)

  18. 29 CFR 541.201 - Directly related to management or general business operations.

    Science.gov (United States)

    2010-07-01

    ... relations, government relations; computer network, internet and database administration; legal and..., PROFESSIONAL, COMPUTER AND OUTSIDE SALES EMPLOYEES Administrative Employees § 541.201 Directly related...

  19. Nifedipine and thallium-201 myocardial perfusion in progressive systemic sclerosis

    Energy Technology Data Exchange (ETDEWEB)

    Kahan, A.; Devaux, J.Y.; Amor, B.; Menkes, C.J.; Weber, S.; Nitenberg, A.; Venot, A.; Guerin, F.; Degeorges, M.; Roucayrol, J.C.

    1986-05-29

    Heart disease in patients with progressive systemic sclerosis may be due in part to myocardial ischemia caused by a disturbance of the coronary microcirculation. To determine whether abnormalities of myocardial perfusion in this disorder are potentially reversible, we evaluated the effect of the coronary vasodilator nifedipine on myocardial perfusion assessed by thallium-201 scanning in 20 patients. Thallium-201 single-photon-emission computerized tomography was performed under control conditions and 90 minutes after 20 mg of oral nifedipine. The mean (+/- SD) number of left ventricular segments with perfusion defects decreased from 5.3 +/- 2.0 to 3.3 +/- 2.2 after nifedipine (P = 0.0003). Perfusion abnormalities were quantified by a perfusion score (0 to 2.0) assigned to each left ventricular segment and by a global perfusion score (0 to 18) for the entire left ventricle. The mean perfusion score in segments with resting defects increased from 0.97 +/- 0.24 to 1.26 +/- 0.44 after nifedipine (P less than 0.00001). The mean global perfusion score increased from 11.2 +/- 1.7 to 12.8 +/- 2.4 after nifedipine (P = 0.003). The global perfusion score increased by at least 2.0 in 10 patients and decreased by at least 2.0 in only 1. These observations reveal short-term improvement in thallium-201 myocardial perfusion with nifedipine in patients with progressive systemic sclerosis. The results are consistent with a potentially reversible abnormality of coronary vasomotion in this disorder, but the long-term therapeutic effects of nifedipine remain to be determined.

  20. IVN201--therapy with a construct containing functional fusion peptides.

    Science.gov (United States)

    Rose, Horst

    2009-01-01

    The new concept of immunotherapy with IVN201 against cat dander allergy combines two proprietary technology platforms: Intralymphatic immunotherapy (ILIT) with Modular-Antigen-Transportation (MAT) proteins. Intralymphatic immunotherapy (ILIT) is the injection of immunotherapeutics directly into the lymph node. Lymph nodes contain a high density of antigen presenting cells together with interacting T cells, which are necessary for allergen tolerance development. Therefore, this site-directed route of administration requires fewer injections of much smaller doses of the allergen than conventional administration routes to induce a highly effective, disease modifying immune response. ILIT was recently demonstrated in a clinical study to enhance safety and efficacy of immunotherapy and to reduce treatment time from 3 years to 8 weeks with only three injections, thereby significantly improving patient compliance. Patients subjectively perceived the intralymphatic injections less painful than a venous puncture. IVN201 is a functional fusion peptide which is a tailor-made recombinant allergen for ILIT with Fel d 1 as allergen module. It is designed to be rapidly taken up by antigen presenting cells in the lymph nodes and to improve the presentation of the allergen to the immune system. IVN201 was shown to induce allergen tolerance in a murine anaphylaxis model. Stimulation assays with basophil leukocytes isolated from allergic patients suggest an increased safety profile when compared to cat extract or recombinant Fel d 1. Therefore, MAT molecules are expected to be safer and more efficacious in inducing the desired immune response than recombinant allergens or allergen extracts in allergen immunotherapy when administered via the intralymphatic route. PMID:20799476

  1. Early dynamic Thallium-201 SPECT in evaluation of brain tumors

    International Nuclear Information System (INIS)

    Purpose: We performed early dynamic 201TlCl SPECT studies on patients with brain tumors to determine the value of 201TlCl dynamics for 15 minutes in distinguishing and evaluating the histologic grade of brain tumors. Method: SPECT studies were performed on 69 patients with brain tumors prior to surgical resection. Histological diagnosis was as follows: 28 patients with glioblastoma (grade IV), 8 patients with anaplastic astrocytoma (grade III), 5 patients with grade II astrocytoma, 1 patients with pilocytic astrocytoma (grade I), and 27 patients with meningioma. Pilocytic astrocytoma and grade II astrocytoma were grouped together as low-grade gliomas. Results: In glioblastomas, the Time-activity ratios(TARs) increased significantly at 6 min (99.2±6.0%, p<0.0001 ), 9 min (103.0±4.6%, p<0.0001), 12 min (102.1±6.4%, p<0.01), and 15 min (102.0±5.0%, p<0.001) after 201TlCl administration when compared to the TAR at 3 min (93.7±6.9%). Unchanged radioactivity was observed on the time-activity curve in anaplastic astrocytomas (3 min: 106.0±17.8%, 6 min: 103.8±9.4%, 9 min: 99.1±6.3%, 12 min: 95.0±11.0%, 15 min: 96.0±13.0%). The TARs decreased significantly at 6 min (104.0±7.1%, p<0.05), 9 min (96.1±4.9%, p<0.02), 12 min(95.0±6.5%, p<0.05), and 15 min (89.8±12.8%, p<0.05) compared to the TAR at 3 min (113.9±9.5%) in low grade gliomas. In meningiomas, the TARs decreased at 12 min (94.0±9.1%, p<0.01), and 15 min (93.6±12.8%, p<0.02) compared to the TAR at 3 min (108.6±18.5%) respectively. Conclusion: In this early dynamic SPECT study, the entire duration of the examination is short, 15 minutes, a period similar to other general laboratory tests. Moreover, there is no need for adjustments of the imaging location with this method since continuous scanning is utilized. This examination method indicated not only 201Tl uptake but accumulative dynamics and also offer more accurate assessment in the diagnosis of brain tumors

  2. 21 CFR 201.129 - Drugs; exemption for radioactive drugs for research use.

    Science.gov (United States)

    2010-04-01

    ... to human research subjects during the course of a research project intended to obtain basic research... labeled drug or regarding human physiology, pathophysiology, or biochemistry (but not intended for... research use. 201.129 Section 201.129 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH...

  3. 7 CFR 330.201 - Applications for permits to move plant pests.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Applications for permits to move plant pests. 330.201... HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.201 Applications for permits...

  4. 30 CFR 243.201 - How will MMS determine if I am financially solvent?

    Science.gov (United States)

    2010-07-01

    ... solvent? 243.201 Section 243.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial... making payments found in 30 CFR 218.51. You are not required to use Electronic Funds Transfer (EFT)...

  5. 7 CFR 201.58c - Detection of captan, mercury, or thiram on seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Detection of captan, mercury, or thiram on seed. 201...) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Examinations in the Administration of the Act § 201.58c Detection of captan, mercury, or thiram on seed. The bioassay method may be used according to the...

  6. 7 CFR 201.70 - Limitations of generations for certified seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Limitations of generations for certified seed. 201.70... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.70 Limitations of generations for certified...

  7. 7 CFR 201.67 - Seed certifying agency standards and procedures.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Seed certifying agency standards and procedures. 201...) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.67 Seed certifying agency standards and procedures. In order to qualify as a seed certifying agency for purposes of section 101(a)(25) of the...

  8. 7 CFR 201.48 - Kind or variety considered pure seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Kind or variety considered pure seed. 201.48 Section... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.48 Kind...

  9. 7 CFR 201.74 - Labeling of all classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Labeling of all classes of certified seed. 201.74... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.74 Labeling of all classes of certified seed....

  10. 7 CFR 201.72 - Production of all classes of certified seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Production of all classes of certified seed. 201.72... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.72 Production of all classes of certified...

  11. 48 CFR 201.109 - Statutory acquisition-related dollar thresholds-adjustment for inflation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Statutory acquisition-related dollar thresholds-adjustment for inflation. 201.109 Section 201.109 Federal Acquisition...-adjustment for inflation. (d) A matrix showing the most recent escalation adjustments of...

  12. 48 CFR 1519.201-72 - Small and disadvantaged business utilization specialists.

    Science.gov (United States)

    2010-10-01

    ... business utilization specialists. 1519.201-72 Section 1519.201-72 Federal Acquisition Regulations System... disadvantaged business utilization specialists. (a) Small Business Specialists (SBS) shall be appointed in... prescribed from time to time in furtherance of overall small and small disadvantaged business...

  13. 48 CFR 1519.201-71 - Director of Small and Disadvantaged Business Utilization.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Director of Small and Disadvantaged Business Utilization. 1519.201-71 Section 1519.201-71 Federal Acquisition Regulations System... Small and Disadvantaged Business Utilization. The Director, OSDBU, provides guidance and advice,...

  14. 48 CFR 419.201-70 - Office of Small and Disadvantaged Business Utilization (OSDBU).

    Science.gov (United States)

    2010-10-01

    ... Disadvantaged Business Utilization (OSDBU). 419.201-70 Section 419.201-70 Federal Acquisition Regulations System... and Disadvantaged Business Utilization (OSDBU). The Office of Small and Disadvantaged Business Utilization (OSDBU) develops rules, policy, procedures and guidelines for the effective administration of...

  15. 48 CFR 1401.201 - Maintenance of the Federal Acquisition Regulation (FAR).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Maintenance of the Federal Acquisition Regulation (FAR). 1401.201 Section 1401.201 Federal Acquisition Regulations System DEPARTMENT OF... Maintenance of the Federal Acquisition Regulation (FAR)....

  16. 22 CFR 201.44 - Vesting in USAID of title to commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Vesting in USAID of title to commodities. 201... APPLICABLE TO COMMODITY TRANSACTIONS FINANCED BY USAID General Provisions Relating to USAID Financing of Commodities and Commodity-Related Services § 201.44 Vesting in USAID of title to commodities. (a) Vesting...

  17. 22 CFR 201.42 - Reexport of USAID-financed commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Reexport of USAID-financed commodities. 201.42... COMMODITY TRANSACTIONS FINANCED BY USAID General Provisions Relating to USAID Financing of Commodities and Commodity-Related Services § 201.42 Reexport of USAID-financed commodities. Unless specifically...

  18. 19 CFR 201.41 - Public inspection and copying of records; applicable fees.

    Science.gov (United States)

    2010-04-01

    ... make available to interested members of the public the transcript or electronic recording of the... (9) of § 201.36. The determination of the Secretary shall be in conformity with a prior vote of the Commission under § 201.36(d) to close a portion or portions of a meeting. (b) Public inspection of...

  19. 30 CFR 204.201 - Who may obtain accounting and auditing relief?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Who may obtain accounting and auditing relief? 204.201 Section 204.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT ALTERNATIVES FOR MARGINAL PROPERTIES Accounting and Auditing Relief §...

  20. 76 FR 12712 - Announcing Draft Federal Information Processing Standard (FIPS) 201-2, Personal Identity...

    Science.gov (United States)

    2011-03-08

    ... (FIPS) 201-2, Personal Identity Verification of Federal Employees and Contractors Standard, Request for... Processing Standard (FIPS) Publication 201-2, ``Personal Identity Verification of Federal Employees and...), dated 31 July 2008, ``Final Credentialing Standards for Issuing Personal Identity Verification...

  1. 37 CFR 201.9 - Recordation of agreements between copyright owners and public broadcasting entities.

    Science.gov (United States)

    2010-07-01

    ... between copyright owners and public broadcasting entities. 201.9 Section 201.9 Patents, Trademarks, and... Recordation of agreements between copyright owners and public broadcasting entities. (a) License agreements... published pictorial, graphic, and sculptural works, and one or more public broadcasting entities, and...

  2. Value of dipyridamole stress 201Tl myocardial SPECT in detecting dysfunction of coronary microcirculation

    International Nuclear Information System (INIS)

    Objective: To evaluate the value of dipyridamole stress 201Tl myocardial SPECT in detecting dysfunction of coronary microcirculation. Methods: Forty-eight patients diagnosed with cardiac syndrome X underwent dipyridamole stress 201Tl myocardial SPECT. Dipyridamole (0.56 mg/kg) was intravenously injected over 4 min followed by 201Tl (111 MBq) injection at 2 min after dipyridamole administration. Image was acquired at 10 min and 240 min post-injection and co-analyzed by over two experienced doctors in nuclear medicine after three-dimensional reconstruction. The patients with 'reverse redistribution' underwent repeated dipyridamole stress 201Tl SPECT after medical therapy for 2 weeks. The clinical symptoms and results of the treadmill exercise test pre-and post-therapy were compared. Results: Forty two patients (42/48, 87.50%) showed segmental defects: 'reverse redistribution' on delayed (240 min)201Tl images. After medical treatment, 36 cases of the 42 'reverse redistribution' patients had improvement in both clinical symptoms and treadmill exercise test. Post-treatment 201Tl imaging showed improvement in 45/49 (91.84%) defect segments. Six of the 42 patients had no improvement in clinical symptoms and/or treadmill exercise test. Post-treatment 201Tl imaging showed no improvement in all the 7 defect segments on the first scan. Conclusion: Dipyridamole stress 201Tl myocardial SPECT may be valuable in evaluation of impaired coronary microcirculation associated with cardiac syndrome X. (authors)

  3. 21 CFR 201.200 - Disclosure of drug efficacy study evaluations in labeling and advertising.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Disclosure of drug efficacy study evaluations in labeling and advertising. 201.200 Section 201.200 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT... Commissioner of Food and Drugs from the National Academy of Sciences (1969).” As the report notes, this...

  4. 20 CFR 25.201 - How is the Special Schedule applied for employees in Australia?

    Science.gov (United States)

    2010-04-01

    ... employees in Australia? 25.201 Section 25.201 Employees' Benefits OFFICE OF WORKERS' COMPENSATION PROGRAMS... How is the Special Schedule applied for employees in Australia? (a) The special schedule of compensation established by subpart B of this part shall apply in Australia with the modifications or...

  5. 22 CFR 201.85 - Legal effect of USAID approvals and decisions.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Legal effect of USAID approvals and decisions... § 201.85 Legal effect of USAID approvals and decisions. In any transaction subject to this part 201... funds. Any decision by USAID to exercise or refrain from exercising these approval rights shall be...

  6. 22 CFR 201.15 - U.S. flag vessel shipping requirements.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false U.S. flag vessel shipping requirements. 201.15... for USAID Financing § 201.15 U.S. flag vessel shipping requirements. (a) General requirements. Unless... regarding shipping arrangements with suppliers as will assure discharge of this responsibility....

  7. 21 CFR 201.315 - Over-the-counter drugs for minor sore throats; suggested warning.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Over-the-counter drugs for minor sore throats; suggested warning. 201.315 Section 201.315 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH... anesthetic, chewing gum containing aspirin, various mouth washes and gargles and other articles sold over...

  8. 37 CFR 201.27 - Initial notice of distribution of digital audio recording devices or media.

    Science.gov (United States)

    2010-07-01

    ... distribution of digital audio recording devices or media. 201.27 Section 201.27 Patents, Trademarks, and... Initial notice of distribution of digital audio recording devices or media. (a) General. This section..., any digital audio recording device or digital audio recording medium in the United States....

  9. 21 CFR 201.16 - Drugs; Spanish-language version of certain required statements.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs; Spanish-language version of certain required statements. 201.16 Section 201.16 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF...; Spanish-language version of certain required statements. An increasing number of medications restricted...

  10. 46 CFR 13.201 - Original application for “Tankerman-PIC” endorsement.

    Science.gov (United States)

    2010-10-01

    ... application for “Tankerman-PIC” endorsement. Each applicant for an original “Tankerman-PIC” endorsement shall... 46 Shipping 1 2010-10-01 2010-10-01 false Original application for âTankerman-PICâ endorsement. 13.201 Section 13.201 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS...

  11. 7 CFR 201.31 - Germination standards for vegetable seeds in interstate commerce.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination standards for vegetable seeds in interstate commerce. 201.31 Section 201.31 Agriculture Regulations of the Department of Agriculture... Germination standards for vegetable seeds in interstate commerce. The following germination standards...

  12. 7 CFR 201.29 - Germination of vegetable seed in containers of 1 pound or less.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Germination of vegetable seed in containers of 1 pound... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Vegetable Seeds § 201.29 Germination of... a germination equal to or better than the standard set forth in § 201.31 need not be labeled to...

  13. 7 CFR 201.17 - Noxious-weed seeds in the District of Columbia.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds in the District of Columbia. 201.17... ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.17 Noxious-weed seeds in the District of Columbia. (a) Noxious-weed seeds in the District of Columbia are: Quackgrass (Elytrigia...

  14. 7 CFR 201.65 - Noxious weed seeds in interstate commerce.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious weed seeds in interstate commerce. 201.65... ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.65 Noxious weed seeds in interstate commerce. Tolerances for rates of occurrence of noxious-weed seeds shall be recognized and shall be applied to...

  15. 31 CFR 585.201 - Prohibited transactions involving blocked property; transactions with respect to securities.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Prohibited transactions involving blocked property; transactions with respect to securities. 585.201 Section 585.201 Money and Finance... transactions involving blocked property; transactions with respect to securities. (a) Except as authorized...

  16. 22 CFR 201.26 - Expenditure of marine insurance loss payments.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Expenditure of marine insurance loss payments... § 201.26 Expenditure of marine insurance loss payments. Unless otherwise authorized by USAID, any marine insurance loss payment under a marine insurance policy financed pursuant to this part 201 received by...

  17. 37 CFR 201.6 - Payment and refund of Copyright Office fees.

    Science.gov (United States)

    2010-07-01

    ...) Return of deposit copies. Copies of works deposited in the Copyright Office pursuant to law are either... Congress, or disposed of according to law. When an application is rejected, the Copyright Office reserves... Copyright Office fees. 201.6 Section 201.6 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY...

  18. 46 CFR 10.201 - General characteristics of the merchant mariner credential.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false General characteristics of the merchant mariner credential. 10.201 Section 10.201 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN MERCHANT MARINER CREDENTIAL General Requirements for All Merchant Mariner...

  19. Myocardial viability assessed by Tl-201 SPECT. Redistribution versus reinjection; Estudo da viabilidade miocardica atraves do SPECT-talio-201. Redistribuicao convencional versus reinjecao

    Energy Technology Data Exchange (ETDEWEB)

    Chalela, William Azem; Pimentel, Flavio Ferrarini de Oliveira; Uchida, Augusto Hiroshi; Bottega, Augusto; Ramires, Jose Antonio Franchine; Izaki, Marisa; Moraes, Aguinaldo Pereira; Soares Junior, Jose; Giorgi, Maria C. Pinto; Moffa, Paulo Jorge; Bellotti, Giovanni; Giovanni Guido Cerri; Meneghetti, Jose Claudio [Sao Paulo Univ., SP (Brazil). Faculdade de Medicina. Instituto do Coracao

    1994-07-01

    The purpose of this study was to verify if a third series of images acquired by reinjection thallium-201, 24 h after conventional myocardial perfusion with the radioisotope, improves the identification of myocardial viability segments. The methods: we studied 30 patients, mean age 57.7 {+-}9.4 years, with old myocardial infarction using thallium (Tl)-201 SPECT, and we obtained three series of images (stress, redistribution after 4 h and reinjection after 24 h). Cardiac images were divided in 5 segments (apical, lateral, anterior, septal and inferior) and each one received a value by a score system according to the Tl-201 myocardial uptake (0=normal uptake; 1=mild hypoperfusion; 2=moderate hypoperfusion; 3=severe hypoperfusion or no myocardial uptake). We considered viable myocardium when the uptake of Tl-201 in the segment related to the myocardial infarction increases at least 1 point in two different axis of Tl-201 SPECT. The results: seven (23,3%) patients demonstrated increase of Tl-201 uptake only at reinjection images, showing a high efficacy of the method. Nine (30%) patients showed persistent hypoperfusion at all series of images suggesting only fibrosis in the are related to the infarction. Fourteen (46,7%) patients showed increase of Tl-201 concentration at redistribution images; among these patients, six showed improvement of myocardial uptake at reinjection. This condition was interpreted as regional chronic ischemic process: hibernating myocardium. The conclusion was that Tl-201 hypoperfusion at redistribution images without significant changes in relation to the stress images do not represent fibrosis at all. The reinjection technic was better than conventional redistribution in the detection of viable myocardium. This data allows a better therapeutic orientation. (author)

  20. 201Tl in myocardial diagnosis: studies on the influence of dipyridamole, dobutamine ergometer exercise and background subtraction on the 201Tl myocadial scintiscam

    International Nuclear Information System (INIS)

    Changes in 201Tl myocardial scintiscans upon administration of dipyridamole or dobutamine and upon ergometer exercise relative to scintiscans at rest were investigated as well as the influence of myocardial background subtraction on scintiscan quality and information. A total of 90 201Tl examinations were carried out in 59 patients. 18 patients had no myocardial disease, 30 patients had a coronary disease, 5 patients suffered from cardiomyopathy and 6 from left ventricular hypertrophy. The findings are discussed in detail. (orig.)

  1. Development of international standards for surface analysis by ISO technical committee 201 on surface chemical analysis

    International Nuclear Information System (INIS)

    Full text: The International Organization for Standardization (ISO) established Technical Committee 201 on Surface Chemical Analysis in 1991 to develop documentary standards for surface analysis. ISO/TC 201 met first in 1992 and has met annually since. This committee now has eight subcommittees (Terminology, General Procedures, Data Management and Treatment, Depth Profiling, AES, SIMS, XPS, and Glow Discharge Spectroscopy (GDS)) and one working group (Total X-Ray Fluorescence Spectroscopy). Each subcommittee has one or more working groups to develop standards on particular topics. Australia has observer-member status on ISO/TC 201 and on all ISO/TC 201 subcommittees except GDS where it has participator-member status. I will outline the organization of ISO/TC 201 and summarize the standards that have been or are being developed. Copyright (1999) Australian X-ray Analytical Association Inc

  2. Effects of smoking on lung uptake of 201Tl during exercise myocardial perfusion imaging

    International Nuclear Information System (INIS)

    Objective: To investigate the influence of smoking on lung uptake of 201Tl during myocardial perfusion imaging. Methods: Ninety-two healthy subjects, with normal 201Tl myocardial perfusion imaging findings but no evidence of left ventricular hypertrophy and pulmonary disease, were divided into three groups, smoker, nonsmoker and quitted smoker groups. Exercise/delay 201Tl myocardial perfusion imaging was performed on all subjects included. Lung/heart ratio was defined on the anterior planar image obtained during exercise tomography. Results: Both the lung/heart ratios during exercise in smoker (0.40 ± 0.07, F=10.635, P201Tl lung/heart ratios in smokers are higher than in nonsmokers and this must be kept in mind when 201Tl lung/heart ratios are used clinically, even in quitted smokers

  3. Effect of a somatostatin analogue, SMS 201-995, on 133Xe clearance from colonic muscosa in unanesthetized man

    International Nuclear Information System (INIS)

    The effect of intravenous bolus injection of the somatostatin analogue SMS 201-995 on mucosal and submucosal blood flow was studied with the local 133Xe clearance technique in eight subjects. Mucosal and submocosal blood flow decreased by 33% after injection of SMS 201-995. These observations suggest that SMS 201-995, like somatostatin, inhibits splanchnic blood flow

  4. 37 CFR 201.26 - Recordation of documents pertaining to computer shareware and donation of public domain computer...

    Science.gov (United States)

    2010-07-01

    ... pertaining to computer shareware and donation of public domain computer software. 201.26 Section 201.26... GENERAL PROVISIONS § 201.26 Recordation of documents pertaining to computer shareware and donation of public domain computer software. (a) General. This section prescribes the procedures for submission...

  5. 21 CFR 201.307 - Sodium phosphates; package size limitation, warnings, and directions for over-the-counter sale.

    Science.gov (United States)

    2010-04-01

    ..., warnings, and directions for over-the-counter sale. 201.307 Section 201.307 Food and Drugs FOOD AND DRUG... Requirements for Specific Drug Products § 201.307 Sodium phosphates; package size limitation, warnings, and directions for over-the-counter sale. (a) Reports in the medical literature and data accumulated by the...

  6. 37 CFR 201.39 - Notice to Libraries and Archives of Normal Commercial Exploitation or Availability at Reasonable...

    Science.gov (United States)

    2010-07-01

    ... Archives of Normal Commercial Exploitation or Availability at Reasonable Price. 201.39 Section 201.39... GENERAL PROVISIONS § 201.39 Notice to Libraries and Archives of Normal Commercial Exploitation or... subject to normal commercial exploitation, or that a copy or phonorecord of the work can be obtained at...

  7. 27 CFR 26.201c - Shipments of bulk distilled spirits to the United States without payment of tax.

    Science.gov (United States)

    2010-04-01

    ... distilled spirits to the United States without payment of tax. 26.201c Section 26.201c Alcohol, Tobacco... Virgin Islands § 26.201c Shipments of bulk distilled spirits to the United States without payment of tax. Bulk distilled spirits may be brought into the United States from the Virgin Islands without payment...

  8. Thallium-201 myocardial scintigraphy on coronary vasodilator, dipyridamole

    International Nuclear Information System (INIS)

    Thallium-201 myocardial scintigraphy on coronary vasodilator, dipyridamole was done to assess their coronary perfusion reserves in 51 patients with suspected angina pectoris. In comparison with coronary arteriography (CAG), sensitivity, specificity and accuracy of this method for 75% coronary stenosis were 0.70, 0.89 and 0.76 respectively. For further analysis, stenotic lesions on CAG were classified into the groups of three coronary vessels and were compared with myocardial scintigrams. Sensitivity was 0.48, however specificity was 0.98, which was very high. From this result, it can be said that a decrease in thallium uptake on scintigram reflects the reduction of regional coronary perfusion reserve accurately. To assess individual stenotic lesion, detectability of the stenoses of left distal coronary artery was low, which could be due to the limitation of spatial resolution of γ-camera. In 33 patients with 75% coronary stenosis, 36% of them had chest pain and 57% had ST-T change on ECG. These side effects disappeared rapidly with intravenous injection of aminophylline, antagonist of dipyridamole. In conclusion, thallium-201 myocardial scintigraphy on dipyridamole is safe and accurate method to assess regional coronary perfusion reserve. (author)

  9. Evaluation of Tl-201 SPECT imaging findings in prostate cancer

    Directory of Open Access Journals (Sweden)

    Sinem Ozyurt

    2015-07-01

    Full Text Available Objectives: To compare with histopathological findings the findings of prostate cancer imaging by SPECT method using Tl-201 as a tumor seeking agent. Methods: The study comprised 59 patients (age range 51-79 years, mean age 65.3 ± 6.8 years who were planned to have transrectal ultrasonography (TRUS-guided biopsies due to suspicion of prostate cancer between April 2011 and September 2011. Early planar, late planar and SPECT images were obtained for all patients. Scintigraphic evaluation was made in relation to uptake presence and patterns in the visual assessment and to Tumor/Background (T/Bg ratios for both planar and SPECT images in the quantitative assessment. Histopathological findings were compatible with benign etiology in 36 (61% patients and malign etiology in 23 (39% patients. Additionally, comparisons were made to evaluate the relationships between uptake patterns,total PSA values and Gleason scores. Results: A statistically significant difference was found between the benign and malignant groups in terms of uptake in planar and SPECT images and T/Bg ratios and PSA values. No statistically significant difference was found between uptake patterns of planar and SPECT images and Gleason scores in the malignant group. Conclusions: SPECT images were superior to planar images in the comparative assessment. Tl-201 SPECT imaging can provide an additional contribution to clinical practice in the diagnosis of prostate cancer and it can be used in selected patients.

  10. Effect of insulin on the tissue distribution of thallium-201

    International Nuclear Information System (INIS)

    Translocation of potassium under the influence of insulin has been repeatedly demonstrated by various investigators during the past 50 years. Accordingly, it is expected that insulin administration would affect the distribution pattern of the potassium analogue thallium-201. To test the validity of this assumption, the present study was performed on 46 rabbits, with an average weight of 3.9 +- 0.8 pounds. To study the effects of the factors involved in the administration of insulin and its dosage, the rabbits were divided into groups; each group being studied on a separate day. The experimental animals were sacrificed exactly 10 minutes after the intravenous injection of radiothallium. The results of the present study showed that thallium-201 uptake per gram tissue varied from one batch to another. However, the radioactivity uptake per gram by the different organs showed a constant pattern. Among the organs studied, the highest level of radioactivity per gram was encountered in the kidneys and heart, followed by the lungs. Then came the liver and lastly the striated muscles. Insulin administration caused an increase in the radioactivity uptake in all the organs studied. The magnitude of this increment was highest in the heart, kidneys and lungs; moderate in the liver, and slight in the striated muscles. In addition, the effect of insulin occurred at an optimum time that varied with the route of administration and was dose related up to a certain level. (author)

  11. Diagnosis of ventricular aneurysm on Tl-201 myocardial scintigraphy

    International Nuclear Information System (INIS)

    Author has proposed ''open beak sign'' (outward extension of left ventricular wall at the edge of scintigraphic hypoperfusion) and ''double chamber sign'' (division of left ventricular cavity) as new observations on planar images of Tl-201 myocardial scintigraphy for diagnosis of ventricular aneurysm. Open beak sign and/or double chamber sign could be detectable in 55 of the 60 myocardial infarctions with ventricular aneurysm, while, 4 of the 162 myocardial infarctions without ventricular aneurysm showed these signs. Thus both open beak sign and double chamber sign for the detection of ventricular aneurysm had a sensitivity of 91.7 %, a specificity of 97.5 %, and an accuracy of 95.9 %. Open beak sign was well demonstrated in middle-sized ventricular aneurysm (17 of the 18 aneurysms, 94.4 %). Detectability of double chamber sign was poor in small ventricular aneurysm (4 of the 10 aneurysms, 40.0 %), and good in large ventricular aneurysm (11 of the 13 aneurysms, 84.6 %). In comparison of rest scan with exercise scan, rest scan was more sensitive for open beak sign and detectability of open beak sign correlated with ischemia at the edge of scintigraphic hypoperfusion based on analysis of coronary arteriography. This report has revealed diagnostic efficacy of Tl-201 myocardial scintigraphy for the detection of ventricular aneurysm. (author)

  12. Synthesis and in vivo evaluation of {sup 201}Tl(III)-DOTA complexes for applications in SPECT imaging

    Energy Technology Data Exchange (ETDEWEB)

    Hijnen, Nicole M.; Vries, Anke de [Biomedical NMR, Department of Biomedical Engineering, Eindhoven University of Technology, 5600 MB Eindhoven (Netherlands); Blange, Roy [Department of Biomolecular Engineering, Antwerp University, 2610 Antwerp (Belgium); Burdinski, Dirk [Department of Biomolecular Engineering, Philips Research, 5656 AE Eindhoven (Netherlands); Gruell, Holger, E-mail: h.gruell@tue.n [Biomedical NMR, Department of Biomedical Engineering, Eindhoven University of Technology, 5600 MB Eindhoven (Netherlands); Department of Biomolecular Engineering, Philips Research, 5656 AE Eindhoven (Netherlands)

    2011-05-15

    Introduction: The aim of this study was to assess the use of {sup 201}thallium{sup 3+} ({sup 201}Tl{sup 3+}) as a radiolabel for nuclear imaging tracers. Methods for labeling of 1,4,7,10-tetraazacyclododecane-N,N',N'',N''' tetraacetic acid (DOTA) and diethylenetriaminepentaacetic acid (DTPA) chelators with {sup 201}Tl{sup 3+} were investigated, and the levels of stability of these chelates were tested in vitro and in vivo. Methods: {sup 201}Tl(I)Cl was treated with hydrochloric acid and ozone to form {sup 201}Tl(III)Cl{sub 3}. The procedure for labeling of DOTA and DTPA was optimized, testing different buffer solutions and pH values. The stability levels of {sup 201}Tl(III)-DOTA and {sup 201}Tl(III)-DTPA were assessed in buffer, mouse serum and human serum (1:1, v/v) at a temperature of 310 K for 48 h. Subsequently, in vivo stability studies with {sup 201}Tl(III)-DOTA were performed, comparing the biodistribution of {sup 201}Tl(III)-DOTA with that of {sup 201}Tl(I)Cl in a single-isotope study and with that of {sup 177}Lu(III)-DOTA in a dual-isotope single photon emission computed tomography study. Results: {sup 201}Tl(III)-DTPA, {sup 201}Tl(III)-DOTA and {sup 177}Lu(III)-DOTA were prepared with >95% radiochemical purity. While {sup 201}Tl(III)-DOTA showed a prolonged level of stability in buffer and serum, {sup 201}Tl was quickly released from DTPA in serum. Apart from some urinary excretion, the biodistribution of DOTA-chelated {sup 201}Tl{sup 3+} was similar to that of free (ionic) {sup 201}Tl{sup +} and did not match the biodistribution of {sup 177}Lu(III)-DOTA. This indicated a limited stability of {sup 201}Tl(III)-DOTA complexes in vivo. Conclusion: Despite promising results on the labeling and in vitro stability of {sup 201}Tl(III)-DOTA, our in vivo results indicate that the integrity of {sup 201}Tl(III)-DOTA decreases to <20% during the time required for urinary excretion, thereby limiting the use of {sup 201}Tl{sup 3+} as a

  13. Synthesis and in vivo evaluation of 201Tl(III)-DOTA complexes for applications in SPECT imaging

    International Nuclear Information System (INIS)

    Introduction: The aim of this study was to assess the use of 201thallium3+ (201Tl3+) as a radiolabel for nuclear imaging tracers. Methods for labeling of 1,4,7,10-tetraazacyclododecane-N,N',N'',N''' tetraacetic acid (DOTA) and diethylenetriaminepentaacetic acid (DTPA) chelators with 201Tl3+ were investigated, and the levels of stability of these chelates were tested in vitro and in vivo. Methods: 201Tl(I)Cl was treated with hydrochloric acid and ozone to form 201Tl(III)Cl3. The procedure for labeling of DOTA and DTPA was optimized, testing different buffer solutions and pH values. The stability levels of 201Tl(III)-DOTA and 201Tl(III)-DTPA were assessed in buffer, mouse serum and human serum (1:1, v/v) at a temperature of 310 K for 48 h. Subsequently, in vivo stability studies with 201Tl(III)-DOTA were performed, comparing the biodistribution of 201Tl(III)-DOTA with that of 201Tl(I)Cl in a single-isotope study and with that of 177Lu(III)-DOTA in a dual-isotope single photon emission computed tomography study. Results: 201Tl(III)-DTPA, 201Tl(III)-DOTA and 177Lu(III)-DOTA were prepared with >95% radiochemical purity. While 201Tl(III)-DOTA showed a prolonged level of stability in buffer and serum, 201Tl was quickly released from DTPA in serum. Apart from some urinary excretion, the biodistribution of DOTA-chelated 201Tl3+ was similar to that of free (ionic) 201Tl+ and did not match the biodistribution of 177Lu(III)-DOTA. This indicated a limited stability of 201Tl(III)-DOTA complexes in vivo. Conclusion: Despite promising results on the labeling and in vitro stability of 201Tl(III)-DOTA, our in vivo results indicate that the integrity of 201Tl(III)-DOTA decreases to 201Tl3+ as a radiolabel for tracer imaging.

  14. Thallium-201 myocardial imaging in children with heart disease

    International Nuclear Information System (INIS)

    201-TlCl myocardial imaging studies were performed to evaluate systolic pressure of right ventricle on 107 patients including 89 patients with congenital cardiac disease, patients with primary pulmonary hypertension and 13 patients with history of MCLS with the age range of 2 months to 17 years. The congenital cardiac disease group included 30 patients with tetralogy of Fallot, 8 patients with pulmonary stenosis (included 1 patient with double chambered right ventricle), 20 patients with ventricular septal defect, 10 patients with patent ductus arteriosus, 9 patients with atrial septal defect and 12 patients with complete transposition of greate arteries. None of the patients with history of MCLS had coronary involvement. 50 μCi/kg of 201-TlCl was infused intravenously and after 15 minutes the images were obtained from 5 directions (anterior, LAO 30, LAO 45, LAO 60 and lateral). The angle was determined to demonstrate the intraventricular septum and ventricular free walls cleary separated. The image of end-diastolic phase was obtained with ECG syncronized gated method from that direction. The ROI (region of interest) was defined as a slice line by drawing two lines perpendicular to the septum and the counts of the left and right ventricular free wall (Cl and Cr) were analized to evaluate the pressure of right ventricle. The pressure of ventricles were obtained by cardiac catheterization performed at the same time with myocardial imaging. The ratio of Cl and Cr (Cr/Cl) had good correlation with the ratio of peak systolic pressure of left ventricle and right ventricle (regression equation Y=0.84X+0.08, r=0.87). In each congenital heart disease group, very good corelation was also demonstrated (Y=1.46X-0.30, r=0.96 in PS ; Y=0.70X0.20, r=0.91 in VSD ; Y=0.86X+0.15, r=0.78 in ASD and Y=0.72X+0.24, r=0.80 in PDA). Thus 201-TlCl myocardial imaging was useful method to evaluate right ventricular pressure noninvasively in congenital cardiac disease. (author)

  15. Clinical usefulness of {sup 201}Tl SPECT in diagnosing nasopharyngeal tumor

    Energy Technology Data Exchange (ETDEWEB)

    Togawa, Takashi; Yui, Nobuharu; Hatano, Kazuo; Takeuchi, Yousuke; Hayasaki, Katsutake [Chiba Cancer Center (Japan); Omura, Ken [Tokyo Medical and Dental Univ. (Japan). Graduate School

    2003-03-01

    {sup 201}Tl SPECT was performed on 54 patients suspected of nasopharyngeal tumor using a three-head rotating gamma camera and its clinical usefulness was evaluated. {sup 201}Tl accumulations were shown in 53 of the 54 patients (50 nasopharyngeal carcinoma, 1 malignant melanoma and 2 lymphoid hyperplasia) before treatment. In 48 of 50 patients with nasopharyngeal carcinoma, the effectiveness for treatment response could be assessed after treatment. {sup 201}Tl SPECT was concordant with MRI and CT in 26 patients (15 complete response (CR), 11 partial response (PR)), whereas it was discordant in 22 patients who showed CR in {sup 201}Tl SPECT but PR in MRI and CT. Follow-up MRI and {sup 201}Tl SPECT studies of 16 of these 22 patients from 6 to 33 months (mean 13 months) after treatment revealed that the tumor gradually decreased and finally vanished. Recurrent and metastatic lesions occurred in 8 patients from 9 to 69 months (mean 24 months) after treatment, and {sup 201}Tl SPECT could detect all 10 lesions in 8 patients. From the results obtained, it was concluded that {sup 201}Tl SPECT is very useful in the initial evaluation, in the assessment of treatment response and in detecting recurrent and metastatic lesions of nasopharyngeal tumor. (author)

  16. The effects of chemical and radioactive properties of Tl-201 on human erythrocyte glutathione reductase activity

    International Nuclear Information System (INIS)

    Aim: The aim of the study was to evaluate the inhibitory effects of thallium-201 (201Tl) solution on human erythrocyte glutathione reductase (GR) activity. Methods: Erythrocyte GR was initially purified by 2′,5′-adenosine diphosphate Sepharose-4B affinity and Sephadex G-200 gel filtration chromatography. The purification was monitored by sodium dodecyl sulfate–polyacrylamide gel electrophoresis, which showed a single band for the final enzyme preparation. The in vitro and in vivo effects of the 201Tl solution including Tl+, Fe+3 and Cu+2 metals and the in vitro effects of the radiation effect of the 201Tl solution and nonradioactive Tl+, Fe+3 and Cu+2 metals on human erythrocyte GR enzyme were studied. Enzyme activity was determined with the Beutler method at 340 nm using a spectrophotometer. All purification procedures were carried out at +4°C. Results: Glutathione reductase was purified 2033-fold at a yield of 28.17%. 201Tl solution and radiation exposure had inhibitory effects on the enzyme activity. Besides, effects of nonradioactive Tl+, Fe+3 and Cu+2 were studied on enzyme activity in vitro. Furthermore, seven human patients were also used for in vivo studies of 201Tl solution. Conclusion: It was detected in in vitro and in vivo studies that the human erythrocyte GR enzyme is inhibited due to the radiation effect of 201Tl solution.

  17. Preoperative evaluation of brain lesion with 201TI brain SPECT: is it useful to differentiate benign and malignant lesions?

    International Nuclear Information System (INIS)

    Thallium-201 (201TI) brain SPECT, which can represent cellular activity of brain lesions, may provide more useful information in differentiating between benign and malignant brain lesions more so than CT or MRI, that merely represents anatomic changes or breakdown of blood brain barrier. We used 201TI brain SPECT prospectively to evaluate the utility of 201TI-indices as an indicator of benign or malignant lesions. We studied 28 patients. There were 13 cases of benign lesions (3: nonspecific benign lesion, 3: meningioma, 2: low grade glioma, 1: tuberculoma, central neurocytoma, hemangioblastoma, radiation necrosis, and choroid plexus papilloma) and 15 cases of malignant lesions (6: glioblastoma multiforme, 5: anaplastic glioma, 2: medulloblastoma, 1: metastasis and lymphoma). In all patients, CT and/or MRI were obtained and then 201TI brain SPECT was obtained with measuring mean 201TI index and peak 201TI index. An unpaired t-test was performed to compare the 201TI-indices and pathologic diagnoses to evaluate the utility of 201TI-indices as an indicator of benign or malignant lesions. There were no statistically significant difference in 201TI-indices between benign and malignant brain lesions (P>0.05). These results demonstrated that we could not use 201TI indices on brain SPECT alone as an indicator of benign or malignant brain lesions

  18. Preoperative evaluation of brain lesion with {sup 201}TI brain SPECT: is it useful to differentiate benign and malignant lesions?

    Energy Technology Data Exchange (ETDEWEB)

    Sohn, Hyung Sun; Kim, Euy Neyng; Kim, Sung Hoon; Chung, Yong An; Chung, Soo Kyo; Hong, Yong Gil; Lee, Youn Soo [College of Medicine, The Catholic Univ., Seoul (Korea, Republic of)

    2000-10-01

    Thallium-201 ({sup 201}TI) brain SPECT, which can represent cellular activity of brain lesions, may provide more useful information in differentiating between benign and malignant brain lesions more so than CT or MRI, that merely represents anatomic changes or breakdown of blood brain barrier. We used {sup 201}TI brain SPECT prospectively to evaluate the utility of {sup 201}TI-indices as an indicator of benign or malignant lesions. We studied 28 patients. There were 13 cases of benign lesions (3: nonspecific benign lesion, 3: meningioma, 2: low grade glioma, 1: tuberculoma, central neurocytoma, hemangioblastoma, radiation necrosis, and choroid plexus papilloma) and 15 cases of malignant lesions (6: glioblastoma multiforme, 5: anaplastic glioma, 2: medulloblastoma, 1: metastasis and lymphoma). In all patients, CT and/or MRI were obtained and then {sup 201}TI brain SPECT was obtained with measuring mean {sup 201}TI index and peak {sup 201}TI index. An unpaired t-test was performed to compare the {sup 201}TI-indices and pathologic diagnoses to evaluate the utility of {sup 201}TI-indices as an indicator of benign or malignant lesions. There were no statistically significant difference in {sup 201}TI-indices between benign and malignant brain lesions (P>0.05). These results demonstrated that we could not use {sup 201}TI indices on brain SPECT alone as an indicator of benign or malignant brain lesions.

  19. Effect of eating on thallium-201 myocardial redistribution after myocardial ischemia

    International Nuclear Information System (INIS)

    To determine whether eating a high-carbohydrate meal between initial and delayed postexercise thallium-201 (Tl-201) imaging affects detection of Tl-201 redistribution during exercise stress testing, 16 patients with stable angina performed 2 Tl-201 treadmill exercise stress tests within a 14-day interval. Immediately after initial postexercise imaging, patients either drank a commercially available instant breakfast preparation for the intervention test or drank an equivalent volume of water for the control test. Comparable exercise workloads were achieved by exercising patients to the same heart rate for both tests. The order of the 2 (intervention and control) tests were randomized. All patients had at least 1 region of Tl-201 myocardial redistribution on either their eating or control test scans, although only 7 of the 16 had positive treadmill exercise test responses. Forty-six regions showing Tl-201 myocardial redistribution were identified in all 144 regions examined. Significantly more of these regions were identified on control test scans than on eating test scans: 11 of 46 on both test scans, 6 of 46 only on eating test scans and 29 of 46 only on control scans (p less than 0.001). Consistent with results of the quantitative regional analysis, the percentage of Tl-201 clearance over 4 hours in the 46 Tl-201 myocardial redistribution regions was 39 +/- 8% for the eating tests and 29 +/- 8% for control tests (mean +/- standard deviation, p less than 0.003). In 4 patients diagnosis of transient ischemia would have been missed because their 14 Tl-201 myocardial redistribution regions were detected only on the control test scans

  20. Codon 201Gly Polymorphic Type of the DCC Gene is Related to Disseminated Neuroblastoma

    Directory of Open Access Journals (Sweden)

    Xiao-Tang Kong

    2001-01-01

    Full Text Available The deleted in colorectal carcinoma (DCC gene is a potential tumor- suppressor gene on chromosome 18821.3. The relatively high frequency of loss of heterozygosity (LOH and loss of expression of this gene in neuroblastoma, especially in the advanced stages, imply the possibility of involvement of the DCC gene in progression of neuroblastoma. However, only few typical mutations have been identified in this gene, indicating that other possible mechanisms for the inactivation of this gene may exist. A polymorphic change (Arg to Gly at DCC codon 201 is related to advanced colorectal carcinoma and increases in the tumors with absent DCC protein expression. In order to understand whether this change is associated with the development or progression of neuroblastoma, we investigated codon 201 polymorphism of the DCC gene in 102 primary neuroblastomas by polymerase chain reaction single-strand conformation polymorphism. We found no missense or nonsense mutations, but a polymorphic change from CGA (Arg to GGA (Gly at codon 201 resulting in three types of polymorphism: codon 201Gly type, codon 201Arg/Gly type, and codon 201Arg type. The codon 201Gly type occurred more frequently in disseminated (stages IV and IVs neuroblastomas (72% than in localized (stages I, II, and III tumors (48% (P=.035, and normal controls (38% (P=.024. In addition, the codon 201Gly type was significantly more common in tumors found clinically (65% than in those found by mass screening (35% (P=.002. The results suggested that the codon 201Gly type of the DCC gene might be associated with a higher risk of disseminating neuroblastoma.

  1. Effect of eating on thallium-201 myocardial redistribution after myocardial ischemia

    Energy Technology Data Exchange (ETDEWEB)

    Angello, D.A.; Wilson, R.A.; Palac, R.T.

    1987-09-01

    To determine whether eating a high-carbohydrate meal between initial and delayed postexercise thallium-201 (Tl-201) imaging affects detection of Tl-201 redistribution during exercise stress testing, 16 patients with stable angina performed 2 Tl-201 treadmill exercise stress tests within a 14-day interval. Immediately after initial postexercise imaging, patients either drank a commercially available instant breakfast preparation for the intervention test or drank an equivalent volume of water for the control test. Comparable exercise workloads were achieved by exercising patients to the same heart rate for both tests. The order of the 2 (intervention and control) tests were randomized. All patients had at least 1 region of Tl-201 myocardial redistribution on either their eating or control test scans, although only 7 of the 16 had positive treadmill exercise test responses. Forty-six regions showing Tl-201 myocardial redistribution were identified in all 144 regions examined. Significantly more of these regions were identified on control test scans than on eating test scans: 11 of 46 on both test scans, 6 of 46 only on eating test scans and 29 of 46 only on control scans (p less than 0.001). Consistent with results of the quantitative regional analysis, the percentage of Tl-201 clearance over 4 hours in the 46 Tl-201 myocardial redistribution regions was 39 +/- 8% for the eating tests and 29 +/- 8% for control tests (mean +/- standard deviation, p less than 0.003). In 4 patients diagnosis of transient ischemia would have been missed because their 14 Tl-201 myocardial redistribution regions were detected only on the control test scans.

  2. Biphasic 201thallium scintgraphy after dipyridamole in mitral valve diseases

    International Nuclear Information System (INIS)

    The results of biphasic 201thallium scintigraphy after dipyridamole i.v. could neither prove nor exclude the presence of small focal lesions in the myocardium of 17 patients with mitral valve diseases. The frequent finding of a decrease in activity in the anterolateral myocardium is probably due to a relative increase in activity in the region of the inferior wall with superimposed areas of the papillary muscle and right ventricular myocardium. If the right ventricle is visualized in stress- or redistribution images, an increase in mean pulmonary artery pressure can be accepted. According to Cohen's criteria, a grade 2 or 3 virtually proves the existence of pulmonary hypertension, a grade 1 makes this finding rather probable. The possibility of pulmonary hypertension can not be excluded if the right ventricular myocardium is not visualized. (orig.)

  3. 201 MHz Cavity R and D for MUCOOL and MICE

    International Nuclear Information System (INIS)

    We describe the design, fabrication, analysis and preliminary testing of the prototype 201 MHz copper cavity for a muon ionization cooling channel. Cavity applications include the Muon Ionization Cooling Experiment (MICE) as well as cooling channels for a neutrino factory or a muon collider. This cavity was developed by the US muon cooling (MUCOOL) collaboration and is being tested in the MUCOOL Test Area (MTA) at Fermilab. To achieve a high accelerating gradient, the cavity beam irises are terminated by a pair of curved, thin beryllium windows. Several fabrication methods developed for the cavity and windows are novel and offer significant cost savings as compared to conventional construction methods. The cavity's thermal and structural performances are simulated with an FEA model. Preliminary high power RF commissioning results will be presented

  4. Thallium-201 for myocardial imaging: appearance of the normal heart

    International Nuclear Information System (INIS)

    Thallium-201 myocardial perfusion images were obtained from 13 healthy adults after tracer administration both at rest and at maximal stress. On the rest-injected scan, tracer was seen in left ventricular myocardium, liver, and spleen. In two subjects with resting tachycardia, the right ventricular myocardium was slightly visualized after tracer injection at rest. When tracer was administered at stress, the left ventricular activity was more nearly homogeneous and the left ventricle was better defined on the scan. The left-ventricle-to-lung-background activity ratio increased from 2.4 at rest to 3.4 at stress. The right ventricular myocardium was seen on the stress-injected scan. Phantom studies, performed to define the optimum position for visualization of lesions, showed that small lesions were best defined when seen either en face or in tangent. Scans should be performed at stress whenever possible and multiple views are essential

  5. Diagnostic advantages of the association of electrocardiograms and thallium 201 exercise scintigraphy in detecting coronary disease

    International Nuclear Information System (INIS)

    Thallium 201 exercise scintigraphy combined with 14-lead exercise electrocardiography detects coronary artery disease in 95-96 percent of the patients, whether men or women. When both tests were positive, 93 percent of the men and 100 percent of the women had coronary artery disease. In women, thallium 201 seems to do better than 14-lead exercise electrocardiogram, detecting the presence of coronary artery disease in 72 percent and its absence in 83 percent of the cases. In approximately 50 percent of the cases, the results of thallium 201 and multiple-lead exercise testing were discordant; in these cases, an accurate clinical history is helpful. (author)

  6. An autopsied case of cardiomyopathy demonstrated specific findings by thallium-201 myocardial scintigraphy

    International Nuclear Information System (INIS)

    A few cases showing dilatation and decreased contraction of the left ventricle at the terminal stage of hypertrophic cardiomyopathy (dilated-HCM) have been reported. Recently, we experienced a case of dilated-HCM and compared thallium-201 myocardial scintigraphic findings with histological findings. Thallium-201 myocardial scintigraphic findings resembled that of dilated cardiomyopathy (dilated biventricle and large perfusion defect). But, histological findings revealed large fibrosis and disarray of myocardial cells. These observation from thallium-201 myocardial scintigraphy was useful for the assessment of myocardial fibrosis of hypertrophic cardiomyopathy. (author)

  7. Usefulness of 201Tl SPECT in the evaluation of treatment effect for primary lung cancer

    International Nuclear Information System (INIS)

    Thallium-201 single photon emission computed tomography (201Tl SPECT) was performed on 20 patients with primary lung cancer before and after treatment (radiotherapy alone or combination of chemotherapy and radiotherapy). They were divided into early recurrence group and no recurrence group by presence of local tumor regrowth within 6 months after treatment. Retention index (Ret. I) after treatment was significantly lower (p201Tl SPECT indicated viability of residual mass, so it was useful in the evaluation of treatment effect for primary lung cancer. (author)

  8. sup(99m)Tc-pyrophosphate and 201Tl myocardial scintigrams in a patient with myocarditis

    International Nuclear Information System (INIS)

    Myocardial necrosis in acute myocarditis was investigated by scintigraphy. sup(99m)Tc-pyrophosphate (PYP) and 201TI myocardial scintigrams were obtained on a patient with acute myocarditis due to mycoplasma infection. sup(99m)Tc-PYP myocardial scintigrams in the acute stage demonstrated grade 2+ findings, which remained until the chronic stage. 201TI myocardial scintigrams in the acute stage revealed impaired perfusion restricted to the posterolateral wall, and this decrease continued through the chronic stage. It was concluded that both of sup(99m)Tc-PYP and 201TI myocardial scintigrams can reveal abnormality of acute myocarditis. (Ueda, J.)

  9. 201Hg excitation in plasma produced by laser

    International Nuclear Information System (INIS)

    The use of high power lasers allows the study of the properties of matter in extreme conditions of temperature and density. Indeed, the interaction of a power laser and a target creates a plasma in which the temperature is high enough to reach important degrees of ionization. These conditions can allow the excitation of the nucleus. A nucleus of interest to study the processes of nuclear excitation is the 201Hg. This work aims to design an experiment where the 201Hg excitation will be observed in a plasma produced by a high power laser. The first part of this manuscript presents the calculation of the expected nuclear excitation rates in the plasma. For about ten years, nuclear excitation rates have been calculated using the average atom model. To validate this model a code named ADAM (French acronym for Beyond The Average Atom Model) was developed to calculate the nuclear excitation rates under the DCA (Detailed Configuration Accounting) hypothesis. ADAM allows us to deduce the thermo dynamical domain where the nuclear excitation rates determined with the average atom model are relevant. The second part of this manuscript presents the coupling of the excitation rate calculation with a hydrodynamic code to calculate the number of excited nuclei produced in one laser shot for different laser intensity. Finally, in the last part, first experimental approaches which will be used to design an experiment on a laser installation are presented. These approaches are based on the detection and determination of the amount of multicharged ions obtained far from the target (∼80 cm). For this purpose, an electrostatic analyzer was used. (author)

  10. Astatination of closo-dodecaborate(2-) anion

    Czech Academy of Sciences Publication Activity Database

    Orlova, A.; Lebeda, Ondřej; Tolmachev, V.; Lundquist, H.; Carlsson, J.; Sjöberg, S.

    Cambridge : The Royal Society of Chemistry , 2000 - (Davidson, M.; Hughes, A.; Marder, T.; Wade , K.), s. 144-147 [Conference "Contemporary Boron Chemistry ". Durham (GB), 11.07.1999-15.07.1999] Institutional research plan: CEZ:AV0Z1048901 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  11. Tank characterization report for single-shell tank 241-B-201

    Energy Technology Data Exchange (ETDEWEB)

    Conner, J.M., Fluor Daniel Hanford

    1997-02-03

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-B-201. This report supports the requirements of the Ri- Party Agreement Milestone M-44-05.

  12. Thallium-201 scintigraphy of the suppressed thyroid: an alternative for iodine-123 scanning after TSH stimulation

    International Nuclear Information System (INIS)

    Thallium-201 scintigraphy of the thyroid gland suppressed by autonomous nodule was compared with 123I scintigraphy after TSH stimulation. In all patients, similar images were obtained by both methods. In 20 patients, the contralateral lobe was visualized on both scans and in 14 of these, the upper pole of the ipsilateral lobe was also visualized. In one patient, neither 123I scanning after TSH nor 201TI scintigraphy showed any extranodular tissue. This study suggests that 201TI scintigraphy is a reliable alternative for scanning after TSH. It is a relatively simple method, not inducing any TSH-related allergic reactions. Iodine uptake in extranodular tissue is not stimulated and therefore, 201TI scintigraphy and radioiodine therapy can be combined on one day, without increasing the risk of radiation damage to the normal thyroid tissue with a resultant post-treatment hypothyroidism

  13. Dipyridamole 201Tl myocardial SPECT imaging in patients with dilated cardiomyopathy

    International Nuclear Information System (INIS)

    Objective: To explore the characteristics of dipyridamole 201Tl myocardial perfusion imaging (MPI) SPECT in patients with dilated cardiomyopathy. Methods: Thirty patients with dilated cardiomyopathy underwent pharmacological stress 201Tl MPI SPECT after intravenous infusion of dipyridamole (0.56 mg/kg) for 4 min. The early and delayed SPECT images were acquired respectively at 10 and 240 min after 201Tl injection. The images were analyzed and reported by two or three experienced nuclear medicine physicians. Results: All patients were found to have abnormal perfusion patterns at delay imaging, however 90.00% (27/30) were also abnormal at early images. Six patients had reverse redistribution. Conclusion: Dipyridamole 201Tl MPI SPECT imaging may be of some value for the assessment of patients with dilated cardiomyopathy. (authors)

  14. 19 CFR 201.17 - Procedures for requesting access to records.

    Science.gov (United States)

    2010-04-01

    ... GENERAL APPLICATION Availability of Information to the Public Pursuant to 5 U.S.C. 552 § 201.17 Procedures... life or physical safety of an individual; (ii) An urgency to inform the public about an actual...

  15. Clinical evaluation of the ipsilateral lung uptake of 201TlCl in spontaneous pneumothorax

    International Nuclear Information System (INIS)

    A case of re-expansion pulmonary edema following the treatment of spontaneous pneumothorax was reported, and in 3 other cases of this disease, perfusion lung scintigraphy with sup(99m)Tc-MAA and myocardial scintigraphy with 201TlCl were performed in order to evaluate the regional pulmonary arterial perfusion and lung uptake of 201Tl. The perfusion decrease and the marked uptake of 201Tl were observed in the ipsilateral lung of 2 cases. In a previous study, we reported that diffuse bilateral lung uptake of 201Tl, which was distributed in more than 90% of the extravascular space of the lung, was observed in various cases with heart disease, diffuse interstitial pneumonia etc. Therefore, it seems that ipsilateral lung in cases with spontaneous pneumothorax may be accompanied with a subclinical increased vascular permeability and abnormal accumulation of interstitial fluid. Thus patients with spontaneous pneumothorax will be predisposed to re-expansion pulmonary edema. (author)

  16. Clinical evaluation of the ipsilateral lung uptake of /sup 201/TlCl in spontaneous pneumothorax

    Energy Technology Data Exchange (ETDEWEB)

    Fujii, T.; Hirayama, J.; Kanai, H.; Kanbayashi, T.; Mimura, N.; Amamiya, H. (Shinshu Univ., Matsumoto, Nagano (Japan). Faculty of Medicine)

    1982-08-01

    A case of re-expansion pulmonary edema following the treatment of spontaneous pneumothorax was reported, and in 3 other cases of this disease, perfusion lung scintigraphy with sup(99m)Tc-MAA and myocardial scintigraphy with /sup 201/TlCl were performed in order to evaluate the regional pulmonary arterial perfusion and lung uptake of /sup 201/Tl. The perfusion decrease and the marked uptake of /sup 201/Tl were observed in the ipsilateral lung of 2 cases. In a previous study, we reported that diffuse bilateral lung uptake of /sup 201/Tl, which was distributed in more than 90% of the extravascular space of the lung, was observed in various cases with heart disease, diffuse interstitial pneumonia etc. Therefore, it seems that ipsilateral lung in cases with spontaneous pneumothorax may be accompanied with a subclinical increased vascular permeability and abnormal accumulation of interstitial fluid. Thus patients with spontaneous pneumothorax will be predisposed to re-expansion pulmonary edema.

  17. 201Tl+-labelled Prussian blue nanoparticles as contrast agents for SPECT scintigraphy

    Science.gov (United States)

    Perrier, M.; Busson, M.; Massasso, G.; Long, J.; Boudousq, V.; Pouget, J.-P.; Peyrottes, S.; Perigaud, Ch.; Porredon-Guarch, C.; de Lapuente, J.; Borras, M.; Larionova, J.; Guari, Y.

    2014-10-01

    Prussian blue (PB) and its analogues on the nanometric scale are exciting nano-objects that combine the advantages of molecular-based materials and nanochemistry. Herein, we demonstrate that ultra-small PB nanoparticles of 2-3 nm can be easily labelled with radioactive 201Tl+ to obtain new nanoprobes as radiotracers for 201-thallium-based imaging.Prussian blue (PB) and its analogues on the nanometric scale are exciting nano-objects that combine the advantages of molecular-based materials and nanochemistry. Herein, we demonstrate that ultra-small PB nanoparticles of 2-3 nm can be easily labelled with radioactive 201Tl+ to obtain new nanoprobes as radiotracers for 201-thallium-based imaging. Electronic supplementary information (ESI) available: Experimental details and procedures, toxicological data, PXRD, TEM images, kinetics and adsorption isotherms, SPECT/CT images, Tl+ captation profiles. See DOI: 10.1039/c4nr03044c

  18. 21 CFR 201.300 - Notice to manufacturers, packers, and distributors of glandular preparations.

    Science.gov (United States)

    2010-04-01

    ... structure or any function of the body. (b) Manufacturers have heretofore taken advantage of § 201.100... function of the human body that they are intended to affect. Since any such representations offering...

  19. A clinical study of thallium-201 scintigraphy in hypertensive patients with and without left ventricular hypertrophy

    International Nuclear Information System (INIS)

    Objective: Based on coronary angiography, thallium-201 myocardial scintigraphy was evaluated in hypertensive patients with and without left ventricular hypertrophy, and the causes of its perfusion abnormalities were discussed. Methods: Thallium-201 myocardial scintigraphy was performed on 85 patients with clinically suspected coronary artery disease. Coronary angiography was performed on patients with perfusion abnormalities in one month after scintigraphy. Results: The rate of 201Tl perfusion abnormalities in hypertensive patients with hypertrophy (85.7%) was higher than normal blood pressure (39.3%, P201Tl perfusion abnormalities occur in hypertensive patients with hypertrophy. The perfusion abnormalities may be caused not only by coronary large vessel disease, but also by coronary microvascular disease

  20. Functional Significance of Angiographic Collaterals in Patients with Totally Occluded Right Coronary Artery: Intracoronary Thallium-201 Scintigraphy

    International Nuclear Information System (INIS)

    To compare the myocardial viability in patients suffering from total occlusion of the right coronary artery (RCA) with the angiographic collaterals, intracoronary injection of Thallium-201 (T1-201) was done to 14 coronary artery disease (CAD) patients (pts) with total occlusion of RCA and into four normal subjects for control. All 14 CAD pts had Grade 2 or 3 collateral circulations. There were 14 male and 4 females, and their ages ranged from 31 to 70 years. In nine pts, T1-201 was injected into left main coronary artery (LCA) (300 ∼ 350 μ Ci) to evaluate the myocardial viability of RCA territory through collateral circulations. The remaining five pts received T1-201 into RCA (200-250 μ Ci) because two had intraarterial bridging collaterals and three had previous successful PTCA. Planar and SPECT myocardial perfusion images were obtained 30 minutes, and four to five hours after T1-201 reinjection. Intravenous T1-201 reinjection (six pts) or 99mTc-MIBI (two pts) were also performed in eight CAD pts. Intracoronary myocardial perfusion images were compared with intravenous T1-201(IV T1-201) images, EGG, and ventriculography. Intracoronary TI-201 images proved to be superior to that of IV T1-201 due to better myocardial to background uptake ratio and more effective in the detection of viable tissue. We also found that perfusion defects were smaller on intracoronary T1-201 images than those on the IV T1-201. All of the 14 CAD pts had either mostly viable myocardium (seven pts) or large area of T1-201 perfusion (seven pts) in RCA territory, however ventriculographic wall motion and ECG did not correlate well with intracoronary myocardial perfusion images. In conclusion, total RCA occlusion patients with well developed collateral circulation had large area of viable myocardial in the corresponding territory.

  1. Functional significance of coronary collateral circulation during dynamic exercise evaluated by thallium-201 myocardial scintigraphy.

    OpenAIRE

    Wainwright, R J; Maisey, M N; Edwards, A. C.; Sowton, E

    1980-01-01

    Sixty-five patients with angiographically documented coronary artery disease were investigated by thallium-201 (201Tl) scintigraphy to determine the role of the collateral circulation during dynamic exercise. Fifty-three patients had complete proximal occlusion of at least one major coronary artery. One patient had total occlusion of all three major coronary arteries. Sixty-four collateral channels were identified, graded, and compared with corresponding regions of the myocardial scintigram. ...

  2. 201Tl single photon emission tomography in the evaluation of residual and recurrent astrocytoma

    International Nuclear Information System (INIS)

    Twenty-five patients with malignant astrocytoma, either postoperatively (15 cases) or with recurrent tumour versus gliosis (10 cases) were included in this study. 201T1 single photon emission computed tomography (SPECT) was performed with the calculation of early and delayed uptake values and retention index. There was a higher sensitivity in detection of tumour viability by 201T1 SPECT of 100% versus 80% using computed tomographic scanning and in the differentiation between recurrent tumour and postradiation gliosis. (author)

  3. [sup 201]Tl single photon emission tomography in the evaluation of residual and recurrent astrocytoma

    Energy Technology Data Exchange (ETDEWEB)

    Moustafa, H.M.; Ziada, G.A.; El-Ghonimy, E.G. (Cairo Univ., El Mansura (Egypt). Faculty of Medicine); Omar, W.M.; Ezzat, I. (Cairo Univ. (Egypt). Cancer Inst.)

    1994-03-01

    Twenty-five patients with malignant astrocytoma, either postoperatively (15 cases) or with recurrent tumour versus gliosis (10 cases) were included in this study. [sup 201]T1 single photon emission computed tomography (SPECT) was performed with the calculation of early and delayed uptake values and retention index. There was a higher sensitivity in detection of tumour viability by [sup 201]T1 SPECT of 100% versus 80% using computed tomographic scanning and in the differentiation between recurrent tumour and postradiation gliosis. (author).

  4. A prospective evaluation of thallium-201 single photon emission computerized tomography for brain tumor burden

    International Nuclear Information System (INIS)

    Purpose: The follow-up of patients with malignant brain tumors after surgery, radiation, and/or chemotherapy has been inadequate for evaluating brain tumor burden using computerized tomography (CT) or magnetic resonance imaging (MRI). Thallium-201 has been shown to concentrate in viable tumor, and Tl-201 single photon emission computerized tomography (SPECT) imaging can identify tumor burden more accurately than CT. Methods and Materials: Thirty-one patients with glioblastoma and three patients with low grade astrocytoma were studied with Tl-201 SPECT. Histololgic diagnosis was obtained in all patients by biopsy and all patients had CT scans within 2 weeks of the SPECT study. Seventeen patients were followed with one or more SPECT and CT evaluations. Results: Single photon emission computerized tomography studies, after surgery, radiotherapy, and/or chemotherapy, were more accurate than CT in identifying progression or regression of disease. Twenty-three patients had evidence of disease and 11 patients had no evidence of recurrent disease in the initial Tl-201 SPECT study following therapy. Computerized tomography identified 20 of the 23 patients with disease and 6 of 11 patients with no recurrent disease. Follow-up with Tl-201 SPECT in 17 patients suggested progression of disease in 9 patients, while CT showed progression in only 3 patients. Clinical examinations and repeat CT studies confirmed the accuracy of Tl-201 SPECT images. Conclusion: We found Tl-201 SPECT more accurate than CT scans in a prospective evaluation of 34 patients with brain tumor. Follow-up studies with both Tl-201 SPECT and CT imaging in 17 patients demonstrated that SPECT was more reliable than CT in identifying progression, improvement, or no change in brain tumor burden

  5. Correlation of myocardial uptake of 201Tl with local perfusion in the dog heart

    International Nuclear Information System (INIS)

    34 anesthetized and thoracotomized dogs are studied. The local myocardial blood flow is measured with sup(99m)Tc human albumin microsphere. The intramyocardial distribution of 201Tl in relation to local blood flow is studied in basal conditions (24 dogs), after experimental infarction (4 dogs) and postischemic reactive hyperhemia (6 dogs). We conclude that during basal conditions, after infarction and hyperhemia the 201Tl myocardial distribution reflect with damping the variations of blood flow

  6. Effects of ischemic-like insult on myocardial 201Tl accumulation

    International Nuclear Information System (INIS)

    Despite extensive clinical use of thallium-201 (201Tl) for myocardial imaging, the effect of ischemia on myocardial accumulation and release of 201Tl independent of flow has not been fully defined. Therefore, myocardial accumulation of 201Tl in response to ischemic-like myocardial injury was assessed in vitro using the cultured fetal mouse heart preparation. Cultured fetal mouse hearts (n . 311) were subjected to injury simulating ischemia by deprivation of oxygen and oxidizable substrates for periods ranging from 15 minutes to 10 hours. The extent of irreversible injury was determined by the percentage of lactic dehydrogenase (LDH) lost from the hearts to the culture medium during recovery from injury. Injury was essentially reversible at 1 hour of insult. The fraction of 201Tl content in injured compared with control hearts was not significantly lower after 1 hour of insult. By 3 hours of insult, irreversible injury as assessed by loss of LDH was detectable and the extent of injury increased progressively through 10 hours. During the 3-10-hour period of irreversible injury, 201Tl accumulation within injured hearts compared with controls was related in a monotonically decreasing fashion to the loss of LDH as described by a mathematical kinetic model that fit the observations closely (R2 greater than 0.99). These results indicate that in this organ culture preparation, in which there is effectively an unlimited reservoir of 201Tl and no confounding effects of perfusion, the time-dependent 201Tl accumulation is determined by the extent of irreversible injury

  7. Extraction chromatography in isotope production: application in the production of 67Ga and 201Tl

    International Nuclear Information System (INIS)

    Extraction chromatography was applied to the production of the radioisotopes 67Ga and 201Tl. 67Ga was produced by irradiation of natural zinc target with 24 MeV protons in a cyclotron. The separation of 67Ga was carried out by extraction chromatography from 6N HCL. 201Tl was produced in a similar way using lead as a precursor, and it was extracted using 4N HNO3 or HCL. (U.K.)

  8. Studies on the diagnosis of uterine body cancer using 201Tl-chloride

    International Nuclear Information System (INIS)

    201Tl scintigraphy was performed in 18 patients with cancer of uterine body, and the results were compared with histopathological findings. With six patients, 201Tl distribution in the pelvic cavity was registered in the minicomputer, and the time activity curve was plotted. Analysis of 201Tl distribution using ROI revealed that the radioactivity in the uterus was approximately 1.47 times as high as that in background. In the removed uterus, the radioactivity in the cancer was calculated to be approximately 1.9 times as high as that in the myometrium. In all 13 patients with Stage Ib or higher cancer, obvious activity in the uterus coinciding with the lesion was obtained shortly after the intravenous administration of 201Tl-Cl. Though accumulation of activity in the uterus was obtained in three of five patients with Stage Ia cancer, it was interpreted as false-positive, because myoma or adenomyosis was present in addition to cancer in these three patients, and such a complication seemed responsible for the positive result. The sensitivity, specificity and accuracy of 201Tl scintigraphy in diagnosing cancer of the uterine body were 86.7, 0 and 72.2%, respectively. These results suggest that 201Tl scintigraphy is a promising diagnostic aid for cancer of the uterine body. (author)

  9. Thymic tuberculosis preoperatively evaluated with thallium-201 SPECT: two resected cases.

    Science.gov (United States)

    Iwata, Takashi; Inoue, Kiyotoshi; Mizuguchi, Shinjiro; Tsukioka, Takuma; Morita, Ryuhei; Suehiro, Shigefumi

    2007-02-01

    We present 2 resected cases of thymic tuberculosis, which had been preoperatively diagnosed as invasive thymoma, using a thallium-201 ((201)Tl) single photon emission computed tomography ((201)Tl SPECT). [Patient 1] A 74-old-male with a 32-year history of steroid therapy for rheumatic arthritis was diagnosed with an anterior mediastinal tumor by routine chest CT scans after onset of myocardial infarction. [Patient 2] A 56-old-female with a 28-year history of diabetes mellitus presented with a dry cough. A chest CT demonstrated an anterior mediastinal tumor. Neither patient showed pulmonary infiltrations on chest x-ray. (201)Tl SPECT was undertaken for each patient. Abnormal findings could not be detected on a planar image of the scintigraphy; however, on SPECT images accumulations of (201)Tl were clearly detected in the anterior mediastinal mass and a thymoma was thus suspected in each case. Total thymectomy was carried out in each case and the mass then diagnosed as caseous granuloma in the thymus. Both patients are well without recurrence after operation. In patients with a (201)Tl SPECT positive anterior mediastinal tumor associated with an immunologically deficient status, and with negative findings in planar images on thallium scintigraphy, the possibility of thymic tuberculosis should be considered. PMID:17392671

  10. Thallium-201 stress-redistribution myocardial rotational tomography: development of criteria for visual interpretation

    International Nuclear Information System (INIS)

    Despite high sensitivity and specificity for overall detection of coronary artery disease (CAD), planar stress-redistribution thallium-201 (Tl-201) scintigraphy remains suboptimal in localizing disease, because of overlap of myocardial segments. Single photon emission computerized tomography (SPECT), by providing three-dimensional representation of myocardial Tl-201, offers promise for improved localization of CAD. In 50 consecutive patients (22 normal and 28 with CAD), who underwent SPECT stress-redistribution Tl-201 imaging, we systemically developed visual interpretive criteria for perfusion abnormality on SPECT. For overall detection of disease, the best criterion for abnormality was greater than or equal to 8 sectors of moderately decreased Tl-201 uptake. With this criterion, the true positive and true negative rates for overall detection of disease were 96% and 91%, respectively. The best criterion for significant defect in the anterior or posterior coronary circulation was greater than or equal to 3 sectors of moderately decreased Tl-201 uptake. With this criterion, the true positive and true negative rates for anterior circulation disease were 71% and 100%, respectively. With respect to posterior circulation disease, the true positive and true negative rates were 100% and 50%, respectively. Regarding identification of dual circulation disease, the true positive and true negative rates were 71% and 82%, respectively

  11. Assessment of myocardial viability by thallium-201 reinjection imaging with sublingual nitroglycerin

    International Nuclear Information System (INIS)

    Although thallium-201 (201Tl) reinjection imaging improves the detection of myocardial viability compared to standard 3-4 hr redistribution (RD) imaging, it still underestimates the extent of viable myocardium. We examined whether 201Tl reinjection SPECT with sublingual nitroglycerin (NTG) had a higher sensitivity for viability detection than reinjection alone. Eighty patients with coronary artery disease were studied, 38 of them with an old myocardial infarction. At the peak of exercise, 111 MBq of 201Tl was injected and the initial and the delayed SPECT images were obtained. Then, all patients were divided randomly into two groups, and in each group, SPECT data were obtained again after the injection of 37 MBq of 201Tl with (NTG(+) group) or without 0.6 mg of sublingual NTG (NTG(-) group). Among 50 segments showing fixed defects on the delayed image in the NTG(+) group, 21 (42%) were found to be reversible on the reinjection image, as compared to 16 of 51 (31%) in the NTG(-) group. Twenty-two of 44 (50%) segments showing incomplete RD were found to be reversible in the NTG(+) group, while 17 of 42 (41%) segments in the NTG(-) group. Moreover, the ratio of reversible segments seen in the reinjection images was significantly higher in the collateralized regions of the NTG(+) group than in those of the NTG(-) group (20/26 vs. 14/28, p201Tl reinjection SPECT with sublingual NTG improves the detection of ischemic but viable myocardium as compared to SPECT with reinjection alone. (author)

  12. Evaluation of acquisition time for calculating retention index of 201Tl lung tumor SPECT

    International Nuclear Information System (INIS)

    In 201Tl SPECT imaging for lung tumor, retention index has been known to be useful for the quantitative evaluation of 201Tl retention in the tumor. The value of retention index varies depending on the imaging time after 201Tl injection. We evaluated a variation of the retention index as a function of time after 201Tl injection, and determined optimum imaging timing for the calculation of the 201Tl retention index. A dynamic SPECT acquisition was performed over 40 min with 5 minutes for a SPECT image set. Four frames were summed to make a SPECT image set, and five SPECT acquisition sets were generated. Delayed image was acquired 2 hours after injection. Target to Non target (T/N) count ratios between one of the early image and the delayed image were calculated. The retention index was defined as (delayed T/N-early T/N) divided by early T/N. We found that 201Tl activity of normal lung tissue decreased slowly with time and the T/N ratio increased. Therefore, the retention index was significantly influenced by the starting time of acquisition. The retention index calculated by a data set with a starting time at 15 to 20 min after administration was stable. Fixed acquisition protocol should be performed for reliable calculation of the retention index. (author)

  13. Determination of thallium content in 201Tl processing waste by UV-spectrophotometry

    International Nuclear Information System (INIS)

    Thallium-201 is a radioisotope widely used for visualization of heart or cardiovascular diagnosis. It is generally produced by means of 203Tl(p,3n)201Pb -->201Tl reaction using enriched 203Tl (more than 95%) as target material. Since the enriched 203Tl is very expensive, the recovery of 203Tl from 201Tl-processing waste is very important. For this reason, a high accuracy and good precision method for Tl measurement is required. Having a single absorbance maximum at 214 nm which is stable up 24 hours post preparation, it is expected that Tl can be quantitatively determined by spectrophotometry in the UV region. The chemical matrices in the 201Tl-processing waste were separated by hydroxide precipitation, stipping extraction and charcoal adsorption techniques. The linearity of the absorbance standard curve is given by regression line A = 0.0013 + 0.0223C with C is concentration in mg/dm3. The regression coefficient was found to be 0.9999. Evaluation using simulated waste solutions and 201Tl-processing waste samples showed that both the accuracy and the precision, in terms of repeatability, of the measurement were high. (author)

  14. Froth characteristic of MIBC and BK-201 frothers%起泡剂MIBC和BK-201的浮选泡沫特性

    Institute of Scientific and Technical Information of China (English)

    曾培; 欧乐明; 冯其明; 李洪强; 张福亚

    2015-01-01

    选用非极性基结构不同的起泡剂MIBC和BK-201,利用自制的泡沫性能测试系统,在两相泡沫体系下,测定两相泡沫不同高度处的气泡直径、静压强、表观溢流速度,研究起泡剂对泡沫特征及夹带的影响.结果表明:增加起泡剂浓度,气泡的兼并行为受到抑制,气泡直径逐渐减小;当MIBC浓度超过75 mg/L、BK-201浓度超过150 mg/L时,兼并行为受到显著抑制,气泡直径基本保持不变.在相同的浓度下,相比MIBC,BK-201产生的泡沫气泡直径大、含液率低、水回收速率低.因而,微细粒脉石在BK-201所形成泡沫中夹带更弱,浮选选择性更好.%By using self-designed foam property testing system, two nonpolar base structure frothers, MIBC and BK-201 were chosen to study the influences of frothers on the foam characteristic and entrainment by measuring the bubble diameter, static pressure and apparent flooding velocity in the two-phase foam. The results show that bubble merger degree reduces and air bubble diameter decreases with increasing frothers concentration. When the concentrations of MIBC and BK-201 are more than 75 and 150 mg/L, respectively, the air bubble diameter basically remains unchanged because the merger behavior is dramatically depressed. Under the same concentration, BK-201 generates larger diameter bubble, lower liquid holdup and lower water recovery compared with MIBC. As a result, the foam entrainment of fine gangue is weaker and the selectivity of flotation is better when BK-201 is used.

  15. Thallium-201 brain SPECT to diagnose aggressiveness of meningiomas

    International Nuclear Information System (INIS)

    This investigation was conducted to determine the ability of 201Tl brain SPECT with respect to pre-operative prediction of lesional aggressiveness of meningioma. Fifty-nine lesions in 42 patients were examined. Early (15 min) and late (3 h) SPECT were obtained. Early uptake ratio (ER; lesion to normal brain average count ratio), late uptake ratio (LR) and the ratio of LR to ER (L/E ratio) were calculated. Twenty-three lesions exhibited malignant features based on histologic or clinical course such as recurrence or skull invasion. Both ER and LR of malignant meningiomas were significantly higher than those in thirty-six benign lesions. Benign lesions were classified into two groups for further analysis: meningotheliomatous type, which is the most common histology, and benign lesions other than the meningotheliomatous (other benign) type. ER in other benign type was lower than the meningotheliomatous and the malignant type. LR afforded differentiation of the malignant type from the two benign types. These two benign types could be distinguished on the basis of the L/E ratio. These results indicate that high pre-operative ER and LR values in patients with meningioma are indicators of the aggressiveness of lesions, i.e., malignant meningioma, recurrence or skull invasion. (author)

  16. A probabilistic risk assessment of an AGN-201M reactor

    International Nuclear Information System (INIS)

    The fundamental liability of any nuclear reactor is the possibility of exposing the public and environment to excessive levels of nuclear radiation. This paper addresses the risk and potential vulnerability assessment of a maximum hypothetical release accident (MHRA) for the AGN-201M reactor located at the University of New Mexico (UNM). The MHRA is defined as the total release of all radiological effluents from the reactor facility to the environment. This paper presents the results of a levels I and II probabilistic risk assessment (PRA) through the disclosure of the following: (1) internal initiating events at full-power operation; (2) dominant accident sequences in the reactor event trees and their frequencies; and (3) radioactive material transport phenomena. The methodology used in the assessment follows NUREG/CR-4550 to include a detailed description of the reactor, its operational domain, and its safety systems. This assessment includes analysis of the safety systems, performance of the confinement structure and other mitigative systems, and identification of the fission products produced by the reactor. The internal events include both human error and random equipment failure. The source term is characterized for the worst-case scenario only, since the magnitude of the escaping effluents is deemed ineffectual for any subcategory release

  17. Myocardial uptake of thallium-201 in rat with cardiac hypertrophy

    International Nuclear Information System (INIS)

    The thallium-201 (TL) has been used in order to diagnose myocardial infarction and ischemia. Although it is well known that TL distributes in the myocardium in proportion to the distribution of coronary blood flow, the biological property of TL in the loaded myocardium remains unclear. We studied the myocardial uptake of TL in rat with cardiac hypertrophy. Experiments were performed in 30 anesthetized rats devided into 3 groups; control group (C,N=14), hypertrophy group (H,N=6) and diltiazem group (D, 0.3 mg/kg/min. IV. N=10). Cardiac hypertrophy was produced with the banding of the ascending aorta. Myocardial blood flow (MBF) was measured by microspheres labeled with Strontium-85. Cardiac weight was increased in H, and both MBF and TL uptake were proportionally increased. MBF was negatively correlated with the extraction fraction in C (r=-0.71), in H (r=-0.66) and in D (r=-0.85), and this relationship in H was significantly different from it in C (p<0.05), but not in D. From these results, we concluded that TL uptake in H is not always dependant on MBF and affected by the altered metabolism of hypertrophied myocardium. (author)

  18. Observation of portal circulation through superior mesenteric vein by enteric coated capsule of thallium-201

    International Nuclear Information System (INIS)

    A new method of oral administration of an enteric coated capsule of 201Tl (201Tl-capsule) was developed to evaluate the portal circulation through the superior mesenteric vein (SMV). The 201Tl-capsule was not collapsed in the artificial gastric juice, whereas it melted soon after soaking in the artificial intestinal juice. In a clinical trial of 42 cases, 201Tl was satisfactory released in the duodenum in 36 cases where clear liver images were observed except in 1 patient. Heart to liver ratio (H/L) at 60 or 90 min after duodenal release of 201Tl was 0.32±0.07 (mean ±1 s.d.) in normal controls, 0.34±0.12 in chronic hepatitis, 0.31±0.12 in acute hepatitis, 0.45±0.13 in liver cirrhosis and 0.48±0.32 in cirrhosis with hepatocellular carcinoma. In 11 patients who had both oral and rectal studies with 201Tl, 7 showed a high H/L ratio of more than 0.8 in the rectal study but only 1 showed a similarly high ratio of 1.07 in the oral study. In the group of varied liver disorders we have studied so far, it was found that most of the SMV blood flowed into the liver and the degree of portal systemic shunting (PSS) from the SMV was much smaller compared to that from the inferior mesenteric vein. The present study with oral administration of the 201Tl-capsule was of value in understanding portal circulation through the SMV, however, this technique seemed of limited usefulness for evaluating overall pathologic PSS. (orig.)

  19. Different thallium-201 single-photon emission tomographic patterns in benign and aggressive meningiomas

    Energy Technology Data Exchange (ETDEWEB)

    Tedeschi, E. [Dipartimento di Diagnostica per Immagini, Centro CNR per la Medicina Nucleare, Napoli (Italy); Soricelli, A. [Dipartimento di Diagnostica per Immagini, Centro CNR per la Medicina Nucleare, Napoli (Italy); Brunetti, A. [Dipartimento di Diagnostica per Immagini, Centro CNR per la Medicina Nucleare, Napoli (Italy); Romano, M. [Dipartimento di Diagnostica per Immagini, Centro CNR per la Medicina Nucleare, Napoli (Italy); Bucciero, A. [Istituto di Neurochirurgia, Universita `Federico II`, Napoli (Italy); Iaconetta, G. [Istituto di Neurochirurgia, Universita `Federico II`, Napoli (Italy); Alfieri, A. [Istituto di Neurochirurgia, Universita `Federico II`, Napoli (Italy); Postiglione, A. [Dipartimento di Clinica Medica, Universita `Federico II`, Napoli (Italy); Salvatore, M. [Dipartimento di Diagnostica per Immagini, Centro CNR per la Medicina Nucleare, Napoli (Italy)

    1996-11-01

    To evaluate the possibility of preoperatively obtaining an index of aggressiveness for intracranial meningiomas, we prospectively studied 22 patients with computed tomographic or magnetic resonance imaging evidence of meningeal tumour, using single-photon emission tomography (SPET) of the brain and thallium-201 ({sup 201}Tl). On a brain-dedicated SPET scanner, a rapid acquisition protocol with early, short scans was started simultaneously with the intravenous administration of 111 MBq {sup 201}Tl, covering the initial intratumoral distribution of the tracer. Twenty minutes post injection, a delayed SPET scan was also obtained. On the reconstructed and attenuation-corrected images we calculated the {sup 201}Tl concentration in tumour and normal contralateral brain tissue, and compared intratumoral tracer concentration in the initial and the final part of the rapid acquisition protocol. Benign and malignant meningiomas were classified as such based on histological examination. In malignant lesions, the ratio of the {sup 201}Tl concentration at 2-4 min post injection to that at 14-16 min was found to be significantly higher than in non-aggressive neoplasms (mean{+-}1 SD: 1.14{+-}0.31 and 0.56{+-}0.13, respectively, P <0.01). Conversely, in the delayed scan, most lesions showed high tracer concentration, and the two groups could not be distinguished. In addition, three recurrent meningiomas displayed the same imaging behaviour as the malignant group, i.e. had similar {sup 201}Tl concentration values at 2-4 and at 14-16 min. Our findings suggest that the comparative assessment of intratumoral {sup 201}Tl concentration at 2-4 and at 14-16 min post injection could provide a fast, simple method to differentiate preoperatively intracranial meningiomas with different biological behaviour. (orig.). With 3 figs., 1 tab.

  20. Different thallium-201 single-photon emission tomographic patterns in benign and aggressive meningiomas

    International Nuclear Information System (INIS)

    To evaluate the possibility of preoperatively obtaining an index of aggressiveness for intracranial meningiomas, we prospectively studied 22 patients with computed tomographic or magnetic resonance imaging evidence of meningeal tumour, using single-photon emission tomography (SPET) of the brain and thallium-201 (201Tl). On a brain-dedicated SPET scanner, a rapid acquisition protocol with early, short scans was started simultaneously with the intravenous administration of 111 MBq 201Tl, covering the initial intratumoral distribution of the tracer. Twenty minutes post injection, a delayed SPET scan was also obtained. On the reconstructed and attenuation-corrected images we calculated the 201Tl concentration in tumour and normal contralateral brain tissue, and compared intratumoral tracer concentration in the initial and the final part of the rapid acquisition protocol. Benign and malignant meningiomas were classified as such based on histological examination. In malignant lesions, the ratio of the 201Tl concentration at 2-4 min post injection to that at 14-16 min was found to be significantly higher than in non-aggressive neoplasms (mean±1 SD: 1.14±0.31 and 0.56±0.13, respectively, P 201Tl concentration values at 2-4 and at 14-16 min. Our findings suggest that the comparative assessment of intratumoral 201Tl concentration at 2-4 and at 14-16 min post injection could provide a fast, simple method to differentiate preoperatively intracranial meningiomas with different biological behaviour. (orig.). With 3 figs., 1 tab

  1. Quantitative analysis of exercise 201Tl myocardial emission CT in patients with coronary artery disease

    International Nuclear Information System (INIS)

    The clinical usefulness of quantitative analysis of exercise thallium-201 myocardial emission computed tomography (ECT) was evaluated in coronary artery disease (CAD). The subjects consisted of 20 CAD patients and five normal controls. All CAD patients underwent coronary angiography. Tomographic thallium-201 myocardial imaging was performed with a rotating gamma camera, and long-axial and short-axial myocardial images of the left ventricle were reconstructed. The tomographic images were interpreted quantitatively using circumferential profile analysis. Based on features of regional myocardial thallium-201 kinetics, two types of abnormalities were studied: (1) diminished initial distribution (stress defect) and (2) slow washout of thallium-201, as evidenced by patients' initial thallium-201 uptake and 3-hour washout rate profiles which fell below the normal limits, respectively. Two diagnostic criteria including the stress defect and a combination of the stress defect and slow washout were used to detect coronary artery lesions of significance (>=75 % luminal narrowing). The ischemic volumes were also evaluated by quantitative analysis using thallium-201 ECT. The diagnostic accuracy of the stress defect criterion was 95 % for left anterior descending, 90 % for right, and 70 % for left circumflex coronary artery lesions. The combined criteria of the stress defect and slow washout increased detection sensitivity with a moderate loss of specificity for identifying individual coronary artery lesion. A relatively high diagnostic accuracy was obtained using the stress defect criterion for multiple vessel disease (75 %). Ischemic myocardial volume was significantly larger in triple vessel than in single vessel disease (p < 0.05) using the combined criteria. It was concluded that quantitative analysis of exercise thallium-201 myocardial ECT images proves useful for evaluating coronary artery lesions. (author)

  2. Comparison of thallium-201 and gallium-67 scintgraphy in the evaluation of non-Hodgkin's lymphoma

    International Nuclear Information System (INIS)

    Gallium-67 (Ga-67) is widely used in the assessment of patients with lymphoma. Although highly sensitive in Hodgkin's disease and high grade non-Hodgkin's lymphoma (NHL), its sensitivity is reported to be reduced in lower grades of NHL. Several series have suggested that thallium-201 (Tl-201) may be more useful than Ga-67 in the evaluation of low and possibly intermediate grade NHL. Aim: To compare the sensitivity and relative uptakes of Tl-201 and Ga-67 in patients with NHL. A total of 36 pairs of studies were performed in 33 patients (14 male: 19 female; age range 16-84 years, mean 55 years). All had whole body Ga-67 (400 MBq) and Tl-201 (100-200 MBq) studies (interval 0-three days) which were read by two experienced nuclear medicine physicians blinded to clinical history and results of other investigations. Tl-201 had a higher sensitivity and avidity than Ga-67 in patients with low grade NHL. In contrast, Ga-67 was slightly more sensitive and had a higher avidity in patients with both intermediate and high grade NHL. We conclude that Tl-201 is more sensitive and avid for low grade NHL than Ga-67 and that consideration should be given to its use in this condition in conjunction with Ga-67 as it may provide complementary information. Routine use in intermediate grade NHL is less convincing as Ga-67 was superior in most cases. Ga-67 is more sensitive than Tl-201 in assessment of high grade NHL. Copyright (1998) Australian and New Zealand Journal of Medicine

  3. Studies on the diagnosis of uterine tumor by 201-thallium-chloride

    Energy Technology Data Exchange (ETDEWEB)

    Tobari, C.; Muroi, K.; Watanabe, H.; Noguchi, S.; Kurosawa, H. (Toho Univ., Tokyo (Japan). School of Medicine)

    1981-10-01

    Cases of gynecological tumor mainly uterine benign and malignant tumors were evaluated using /sup 201/Thallium-Chloride (/sup 201/Tl-Cl) after intravenous injection. The positive scans of 100% in 42 cases of uterine myoma including 29 cases of leiomyoma, 8 cases of adenomyosis and 5 cases of combined type myoma, also 100% in 8 cases of body cancer indicating adenocarcinoma and 25% in 12 cases of cervical cancer indicating squamous cell carcinoma were observed. The smallest focal lesion for the positive scans was needed approximately more 5 cm in diameter in the cases of leiomyoma. The most accumulation of activities was shown in adenomyosis or adenocarcinoma with much adenoid structure in the pathological study. Accumulation of /sup 201/Tl in uterine benign and malignant tumors was suggested the analog of potassium. The mechanism of tumor affinity was correlated to perfusion volume and the acceleration of the potassium metabolism in a tumor. On the other hand, we suggested the diagnosis of the malignant uterine tumor should be attended due to /sup 201/Tl accumulation also in the benign uterine tumor. The uterine scanning using /sup 201/Tl-Cl was acknowledged to be very useful and safe indicating early detection at 20 minutes after the injection, (non-traumatic procedure and non-visualized bone tissues). In conclusion, this radioisotopical procedure was indicated to be a high value screening examination in the diagnosis of uterine tumor.

  4. Studies on the diagnosis of uterine tumor by 201-thallium-chloride

    International Nuclear Information System (INIS)

    Cases of gynecological tumor mainly uterine benign and malignant tumors were evaluated using 201Thallium-Chloride (201Tl-Cl) after intravenous injection. The positive scans of 100% in 42 cases of uterine myoma including 29 cases of leiomyoma, 8 cases of adenomyosis and 5 cases of combined type myoma, also 100% in 8 cases of body cancer indicating adenocarcinoma and 25% in 12 cases of cervical cancer indicating squamous cell carcinoma were observed. The smallest focal lesion for the positive scans was needed approximately more 5 cm in diameter in the cases of leimyoma. The most accumulation of activities was showed in adenomyosis or adenocarcinoma with much adenoid structure in the pathological study. Accumulation of 201Tl in uterine benign and malignant tumors was suggested the analog of potassium. The mechanism of tumor affinity was correlated to perfusion volume and the acceleration of the potassium metabolism in a tumor. On the other hand, we suggested the diagnosis of the malignant uterine tumor should be attended due to 201Tl was accumulation also in the benign uterine tumor. The uterine scanning using 201Tl-Cl was acknowledged to be very useful and safe indicating early detection at 20 minutes after the injection, (non-traumatic procedure and non-visualized bone tissues). In conclusion, this radioisotopical procedure was indicated high value of screening examination in the diagnosis of uterine tumor. (author)

  5. Dynamic single photon emission computed tomography of Tl-201 with exercise loading

    International Nuclear Information System (INIS)

    Single photon emission computed tomography (SPECT) with Tl-201 has been reported to provide accurate means for diagnosis of coronary artery disease (CAD). The purpose of this study is to examine the serial changes in regional myocardial activity of Tl-201 injected during exercise loading in CAD using a multidetector SPECT system. Four cases without coronary stenosis (N) and 17 patients with CAD including 9 cases with prior myocardial infarction (MI) were studied. Tl-201 was injected during submaximal exercise loading with a bicycle ergometer. Serial dynamic SPECT scan was performed every 5 min until 30 min after injection, followed by additional 3 scans for 10 min at 1 hr, 2 hr and 3 hr after injection. These SPECT images were corrected for the acquisition time, but no corrections were made for photon attenuation and scattering. N revealed uniform distribution throughout the study, and rapid washout was observed from the early period in 3/4 cases (10 to 24 % for initial 25 min). CAD showed various patterns of abnormal distribution and washout. In addition, the changes in regional distribution of Tl-201 were observed during the early period. These preliminary results indicate the significance of the early washout during the 30 min after injection of Tl-201, and careful consideration should be taken in calculating the washout rate by a conventional SPECT system with a rotating gamma camera. (author)

  6. Quantification of left ventricular size on exercise thallium-201 single-photon emission tomography

    International Nuclear Information System (INIS)

    The purposes of this study were to determine whether quantification of the left ventricular size on exercise thallium-201 single-photon emission tomography (SPET) correlates with echocardiographic measurements, whether the quantification reflects the severity of coronary artery disease, and whether it can provide supplementary information regarding the severity of coronary artery disease. In 42 control subjects and 110 patients who underwent coronary angiography, we performed exercise 201Tl SPET and quantified six non-regional markers: Lung 201Tl uptake on an initial planar image (Lung/Heart), left ventricular width on a tomogram (Width), change in the Width from the initial to delayed tomograms (ΔWidth), count ratio of the left ventricular cavity to the myocardium (C/M), count ratio of the lung to the myocardium (L/M), and count ratio of the lung to the left ventricular cavity (L/C). In 76 patients, furthermore, the Width was compared with echocardiographic measurements. The Width correlated with echocardiographic measurements (P201Tl SPET correlated with echocardiogrpahic measurements and reflected the severity of coronary artery disease, but may be replaced with quantitation of the lung 201Tl uptake. (orig.)

  7. Correlation of an abnormal rest 201Tl myocardial image: Pathological findings in cardiac transplant recipients

    International Nuclear Information System (INIS)

    Rest myocardial 201Tl scintigraphy was undertaken in 15 males mean age 39 years (22-54) who had been accepted for cardiac transplantation. Complete pathological correlation was obtained in 14 after transplantation and in 1 who died before a suitable donor heart became available. The average time from scintigraphy to pathological evaluation was 42 days (9-103). All the 201Tl images were grossly abnormal and on the basis of these studies it was not possible to differentiate ischemic from idiopathic cardiomyopathy. Each of the three views of the 201Tl study was divided into three segments, therefore 135 areas were available for comparison (3 x 3 x 15). Eighty-eight of these were abnormal on scan and 78 of these were abnormal pathologically. The right ventricle was seen on all rest images but the degree of uptake bore no relationship to the measured thickness of the right ventricular wall. Structures such as the atrial wall and the enlarged papillary muscle were visualized in some patients. In two patients there was an improvement of the rest 201Tl image in delayed views and histologically these areas showed a mixture of muscle and fibrous tissue. The sensitivity of 201Tl imaging in this study was 89% and there was close correlation of the images with gross and microscopic pathological findings. (orig.)

  8. Quantitative measurement of membrane Na+-K+ ATPase activity using thallium-201: comparison with rubidium-86

    International Nuclear Information System (INIS)

    Na+-K+ ATPase activity has been estimated by the degree of inhibition of cation transport by cardiac glycosides (ouabain) using Rb-86 as a substrate. The biological characteristics of Tl-201 is known to be similar to those of potassium as a transport substrate in the presence of glucose, insulin or phobol myristate acetate (PMA). The purpose of this study was to measure ouabain sensitive Na+-K+ ATPase activity using Tl-201 and compare with that using Rb-86. Smooth muscle cells isolated from rat aorta or human placental umbilical artery were cultured, and used to measure cellular Na+-K+ ATPase activity. Na+-K+ ATPase activity was measured as a percentage decrease in cellular uptake of Tl-201 or Rb-86 by ouabain under the presence of glucose, insulin or PMA in media. Na+-K+ ATPase activity measured with Tl-201, as a transport substrate, was not different from those measured with Rb-86 in rat or human smooth muscle cell preparation. Incubation with high concentration glucose resulted in about 30% decrease in enzyme activity. In contrast, insulin or PMA resulted in 50-70% or 28% increase from baseline activity, respectively. These results suggests that Tl-201 could replace Rb-86 in measurement of ouabain sensitive Na+-K+ ATPase activity in vitro. High level of glucose concentration decreased cellular Na+-K+ ATPase activity, but insulin or PMA increased it

  9. Assessment of congenital heart disease by a thallium-201 SPECT study in children

    International Nuclear Information System (INIS)

    The characteristics of correlation between the right-to-left ventricular systolic pressure ratios (RVp/LVp) and the thallium-201 right-to-left ventricular (201Tl R/L) count ratios was investigated in children with various congenital heart diseases. High-resolution three-headed SPECT system equipped with either parallel-hole or fan-beam collimators was used. In a total of 102 patients, the correlation between RVp/LVp and 201Tl R/L average count ratios was good in both planar (r=0.89, p=0.0001) and SPECT studies (r=0.80, p=0.0001). Quantitative analysis of myocardial uptake by SPECT demonstrated the characteristic pattern of each disease as well as the differences in the right ventricular overload types. When the linear regression analysis was performed in each heart disease, ventricular septal defect showed most excellent correlation. Complex heart anomalies also showed positive correlation (r=0.51, p=0.05) with RVp/LVp, and it can be used to estimate right ventricular pressure. After surgical treatment of tetralogy of Fallot and pulmonary stenosis, the decrease of 201Tl R/L count ratio was in accordance with improvement of right ventricular overload. We conclude that 201Tl SPECT study can be a good indicator for estimation of right ventricular pressure. (author)

  10. Subcutaneous injection of thallium-201 chloride and gallium-67 citrate at acupuncture point K-3

    International Nuclear Information System (INIS)

    Subcutaneous (SC) injection of 99mTc pertechnetate (99mTc) at acupuncture points K-3 is a new method of lower-limb radionuclide venography. To investigate the mechanism of absorption of 99mTc from SC injected sites into vascular system, various radioisotopes such as 201Tl chloride (201Tl) and 67Ga citrate (67Ga) were SC injected at K-3 points in animal and human-beings experiments. It was found that 99mTc and 201Tl were absorbed rapidly from K-3 points through venous system and into whole body soft tissue. However, 67Ga with a larger effective ionic radius than 201Tl was not absorbed throughout the observation of 5 minutes. Furthermore, intravenous administration of digitalis, a Na+-K+ pump blocker, did not inhibit the absorption of 99mTc and 201Tl after SC injection at K-3 points. These results suggest that absorption of radionuclides on SC injection at K-3 points is mainly through the passive pathway of diffusion rather than the active transport, and the effective ionic radius may be a major factor influencing the absorption rate of the radionuclides. (author)

  11. Clinical significance of thallium-201 redistribution in old myocardial infarction

    International Nuclear Information System (INIS)

    The purpose of this study is to determine the clinical usefulness of thallium-201 stress myocardial scintigrapny (Tl SMS) in the evaluation of peri-infarct ischemia. Tl SMS and right heart sided hemodynamic measurement during exercise (EX) were performed in 68 pts with old myocardial infarction. The myocardium was devided into 10 segments and regional Tl defect score was visually determined as 0 = normal to 3 = background. Redistribution (Rd) was defined by a decrease in regional defect score > 1 from immediately to 2.5 hours after EX. Of 68 pts. 66 (97 %) showed perfusion defect on images immediately after EX in the infact regions suspected from ECG. Rd in the infarct region occurred in 26 (38 %) of 68 pts with infarction, 18 (44 %) of 41 pts with anterior and 8 (30 %) of 27 pts with inferior infarction. ST-depression in the lead without abnormal Q-wave was demonstrated in 22 (85 %) of 26 pts with Rd, while in 21 (50 %) of 42 pts without Rd (p > 0.005). Chest pain on EX was noticed in 14 (54 %) with Rd, but only in 6 (14 %) without Rd (p > 0.005). Mean pulmonary artery wedge pressure during EX was higher in pts with Rd than in pts without Rd(33.6 +- 12.3 vs 22.4 +- 12.2 mmHg, p < 0.01). There was no relation between Rd and coronary stenosis perfusing infarct area, but pts with Rd were accompanied with jeopardized collateral vessels more frequently compared with pts without Rd (63 vs 28 %, p < 0.05). In conclusion, Tl Rd in the infarct region may be a sign of peri-infarct ischemia and Tl SMS is a useful tool for evaluating the pathologic aspects of old myocardial infarction. (author)

  12. 201Thallium SPECT, accuracy in astrocytoma diagnosis and treatment evaluation

    International Nuclear Information System (INIS)

    The aims of the studies included in this thesis were: - to investigate the reliability of 201Thallium single photon emission computed tomography. Tl SPECT for preoperative diagnosis and histological staging of malignant astrocytomas in comparison with CT; - to develop a method for quantification of cerebral thallium uptake, and to evaluate the quantitative measurement in comparison with CT, for astrocytoma treatment follow-up purposes; - to compare quantitative Tl SPECT and proton magnetic resonance spectroscopy (H-MRS) with conventional MR imaging for astrocytoma monitoring, and to evaluate associations between change of morphological tumour characteristics during treatment and changes of cerebral thallium uptake and metabolic ratios. Results and conclusions: - High TI-index, calculated as a ratio comparing tumour uptake to uptake in the contralateral hemisphere, is an indicator of highly malignant astrocytoma. Differentiation between the high-grade astrocytomas, the low-grade astrocytomas, and infectious lesions is only partial, with an overlap of Tl-indexes between these groups. High-grade astrocytomas that do not show contrast enhancement on CT, and astrocytomas with central necrosis and moderate ring-enhancement, tend to be underestimated when evaluated by Tl-index calculation. Tl SPECT is not a reliable method for non-invasive tumour staging among the group of highly malignant astrocytomas. - Quantification of cerebral TI-uptake, defining the volume of viable tumour tissue, is a new method for astrocytoma chemotherapy monitoring. Results suggest that the method provides prognostic information, and information of treatment efficacy, at an earlier stage than CT. - We did not find a higher accuracy of quantitative Tl SPECT than of MR for monitoring purposes and our results indicated that treatment induced MR changes were interrelated with TI-uptake variations. - Multi-voxel H-MRS was difficult to apply for astrocytoma treatment monitoring, due to the anatomical

  13. LDEF (Postflight), AO201 : Interplanetary Dust Experiment, Tray B12

    Science.gov (United States)

    1990-01-01

    LDEF (Postflight), AO201 : Interplanetary Dust Experiment, Tray B12 The postflight photograph shows little change of the exposed surfaces when compared with the prelaunch photograph. Although not noticable in the photograph, a light coating of contamination was seen on all experiment surfaces in this location. The difference in colors of the IDE detectors, located on the right hand mounting plate, is a result of the reflected surroundings and not related to space exposure. A close observation of the detector surfaces reveal that some damage has occured from meteroid and/or debris impacts. One impact crater can be seen, upper right quadrant, on the detector located in the sixth (6th) row down from the top and the fifth (5th) row from the right. Other impacts, smaller in size, show as small white dots on the detector surface. The solar sensor seems to have changed little, if any. However, the color of the solar array baseplate, showing indications of contamination, appears to be darker than the detector mounting plate. The center section cover plate shows little change when compared with the pre-launch photograph. However, during inspection, a light coat of the brown contamination has been observed on all surfaces. The color of the bonding material (RTV) used to secure several thin specimen, sapphire, to individual mounting plates has changed from pink to gold. At one location, that of a single specimen, the bonding material is more gray than gold in color. This has been attributed to the specimen being considerably thicker. The EPDS thermal cover in the right hand side of the tray shows a light coating of brown contamination on the Chemglaze II A-276 white paint.

  14. Analysis of coronary hemodynamics in exercise by 201Tl scintigraphy

    International Nuclear Information System (INIS)

    From our observation that initial distribution of 201Tl in tissue is mainly dependent on blood flow distribution, we designed the method to obtain the rates of change of coronary blood flow and coronary vascular resistance and applied it to the analysis of coronary hemodynamics in patients with ischemic heart disease during submaximal exercise. We measured the rates of change of cardiac output (Δ CO) and myocardial blood flow distribution (Δ Fract) in two occasions by the sequential two injections of Tl, and obtained the rate of change of coronary blood flow (Δ Flow) from Δ CO and Δ Fract. Using the rate of change of mean blood pressure, we calculated also the rate of change of coronary vascular resistance (Δ CVR). The initial components of histograms of the right ventricle by the first and second injections of Tl were fitted into gamma function curve. S1 and S2 were the areas bounded by the curve and baseline of the first and second injections, and then the cardiac output ratio was estimated by R x S1/S2, where R was the dose ratio measured by another camera system. The five min count rates on the myocardium by the first (H1) and second (H2) injections of Tl were calculated five min after the injection. H2 was approximately H1 x R in the same condition of Tl injection but H2 was not equal to H1 x R, when the Tl injection was done in the different loading condition. Therefore the rate of change of myocardial blood flow distribution was calculated as Δ Fract = (H1 x R - H2)/H2. With submaximal exercise the increases in Δ CO, Δ Fract and Δ Flow were smaller in patients with ischemic heart disease (IHD) than those in control subjects. In the patients with IHD, there was response of lesser degree in Δ Flow under increased myocardial oxygen demand, suggesting low coronary reserve in this condition. (author)

  15. Sequential change of cardiomyopathy of Duchenne muscular dystrophy by 201Tl myocardial SPECT

    International Nuclear Information System (INIS)

    201Tl myocardial SPECT were performed to evaluate of cardiomyopathy in Duchenne type of progressive muscular dystrophy (DMD). Follow up SPECT images of the same patients were also obtained about 1 year after the first scan. Cases subjected to study were 10 DMD. At the first study the hypoperfusion area of the left ventricular muscle were observed in 6 cases (60%) out of 10. At the second study the hypoperfusion areas became wider and lower in 4 out of 6 cases (66.7%). The new hypoperfusion area which was not demonstrated at the first study was observed at the second study in one case of these cases. These results suggested that the positive rate of cardiomyopathy in DMD by 201Tl myocardial SPECT was high, and 201Tl myocardial SPECT is a useful examination to detect the change of myocardial damage in DMD. (author)

  16. Long term retention and excretion of 201Tl in a patient after myocardial perfusion imaging

    International Nuclear Information System (INIS)

    201Tl is widely used in nuclear medicine to carry out myocardial perfusion imaging (MPI). However, very limited data is available on long-term distribution in the body, excretion and corresponding dose. In this study we performed a 2 month follow-up of a patient who underwent MPI, by urine analysis and in vivo measurements. The biological half-life of thallium was consequently estimated to be 11.6-27 d, which is in partial agreement with previous studies. We also estimated excretion and retention of 200Tl, 201Tl and 202Tl isotopes using the biokinetic parameters from ICRP publication 53 and compared the forecast result with actual measurements. The latter demonstrated a higher urinary excretion and a higher body retention than what was expected. Our results therefore suggest that the long-term retention and consequently the effective dose coefficient for 201Tl considered in ICRP publications 53 and 80 may be slightly underestimated. (authors)

  17. Long term retention and excretion of 201Tl in a patient after myocardial perfusion imaging.

    Science.gov (United States)

    Blanchardon, E; Challeton-de Vathaire, C; Boisson, P; Célier, D; Martin, J-C; Cassot, S; Herbelet, G; Franck, D; Jourdain, J R; Biau, A

    2005-01-01

    201Tl is widely used in nuclear medicine to carry out myocardial perfusion imaging (MPI). However, very limited data is available on long-term distribution in the body, excretion and corresponding dose. In this study we performed a 2 month follow-up of a patient who underwent MPI, by urine analysis and in vivo measurements. The biological half-life of thallium was consequently estimated to be 11.6-27 d, which is in partial agreement with previous studies. We also estimated excretion and retention of 200Tl, 201Tl and 202Tl isotopes using the biokinetic parameters from ICRP publication 53 and compared the forecast result with actual measurements. The latter demonstrated a higher urinary excretion and a higher body retention than what was expected. Our results therefore suggest that the long-term retention and consequently the effective dose coefficient for 201Tl considered in ICRP publications 53 and 80 may be slightly underestimated. PMID:15671052

  18. Thallium-201: quantitation of right ventricular hypertrophy in chronically hypoxic rats

    International Nuclear Information System (INIS)

    Sprague Dawley rats were divided into two groups. Ten were kept in room air and 10 in hypobaric hypoxia (air at 380 m Hg). After two weeks all were injected intravenously with 50 μCi of 201Tl and sacrificed. The right and left ventricles were separated, weighed, and measured for radioactivity in a gamma well counter. Left and right ventricular mass ratios (MR) correlated with 201Tl radioactivity ratios (TAR) in both control and hypoxic rats: r = 0.962 where MR = 0.863 TAR + 0.27. Myocardial 201Tl uptake reflects and quantitates normal and abnormal ventricular mass, the abnormal mass in this model consisting of right ventricular hypertrophy associated with hypoxic pulmonary hypertension

  19. REMOVAL OF GLUCORAPHENIN FROM THE EXTRACT OF RADISH PIGMENT BY ANION EXCHANGE RESIN 201×7

    Institute of Scientific and Technical Information of China (English)

    ZhouXiaohua; ChenQi

    1998-01-01

    A method for removimg glucoraphenin from the extract of Radish pigment by anion exchange resin 201×7 was studied.The adsorption capacity of 201×7 resin for glucoraphenin was 72.8mg/ml resin,the equilibrium time 55 minutes,and the optinum pH5.5.All glucoraphenin that had been adsorbed on 201×7 resin was eluted by 1.5BV.hr-1, eluent in whinc concentration of NaOH was 0.05mol·L-1 at the flow rate of 1.5BV/h.Extracting solution of deglucoraphenin was enriched by vacuum and spray drying.A powder product of Radish pigment was obtained and E1cm1%=4.30.

  20. 75 FR 3705 - Foreign-Trade Zone 201-Holyoke, MA; Application for Subzone; Yankee Candle Corporation (Candles...

    Science.gov (United States)

    2010-01-22

    ... Foreign-Trade Zones Board Foreign-Trade Zone 201--Holyoke, MA; Application for Subzone; Yankee Candle Corporation (Candles and Gift Sets); Whately and South Deerfield, MA An application has been submitted to the..., grantee of FTZ 201, requesting special-purpose subzone status for the candle and gift set...

  1. 47 CFR 95.201 - (R/C Rule 1) What is the Radio Control (R/C) Radio Service?

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false (R/C Rule 1) What is the Radio Control (R/C) Radio Service? 95.201 Section 95.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PERSONAL RADIO SERVICES Radio Control (R/C) Radio Service...

  2. 37 CFR 201.29 - Access to, and confidentiality of, Statements of Account, Verification Auditor's Reports, and...

    Science.gov (United States)

    2010-07-01

    ... filed in the Copyright Office for digital audio recording devices or media. 201.29 Section 201.29...'s Reports, and other verification information filed in the Copyright Office for digital audio... appropriate parties. (b) Definitions. (1) Access includes inspection of and supervised making of notes...

  3. 45 CFR 201.6 - Withholding of payment; reduction of Federal financial participation in the costs of social...

    Science.gov (United States)

    2010-10-01

    ... financial participation in the costs of social services and training. 201.6 Section 201.6 Public Welfare... Federal financial participation in the costs of social services and training. (a) When withheld. Further... (AABD) of the Act, Federal financial participation in the costs of social services and training...

  4. Thallium chloride 201Tl combined with single photon emission computed tomography (SPECT) in the evaluation of vestibular schwannoma growth

    DEFF Research Database (Denmark)

    Charabi, Samih Ahmed; Lassen, N A; Thomsen, J;

    1997-01-01

    Thallium chloride 201Tl combined with SPECT was performed in a series of 29 patients with neuroradiological evidence of vestibular schwannoma (VS). The relative tumor uptake (U) and relative tumor concentration (C) of the radiotracer 201Tl was determined, and the cerebellum served as a reference...

  5. 9 CFR 201.49 - Requirements regarding scale tickets evidencing weighing of livestock, live poultry, and feed.

    Science.gov (United States)

    2010-01-01

    ... evidencing weighing of livestock, live poultry, and feed. 201.49 Section 201.49 Animals and Animal Products... regarding scale tickets evidencing weighing of livestock, live poultry, and feed. (a) Livestock. When... copy shall be furnished to or retained by the live poultry dealer. (c) Feed. (1) Whenever feed...

  6. Myocardial perfusion as assessed by thallium-201 scintigraphy during the discontinuation of mechanical ventilation in ventilator-dependent patients

    International Nuclear Information System (INIS)

    Patients who cannot be separated from mechanical ventilation (MV) after an episode of acute respiratory failure often have coexisting coronary artery disease. The authors hypothesized that increased left ventricular (LV) wall stress during periods of spontaneous ventilation (SV) could alter myocardial perfusion in these patients. Using thallium-201 (201TI) myocardial scintigraphy, the authors studied the occurrence of myocardial perfusion abnormalities during periods of SV in 15 MV-dependent patients (nine women, six men; aged 71 ± 7 yr, mean ± SD). Fourteen of these patients were studied once with 201TI myocardial scintigraphy during intermittent mechanical ventilation (IMV) and again on another day, after at least 10 min of SV through a T-piece. One patient was studied during SV only. Thirteen of 14 of the patients (93%) studied during MV had abnormal patterns of initial myocardial 201TI uptake, but only 1 patient demonstrated redistribution of 201TI on delayed images. The remainder of the abnormalities observed during MV were fixed defects. SV produced significant alterations of myocardial 201TI distribution or transient LV dilation, or both, in 7 of the 15 patients (47%). Four patients demonstrated new regional decreases of LV myocardial thallium concentration with redistribution of the isotope on delayed images. The patient studied only during SV also had myocardial 201TI defects with redistribution. Five patients (3 also having areas of 201TI redistribution) had transient LV dilation during SV

  7. 40 CFR 201.26 - Procedures for the measurement on receiving property of retarder and car coupling noise.

    Science.gov (United States)

    2010-07-01

    ... receiving property of retarder and car coupling noise. 201.26 Section 201.26 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS NOISE EMISSION STANDARDS FOR TRANSPORTATION... receiving property of retarder and car coupling noise. (a) Retarders—(1) Microphone. The microphone must...

  8. 7 CFR 201.58 - Substrata, temperature, duration of test, and certain other specific directions for testing for...

    Science.gov (United States)

    2010-01-01

    .... Editorial Note: For Federal Register citations affecting § 201.58, see the List of CFR Sections Affected... 7 Agriculture 3 2010-01-01 2010-01-01 false Substrata, temperature, duration of test, and certain... REGULATIONS Germination Tests in the Administration of the Act § 201.58 Substrata, temperature, duration...

  9. Sensitivity and specificity of thallium-201 scintigraphy for the diagnosis of malignant vertebral fractures

    International Nuclear Information System (INIS)

    Objective: To evaluate the accuracy of thallium-201 (201TI) scintigraphy in distinguishing a benign from a malignant recent non-traumatic vertebral fracture. Methods: Study design--Single center, prospective study. Participants--Patients hospitalized for a recent non-traumatic vertebral fracture. Evaluation--Usual clinical, laboratory and radiological assessment; 201TI vertebral scintigraphy: patients were injected with iv 3 mCi 201TI. Early and delayed images of the fractured vertebra were obtained. Data analysis--(1) Two examinators, unaware of the other findings, rated the images as hyperfixation or not of the fractured vertebra; (2) the ratio (average count per pixel of the fractured vertebra/normal adjacent vertebrae) were calculated. The final diagnosis was established on the result of vertebral biopsy or on follow-up. Results: Twenty-one patients were included. The final diagnosis was a benign vertebral fracture in 14 patients and a malignant vertebral fracture in 7. The sensitivity, specificity, positive and negative predictive values for a malignant fracture on early 201TI vertebral scintigraphy images were 28.6, 92.9, 66.6, and 72.2%, respectively, and on delayed images were 28.6, 100, 100, and 73.7%, respectively. The ratio of lesioned over normal tissue was not increased in malignant, compared with benign fractures. Conclusion: The weak sensitivity does not support the wide use of 201TI bone scintigraphy to distinguish a benign from a malignant recent non traumatic vertebral fracture. However, the high specificity suggests that such evaluation might be proposed prior to vertebral biopsy in some difficult cases

  10. Studies on portal systemic circulation by oral administration of 201Tl enclosed enteric coated capsule

    International Nuclear Information System (INIS)

    Thallium-201 enclosed enteric coated capsule was prepared and administered orally to evaluate portal systemic circulation in 11 control subjects and 31 patients with various liver diseases by investigating scintigraphic appearance and the heart-to-liver uptake ratio (H/L ratio). In 10 patients with liver cirrhosis and one with chronic hepatitis, the results of H/L ratio were compared to those obtained by 201Tl per-rectal administration. 1. It was fundamentally confirmed that 201Tl enclosed enteric coated capsule was not broken down in the artificial gastric juice, but nearly completely melted 15 minutes after soaking in the artificial intestinal juice. 2. Clinical study was successfully completed in 36 out of 42 cases (86 %). Unsuccessful cases were found in 2 with capsule collapse in the stomach and 4 with its poor moving to the duodenum. 3. In control subjects the liver was clearly visualized and the mean value of H/L ratio was 0.32 which is lower than that of 201Tl per-rectal administration previously reported. H/L ratio in patients with chronic and acute hepatitis was nearly equal to that in control subjects. H/L ratio in patients with liver cirrhosis was slightly higher than that in control subjects, but there was no significant difference between them. In cases with esophageal varices, H/L ratio was not so high compared to that in control subjects. Out of 7 patients showing high H/L ratio more than 0.8 in 201Tl per-rectal administration, only one showed similar high ratio (1.07) in oral administration of 201Tl enclosed enteric coated capsule. In this case the shunting from superior mesenteric vein to inferior vena cava connection was confirmed. From these results, it was considered that the shunting volume of superior mesenteric vein through esophageal varices is small. 4. A possibility of a new administration of radioisotope with enteric coated capsule was emphasized. (author)

  11. Evaluating the sensitivity and specificity of 201Tl SPECT in intracranial tumoral pathology

    International Nuclear Information System (INIS)

    The aim of this study was to evaluate the sensitivity of SPECT with 201Tl in detecting the cerebral tumors. A hundred and forty nine explorations were carried out (107 SPECT in patients clinically suspected and/or cerebral tumor radiography, 42 SPECT in patients treated for cerebral tumor to evaluate the persistence of the tumoral tissue immediately post-operation, or the presence of a tumoral recurrence). The SPECTs were achieved 15 minutes after the IV injection of 185 MBq of 201Tl with a double head Elscint Helix HR camera with fan collimators. The reconstructions were obtained by retro-projection with a Metz 3.13 filter. As the brain normally do not capture 201Tl, any fixation of 201Tl was considered an positive examination. The final diagnosis was based either on the histology (n = 41) or on clinical evolution (n = 149). The pathologies recorded were: 33 glial tumors, 32 metastases (51 lesions), 14 meningiomas, 1 hypophyseal adenoma, 1 cranio-pharyngogioma, 1 malign lymphoma, 1 gr.4 neurinomas, 1 arachnoid cyst, 34 AVCs, 24 normal, 2 complete surgical extirpations, and 5 necroses after treatment. In our population the sensitivity of SPECT with 201Tl for the diagnosis of intracranial tumors was calculated to be 91.5% and the specificity, 98.5%. We have met a false positive (recent hemorrhagic AVC) and 7 false negatives (4 metastases of which 3 were under 1 cm and another largely necrotic, 3 patients presenting residual tumoral tissue immediately post-operation, presently in recurrence). These excellent results prove the utility of SPECT with 201Tl both for positive diagnosis of cerebral tumors and for evaluation of these tumors after treatment

  12. The influence of thallium 201 scintigraphy on the clinical estimation of chest pain

    International Nuclear Information System (INIS)

    The histories of 60 patients without myocardial infarction complaining of chest pain, who had undergone coronary angiography, were submitted to 6 observers unaware of the angiographic findings. Results of ECGs at rest and on exertion were communicated to them. Observers were requested to estimate the likelihood (L) of coronary heart disease to be present in % and to assess the need for coronary angiography. (5-score scale, 1 = definitely not indicated, 5 = absolutely indicated). After being told the outcome of 201-T1 imaging after intravenous dipyridamol observers were again requested to estimate the likelihood of CHD and evaluate indications for angiography. In the 43 patients with CHD L was rated 75.6% +- 20.2 without knowledge of the 201-T1 findings. After being told the 201-T1 findings observers increased their estimates to 82.9% +- 23.2 (p 0.001). Indications for coronary angiography increased from 4.3 +- 0.9 to 4.5 +- 0.9 (p<0.001). In subjects without angiographic evidence of coronary disease the pre-201-T1 L was rated at 36.7 + 22.0, and the post-201-T1 L was 24,8% +- 21.0 (p<0.001). Estimated indications for angiography dropped from 2.7 +- 1.1 to 2.2 += 1.2 (p<0.001). Awareness of the findings of 201-T1 imaging after intravenous dipyridamol thus significantly improved the clinical assessment of both coronary patients and patients without coronary disease complaining of chest pain. Similarly, patient management in terms of indications for coronary angiography was favorably influenced in both groups. (Author)

  13. Role of 201T1 in the management of cardiac transplantation

    International Nuclear Information System (INIS)

    Serial percutaneous endomyocardial biopsy is the standard for diagnosis of cardiac rejection; it is generally done on a weekly basis for the first month and then as indicated by ECG voltage; but, this method is invasive, can be done only in specialized centers, not available for the many patients who return home, requires 18-24 h before a result is obtained, delaying institution of therapy, and it is aggressive for the endomyocardium of the graft. A reliable, rapid, and noninvasive test for detection of cardiac rejection is still not available. The aim of this work was to determine whether 201Tl uptake was significantly correlated with the histological findings presenting in cardiac rejection. Auxiliary heart transplantation was carried out on 60 mole rats. Graft viability was evaluated by direct palpation, ECG voltage, and 201Tl uptake during the study (from 4-6 h after transplantation to 1 month). Syngenic rats (without rejection) were used as a control group. Histological studies were done at the end of the isotope study in all animals. The statistical significance of all results was determined by means of Student's t-test. A very significant correlation between the severity of the histological findings of rejection and 201Tl uptake was found (P201Tl uptake detected rejection earlier than ECG voltage; moreover, 201Tl uptake was more sensitive in detecting a mild degree of rejection while ECG only detected a moderate degree. We believe that 201Tl uptake should be the screening method for the follow-up of cardiac transplantation; if offers to surgeons the opportunity to select patients for endomyocardial biopsy, with a higher accuracy than the other noninvasive methods. (orig.)

  14. Clinical studies on the thallium-201 myocardial scintiphotography in the patients with ischemic heart diseases

    International Nuclear Information System (INIS)

    Thallium-201 (201Tl) myocardial scintiphotography was performed in 34 patients with myocardial infarction and 13 with angina pectoris. Changing pattern of 201Tl activity in various organs observed. Myocardial blood flow was calculated from the relation of these activities. The body surface radioactivity of 201Tl decreased rapidly in initial phase, it gradually slowed down then reached to plateau on the heart and the lungs, while it increased gradually on the liver and kidneys. In patients with congestive heart failure, blood clearance of 201Tl was delayed and radioactivity on the lung area was increased compared with normal case. MBF/CO (%) ratio was calculated by the following way. Soon after the injection of 201Tl, serial images including whole chest were taken one frame in each one second during 30 seconds. Total injected dose was calculated from the maximum radioactivity in the frame. Myocardial uptake was calculated by the anterior view subtracting the mediastinal activity as the background at 5 minutes after the injection. MBF/CO (%) ratio was calculated as the myocardial uptake divided by the activity of total injected dose. Its mean value were 3.49 +- 0.45% in normals, 2.84 +- 0.47% in myocardial infarction and 3.00 +- 0.37% in angina pectoris, respectively, which showed significant low values in the latter two groups. MBF (ml/min/m2) = MBF/CO (%) x Cardiac index (CI). The mean value of MBF was 100.4 +- 12.7 ml/min/m2 in normals, 80.5 +- 21.1 in myocardial infarction and 77.3 +- 15.4 in angina pectoris, respectively, showing also significant low values in the latter two groups. Especially, MBF was most significant low in the groups of myocardial infarction with high serum CPK values. (author)

  15. Chest Pain with Normal Thallium-201 Myocardial Perfusion Image – Is It Really Normal?

    Science.gov (United States)

    Liu, Pang-Yen; Lin, Wen-Yu; Lin, Li-Fan; Lin, Chin-Sheng; Lin, Wei-Shiang; Cheng, Shu-Meng; Yang, Shih-Ping; Liou, Jun-Ting

    2016-01-01

    Background Thallium-201 myocardial perfusion image (MPI) is commonly used to detect coronary artery disease in patients with chest pain. Although a normal thallium-201 MPI result is generally considered to be a good prognosis and further coronary angiogram is not recommended, there are still a few patients who suffer from unexpected acute coronary events. The aim of this study was to investigate the clinical prognosis in patients with normal thallium-201 MPI. Methods From January 2006 to August 2012, a total 22,003 patients undergoing thallium-201 MPI in one tertiary center were screened. Of these, 8092 patients had normal results and were investigated retrospectively. During follow-up, 54 patients underwent coronary angiogram because of refractory typical angina pectoris or unexpected acute coronary events. These 54 patients were divided into 2 groups: group I consisted of 26 (48.1%) patients with angiography-proven significant coronary artery stenosis, and group II consisted of 28 (51.9%) patients without significant stenosis. Results Patients in group I had a higher prevalence of prior coronary stenting and electrocardiographic features of ST depression compared with patients in group II. The multivariate analysis demonstrated that both prior coronary stenting and ST depression were risk predictors of unexpected acute coronary events in the patients with normal thallium-201 MPI [odds ratio (OR), 5.93; 95% confidence interval (CI): 1.03-34.06, p = 0.05 and OR, 7.10; 95% CI: 1.28-39.51, p = 0.03,respectively]. Conclusions Although there is a low incidence of unexpected acute coronary events in patients with chest pain and normal thallium-201 MPI, physicians should be aware of the potentials risk in certain patients in this specific population.

  16. Studies on Feeding Animals with Straw of Grain-Straw-Dual-Use-Rice 201

    Institute of Scientific and Technical Information of China (English)

    ZHENG Jin-gui; CHEN Jun-chen; HUANG Qin-lou; ZHENG Kai-bin; YE Xin-fu; TU Jie-feng; CHEN Bing-huan

    2002-01-01

    The straw of Grain-Straw-Dual-Use-Rice (GSDUR) variety 201 of which the grain quality and yield were equivalent to that of common rice variety (the grain yield approximately 7.5 t ha-1 ), but straw protein content was 9.31% (common rice straw i.e. CK was approximately 4.0%), and other eight fodder indexes were better than CK to some extent, was employed to feed animals. 15 N tracing result suggested that the protein in 201 straw could be effectively transformed into fish body protein and white mouse body protein. The digestibility of fodder, the 15N recovery rate of animal body and the absorption of fodder protein were 13.8,9.6, 24. 49 % and 16.5, 6.0, 47.2 % higher than those of common rice straw respectively when feeding grass carp and white mice with 201 rice straw, whereas the 1s N recovery rates of animal manure were 3.25, 6.5 %lower than those of common rice straw, respectively. The results of feeding animals with 201 straw were as carp, fish weight gain per kg fresh rice straw were increased by 60.0, 16.8 and 37.0% respectively when 201fresh straw was used to feed grass carp compared to feeding CK, and fish yield could be increased by 297.5 kg creased by 33.9 and 26.8% respectively when 201 rice straw was used as the main raw material of the compound fodder to feed white geese compared to feeding CK, and geese weight could be increased by 2 358.0 kg powder substituting for wheat bran which made up of 5 % compound fodder to feed cross bred pigs compared to CK, but 0. 11 kg fine fodder could be saved when 1 kg cross bred pig weight was increased.

  17. Experimental investigation of 201TlCl-scintigraphy in evaluating therapeutic effect of hyperthermia

    International Nuclear Information System (INIS)

    We investigated the usefulness of 201Tl-scintigraphy in the evaluation of therapeutic effect of hyperthermia. Satoh's experimental lung cancer tumors implanted in the right thighs of donryu rats were treated with hyperthermia using water bath. Tumors were heated at 44degC or 46degC for 15 min. 201Tl-scintigraphy was obtained before, immediately after and 24 hrs after treatment. Counts ratio of the tumor of the normal muscle (T/N ratio) was measured by gamma camera. We examined blood flow of the tumor, and relative tumor growth rate, and performed autoradiogram and histopathological examination of the tumor after 201Tl-scintigraphy. Immediately after hyperthermia, T/N ratio and blood flow of the tumor significantly decreased (p201TlCl in the tumor decreased diffusely. Histopathological finding showed congestion, thrombosis, and swelling of endothelial cells. These results suggest that the decrease in T/N ratio may be caused by the vascular damage due to hyperthermia. The T/N ratio recovered 24 hrs after hyperthermia but was still lower than that for the control. Autoradiogram showed that 201TlCl greatly accumulated in viable tumor tissue but was hardly seen in the necrotic tumor tissue. These results suggest that the decrease in T/N ratio may be caused by increase of necrotic areas. The T/N ratio 24 hrs after hyperthermia correlated (r=0.83) with relative tumor growth rate on 7th day after hyperthermia and, therefore, can be used as an indicator of relative tumor growth rate. 201Tl-scintigraphy can be useful for prediction of therapeutic effect of hyperthermia. (author)

  18. Limited performance of quantitative assessment of myocardial function by thallium-201 gated myocardial single-photon emission tomography

    International Nuclear Information System (INIS)

    We investigated the reproducibility between thallium-201 and technetium-99m methoxyisobutylisonitrile (MIBI) gated single-photon emission tomography (SPET) for the assessment of indices of myocardial function such as end-diastolic and end-systolic volume (EDV, ESV), ejection fraction (EF) and wall motion. Rest 201Tl (111 MBq) gated SPET was sequentially performed twice in 20 patients. Rest 201Tl gated SPET and rest 99mTc-MIBI (370 MBq) gated SPET were performed 24 h apart in 40 patients. Wall motion was graded using the surface display of the Cedars quantitative gated SPET (QGS) software. EDV, ESV and EF were also measured using the QGS software. The reproducibility of functional assessment on rest 201Tl gated SPET was compared with that on 99mTc-MIBI gated SPET, and also with that between 201Tl gated SPET and 99mTc-MIBI gated SPET performed on the next day. The two standard deviation (2 SD) values for EDV, ESV and EF on the Bland-Altman plot were 29 ml, 19 ml and 12%, respectively, on repeated 201Tl gated SPET, compared with 14 ml, 11 ml and 5.3% on repeated 99mTc-MIBI gated SPET. The correlations were good (r=0.96, 0.97 and 0.87) between the two measurements of EDV, ESV and EF on repeated rest studies with 201Tl and 99mTc-MIBI gated SPET. However, Bland-Altman analysis revealed that the 2 SD values between the two measurements were 31 ml, 23 ml and 12%. We were able to score the wall motion in all cases using the 3D surface display of the QGS on 201Tl gated SPET. The kappa value of the wall motion grade on the repeated 201Tl study was 0.35, while that of the wall motion grade on the repeated 99mTc-MIBI study was 0.76. The kappa value was 0.49 for grading of wall motion on repeated rest studies with 201Tl and 99mTc-MIBI. In conclusion, QGS helped determine EDV, ESV, EF and wall motion on 201Tl gated SPET. Because the EDV, ESV and EF were less reproducible on repeated 201Tl gated SPET or on 201Tl gated SPET and 99mTc-MIBI gated SPET on the next day than on repeated

  19. Myocardial ischemia detection by artificial intelligence interpretation of Tl-201 tomograms

    International Nuclear Information System (INIS)

    This paper reports on an expert system environment which automatically assigned certainty factors to abnormal regions in stress and delayed myocardial thallium-201 polar bulls-eye plots. MYCIN-type algorithms propagated certainty factors for the presence, location, and character of each coronary lesion. Ninety-four previously validated rules that considered only stress perfusion defects spawned 91 new rules considering tracer redistribution. Fifteen new rules assessed vascular territories for the presence and location of fixed or reversible defects. This artificial intelligence tool can provide novice readers of cardiac T1-201 studies automatic, consistent, objective, and justified interpretations that consider artifacts, coronary territory overlap, and multiple defects

  20. Diagnosis of myocardial ischaemia using exercise ST mapping and afterload 201Tl scintigraphy

    International Nuclear Information System (INIS)

    Two non-invasive methods are compared used in the diagnosis of myocardial ischaemia, i.e. precordial exercise mapping of the ST segment and after load 201Tl scintigraphy of the myocardium.High sensitivity of mapping (89.3%) and of 201Tl scan (92.9%) was found compared to the findings on the coronary arteries. The specificity of both methods was lower (57.1%). Both methods give similar results in diagnosis of myocardial ischaemia; for localization the affection site thallium scintigraphy of the myocardium is preferably used. (author). 2 figs., 2 tabs., 23 refs

  1. 201Tl brain SPECT in differentiating central nervous system lymphoma from toxoplasmosis in AIDS patients

    International Nuclear Information System (INIS)

    In AIDS patients, toxoplasmosis and lymphoma are the leading causes of CNS mass lesions. It is important to make the correct diagnosis expeditiously, since the two diseases require markedly different treatments and have different prognoses. In general, CT and MR imaging have failed to provide specific distinguishing characteristics to differentiate CNS lymphoma from toxoplasmosis, and it is difficult to differentiate these entities clinically. We performed 201Tl brain SPECT in order to differentiate two diseases. Counts ratio of a lesion to the normal brain (L/N ratio) was elevated in patients of lymphoma compared in patients of toxoplasmosis. 201Tl brain SPECT is useful to differentiate CNS lymphoma from toxoplasmosis. (author)

  2. Vital Organ Tissue Oxygenation After Serial Normovolemic Exchange Transfusion With HBOC-201 in Anesthetized Swine

    OpenAIRE

    Muir, William W; Ilangovan, Govindasamy; Zweier, Jay L.; Moon-Massat, Paula F.; Rentko, Virginia T.

    2011-01-01

    This study determined the effects of serial, normovolemic, stepwise exchange transfusions with either 6% human serum albumin (HSA) or the hemoglobin-based oxygen carrier, HBOC-201, on tissue oxygenation of the heart, brain and kidney in intact anaesthetized pigs. Exchange transfusions to 10%, 30% and 50% of the pigs total blood volume were completed at a withdrawal rate of 1.0 ml/kg/min followed by an infusion rate of 0.5 ml/kg/min of HBOC-201 or iso-oncotically matched 6% HSA. Measurements i...

  3. INGN 201: Ad-p53, Ad5CMV-p53, adenoviral p53, p53 gene therapy--introgen, RPR/INGN 201.

    Science.gov (United States)

    2007-01-01

    Introgen and its wholly owned European subsidiary Gendux AB are developing an adenoviral p53 gene therapy as a treatment for cancer in the US and Europe, respectively. Phase III trials in patients with head and neck cancer are ongoing, and a number of clinical trials in other cancer indications have been completed. INGN 201 is being reviewed by the EMEA for approval in Li-Fraumeni syndrome (LFS) under the provisions of exceptional circumstance; the therapy is available on a compassionate use basis to eligible LFS cancer patients under a protocol authorised by the US FDA. The p53 tumour suppressor gene is deleted or mutated in many tumour cells and is one of the most frequently mutated genes in human tumours. The p53 protein is one of the most intricate elements in the apoptotic signalling cascade, and a mutation in the gene encoding it is believed to result in a decreased ability of a cell to apoptose. Thus replacing this gene via adenovirally-mediated p53 gene therapy is hoped to result in increased apoptosis where it is administered.INGN 201 is available for licensing, although Introgen favours retaining partial or full rights to the therapy in the US. Introgen entered into a license agreement with The University of Texas System and MD Anderson Cancer Center in 1994. The technologies licenced include p53 and fus1 (INGN 401). The collaboration has yielded exclusive patent and licensing rights to numerous technologies. Introgen entered into a collaboration with Rhône-Poulenc Rorer Pharmaceuticals (now sanofi-aventis) to develop therapeutics based on p53 inhibition in October 1994. However, in June 2001 this relationship was restructured and Introgen assumed responsibility for the worldwide development of all p53 products including INGN 201, and acquired all marketing and commercialisation rights with respect to those products. Introgen initiated two phase III trials in head and neck cancer (in June 2000 and May 2001) at about 80 sites in the US, Canada and Europe

  4. 7 CFR 201.33 - Seed in bulk or large quantities; seed for cleaning or processing.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Seed in bulk or large quantities; seed for cleaning or... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling in General § 201.33 Seed in bulk or large quantities; seed for cleaning or processing. (a) In the case of seed in bulk, the information required...

  5. 7 CFR 201.76 - Minimum Land, Isolation, Field, and Seed Standards.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Minimum Land, Isolation, Field, and Seed Standards... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.76 Minimum Land, Isolation, Field, and Seed Standards. In the following Table 5 the figures in the “Land” column indicate the...

  6. 9 CFR 201.86 - Brand inspection: Application for authorization, registration and filing of schedules, reciprocal...

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Brand inspection: Application for authorization, registration and filing of schedules, reciprocal arrangements, and maintenance of identity of... STOCKYARDS ACT Inspection of Brands § 201.86 Brand inspection: Application for authorization,...

  7. Evaluation of regional myocardial perfusion in patients with cardiomyopathy using dipyridamole thallium-201 emission computed tomography

    International Nuclear Information System (INIS)

    Myocardial emission computed tomography with thallium-201 was performed immediately and at 3 hr after iv infusion of dipyridamole in 20 patients with nonobstructive hypertrophic cardiomyopathy (HNCM) and 20 patients with dilated cardiomyopathy (DCM). The results were compared with findings of two-dimensional echocardiography and pathological findings. In the HNCM group, early Tl-201 imaging did not show perfusion defects in 9 patients (Group I), but showed them in 11 patients (Group II). Redistribution (Rd) was seen on delayed Tl-201 images in all of the HNCM group. Although percent fractional shortening of the septal and posterior walls was significantly reduced in Group II when compared with Group I, there was no difference in echocardiographic findings between the Groups. Percent fibrosis was significantly higher in Group II than Group I. All patients of the DCM group showed Tl-201 perfusion defects on early images, 9 of whom had Rd on delayed images. Percent fractional shortening was significantly elevated in patients with Rd than those without Rd. Ventricular wall motion abnormality was slight in the area with Rd, as compared with that without Rd. Percent fibrosis of the septal wall was higher in the presence of Rd than in the absence of Rd. The results indicate reduced coronary flow reverse in some of the cardiomyopathy patients. The reduced coronary reverse may be attributable to the mechanism involved in the fibrosis and be related to pathophysiologic progression. (Namekawa, K.)

  8. 49 CFR 179.201-8 - Sampling device and thermometer well.

    Science.gov (United States)

    2010-10-01

    ... FOR TANK CARS Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.201-8... lading, and must withstand a pressure of 100 psig without leakage. Interior pipes of the sampling valve must be equipped with excess flow valves of an approved design. Interior pipe of thermometer well...

  9. False-negative dipyridamole-thallium-201 myocardial imaging after caffeine infusion

    International Nuclear Information System (INIS)

    The vasodilator effect of intravenously administered dipyridamole may be caused by an increase in endogenous plasma adenosine levels. The authors evaluated the effect of caffeine, an adenosine receptor antagonist, on the diagnostic results of dipyridamole-201Tl myocardial imaging in eight patients with coronary artery disease. Caffeine infusion significantly attenuated the dipyridamole-induced fall in blood pressure and the accompanied increase in heart rate. The infusion of dipyridamole alone resulted in chest pain and ST-segment depressions on the electrocardiogram in four patients, whereas none of these problems occurred when the tests were repeated after caffeine. In six of eight patients, caffeine was responsible for false-negative dipyridamole-201Tl tests. Semiquantitive scores of the dipyridamole-induced 201Tl perfusion defects were decreased by caffeine from 9.0 ± 0.9 to 2.0 ± 1.1 points (p less than 0.05). Computerized analysis revealed a caffeine-mediated reduction in the percent reversibility of the images from 46% ± 16% to 6% ± 10% (p less than 0.05). They conclude that the use of caffeinated products prior to dipyridamole-201Tl testing may be responsible for false-negative findings

  10. 22 CFR 201.64 - Application of the price rules to commodities.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Application of the price rules to commodities... APPLICABLE TO COMMODITY TRANSACTIONS FINANCED BY USAID Price Provisions § 201.64 Application of the price rules to commodities. (a) Calculation of commodity prices on a common basis. In testing whether...

  11. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Tannic acid and barium enema preparations. 201.304... Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished...

  12. 77 FR 40338 - Announcing Revised Draft Federal Information Processing Standard (FIPS) 201-2, Personal Identity...

    Science.gov (United States)

    2012-07-09

    ... April 8, 2005 (70 FR 17975), and in accordance with NIST policy was due for review in 2010. In... agencies. On March 8, 2011, a notice was published in the Federal Register (76 FR 12712), soliciting public... Standard (FIPS) 201-2, Personal Identity Verification (PIV) of Federal Employees and Contractors,...

  13. 18 CFR 701.201 - Availability of records and informational materials.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Availability of records... RESOURCES COUNCIL COUNCIL ORGANIZATION Availability of Information § 701.201 Availability of records and... investigative techniques and procedures, or (vi) endanger the life or physical safety of law...

  14. 9 CFR 201.67 - Packers not to own or finance selling agencies.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Packers not to own or finance selling... STOCKYARDS ACT Trade Practices § 201.67 Packers not to own or finance selling agencies. No packer subject to the Act shall have an ownership interest in, finance, or participate in the management or operation...

  15. The cardiomyopathy in Friedreich's ataxia: isotopic ventriculography and myocardial imaging with thallium-201

    International Nuclear Information System (INIS)

    Myocardial scanning after the intravenous administration of Thallium 201 was used to evaluate regional myocardial perfusion in 14 patients with Friedreich's ataxia. Isotopic ventriculography was also used to assess left ventricular contractility. Myocardial images in patients with Friedreich's ataxia were found to be precociously abnormal irrespective of the degree of neurological impairment or of the severity of myocardial hypertrophy

  16. 20 CFR 416.201 - General definitions and terms used in this subpart.

    Science.gov (United States)

    2010-04-01

    ... INCOME FOR THE AGED, BLIND, AND DISABLED Eligibility General § 416.201 General definitions and terms used... making available on a temporary basis a place to sleep, food, and some services or treatment to homeless... exceptions to the general limitation on the eligibility for Supplemental Security Income benefits...

  17. 7 CFR 201.51a - Special procedures for purity analysis.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Special procedures for purity analysis. 201.51a... MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act §...

  18. Parameters for discriminating multiple-vessel coronary artery lesion in exercise 201Tl myocardial SPECT

    International Nuclear Information System (INIS)

    This study was performed to select parameters most suitable for discriminating multiple-vessel lesion in exercise 201Tl SPECT. Exercise 201Tl SPECT and coronary contrasting were carried out in 110 patients. At 1 min before the end (appearance of heart pain, severe arrhythmia, hypotension or fatigue) of exercise with a bicycle ergometer, 4 mCi of 201Tl was intravenously injected and myocardial SPECT was done with gamma camera from 32 directions for 20 sec at 5 min and 4 hr after the exercise. Images were analyzed by scaring the uptake of 201Tl for left ventricle. Parameters were Initial score of Tl uptake, Score difference of Tl uptake, Lung/heart, Initial width, Width difference, Diffuse slow washout, Cavity/myocardium, Lung/myocardium and Lung/cavity. Parameters versus Number of diseased vessels were analyzed by chi square method or ANOVA and the parameters for the present purpose were selected by stepwise discriminant analysis. Lung/heart and Initial score were found most suitable. (K.H.)

  19. 30 CFR 77.201-1 - Tests for methane; qualified person; use of approved device.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Tests for methane; qualified person; use of... WORK AREAS OF UNDERGROUND COAL MINES Surface Installations § 77.201-1 Tests for methane; qualified person; use of approved device. Tests for methane in structures, enclosures, or other facilities,...

  20. 30 CFR 77.201-2 - Methane accumulations; change in ventilation.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Methane accumulations; change in ventilation... OF UNDERGROUND COAL MINES Surface Installations § 77.201-2 Methane accumulations; change in... centum or more of methane changes or adjustments in the ventilation of such installation shall be made...

  1. 7 CFR 767.201 - Real estate inventory property with important resources.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Real estate inventory property with important... SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS INVENTORY PROPERTY MANAGEMENT Real Estate Property With Important Resources or Located in Special Hazard Areas § 767.201 Real estate...

  2. 42 CFR 1001.201 - Conviction relating to program or health care fraud.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 5 2010-10-01 2010-10-01 false Conviction relating to program or health care fraud... Permissive Exclusions § 1001.201 Conviction relating to program or health care fraud. (a) Circumstance for... misdemeanor relating to fraud, theft, embezzlement, breach of fiduciary responsibility, or other...

  3. 49 CFR 172.201 - Preparation and retention of shipping papers.

    Science.gov (United States)

    2010-10-01

    ... List of CFR Sections Affected which appears in the Finding Aids section of the printed volume and on... 49 Transportation 2 2010-10-01 2010-10-01 false Preparation and retention of shipping papers. 172..., TRAINING REQUIREMENTS, AND SECURITY PLANS Shipping Papers § 172.201 Preparation and retention of...

  4. 40 CFR 1033.201 - General requirements for obtaining a certificate of conformity.

    Science.gov (United States)

    2010-07-01

    ... your application (see 40 CFR 1068.5). (e) An authorized representative of your company must approve and... production after December 31 of the model year for which it is issued. No certificate will be issued after....201 General requirements for obtaining a certificate of conformity. Certification is the process...

  5. Myocardial perfusion changes following 1 year of exercise training assessed by thallium-201 circumferential count profiles

    International Nuclear Information System (INIS)

    The effect of exercise training on myocardial perfusion was assessed using initial and 1-year thallium-201 (Tl-201) exercise studies in 56 patients with stable coronary artery disease (CAD). Subjects had been randomized into a trained group participating in supervised exercise three times per week and a control group. Indices (non-dimensional units) based on computer-analyzed circumferential count profile from nine regions of the heart, assessed in three projections, were used to eliminate observer bias and more accurately quantitate Tl-201 distribution and 4-hour washout. There was serial improvement of the global distribution count profiles in 21 of 27 (77.8%) of the trained and in 9 of 29 (31.0%) of the control subjects (p less than 0.001). The mean interval change in global initial distribution over the year period was 5 +/- 13 (mean +/- SD) in the trained and -6 +/- 14 in the control groups (p less than 0.003). The mean initial distribution of the trained group had improvement in all nine regions (significant in three), while the control group showed mean improvement in only one of nine regions. Additionally, the trained group showed improvement in the mean washout in five of nine regions (significant in three), while no mean regional washout improvement occurred in the control group. Thus, in this group of patients with stable CAD, exercise training resulted in apparently improved cardiac perfusion evidenced by enhance Tl-201 uptake and washout

  6. 37 CFR 201.11 - Satellite carrier statements of account covering statutory licenses for secondary transmissions.

    Science.gov (United States)

    2010-07-01

    ... period shall be the rate fixed by the Licensing Division of the Copyright Office pursuant to 37 CFR 201... with the total statutory royalty fee or the confirmed arbitration royalty fee for such accounting... information shall be provided as part of the EFT and/or as part of the remittance advice as provided for...

  7. 41 CFR 301-71.201 - What are the reviewing official's responsibilities?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false What are the reviewing... ACCOUNTABILITY REQUIREMENTS Travel Claims for Reimbursement § 301-71.201 What are the reviewing official's responsibilities? The reviewing official must have full knowledge of the employee's activities. He/she must...

  8. 20 CFR 405.201 - Reviewing an initial determination-general.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Reviewing an initial determination-general... PROCESS FOR ADJUDICATING INITIAL DISABILITY CLAIMS Review of Initial Determinations by a Federal Reviewing Official § 405.201 Reviewing an initial determination—general. If you are dissatisfied with the...

  9. 7 CFR 201.55a - Moisture and aeration of substratum.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Moisture and aeration of substratum. 201.55a Section... and aeration of substratum. (a) The substratum must be moist enough to supply the needed moisture to the seeds at all times. Excessive moisture which will restrict aeration of the seeds should be...

  10. Characterization of Pu-contaminated soils from Nuclear Site 201 at the Nevada Test Site

    International Nuclear Information System (INIS)

    Distribution and characteristics of Pu-bearing radioactive particles throughout five soil profiles from Nuclear Site (NS) 201 were investigated. Concentrations of 239240Pu and 241Am decreased with depth and most of the contamination was contained in the top 5 cm except in profile 4 where it extended to 10 cm. The mean activity ratio of 239240Pu to 241Am and its standard error were 5.8 +- 0.3 (N=42). Most of the total radioactivity of the soils was contributed by 0.25 to 2 mm sand size fraction which comprised 20 to 50% by weight of the soils. The radioactive particles in the 0.25 to 2 mm size fraction occurred as spherical glass particles or as glass coatings on sand particles. The glass coatings had gas voids in the matrix but were not as porous as the radioactive particles from NS 219. After impact grinding the >0.25-mm size fractions for one hour, 85% of the initial activity in a NS 201 sample remained with the particles on the 0.25 mm sieve, whereas in the NS 219 sample only 10% remained. The results show that the radioactive particles from NS 201 were much more stable against the impact grinding force than those from NS 219. Therefore, the NS 201 soils would be expected to have a lower probability of producing respirable-size radioactive particles by saltation during wind erosion. 19 references, 3 figures, 3 tables

  11. 14 CFR 121.201 - Nontransport category airplanes: En route limitations: One engine inoperative.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Nontransport category airplanes: En route...: CERTIFICATION AND OPERATIONS OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Airplane Performance Operating Limitations § 121.201 Nontransport category airplanes: En route limitations: One...

  12. 40 CFR 201.16 - Standard for locomotive load cell test stands.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Standard for locomotive load cell test... Interstate Rail Carrier Operations Standards § 201.16 Standard for locomotive load cell test stands. (a) Effective January 15, 1984, no carrier subject to this reguation shall operate locomotive load cell...

  13. Scintigraphic anatomy of coronary artery disease in digital thallium-201 myocardial images

    International Nuclear Information System (INIS)

    One hundred and eight patients with single and multiple vessel coronary artery disease confirmed by arteriography were evaluated by exercise thallium-201 (201Tl) myocardial scintigraphy to determine the scintigraphic appearances of specific coronary stenoses. In general proximal stenoses caused more widespread, but not necessarily more severe, myocardial tracer deficit, than distal stenoses. In particular, proximal dominant right coronary artery disease was specifically associated with extensive inferior wall tracer deficit in the anterior scintigram, whereas proximal left circumflex disease caused similar tracer depletion best visualised in the left lateral scintigram. A triad of uptake defects was caused by left anterior descending coronary artery disease; one of these defects called 'diagonal window tracer deficit' was the most useful scintigraphic sign distinguishing proximal from distal disease in the left anterior descending coronary artery. Certain scintigraphic patterns of 201Tl myocardial accumulation appear invaluable in the noninvasive localisation of stenoses within specific coronary arteries and thus may be useful in predicting life-threatening coronary artery disease which should be confirmed by definitive coronary arteriography. The digital 201Tl myocardial scintigram also provides an independent functional guide to the interpretation of coronary arteriograms and may be helpful in the planning of aortocoronary bypass graft surgery. (author)

  14. Investigating Validity of Math 105 as Prerequisite to Math 201 among Undergraduate Students, Nigeria

    Science.gov (United States)

    Zakariya, Yusuf F.

    2016-01-01

    In this study, the author examined the validity of MATH 105 as a prerequisite to MATH 201. The data for this study was extracted directly from the examination results logic of the university. Descriptive statistics in form of correlations and linear regressions were used to analyze the obtained data. Three research questions were formulated and…

  15. 9 CFR 201.30 - Amount of market agency, dealer and packer bonds.

    Science.gov (United States)

    2010-01-01

    ..., divide the total dollar value of livestock purchased by all persons for whom the market agency served as... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Amount of market agency, dealer and... STOCKYARDS ACT Market Agency, Dealer and Packer Bonds § 201.30 Amount of market agency, dealer and...

  16. 31 CFR 560.803 - Customs procedures: Goods specified in § 560.201.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Customs procedures: Goods specified... REGULATIONS Procedures § 560.803 Customs procedures: Goods specified in § 560.201. (a) With respect to goods... Customs officers shall not accept or allow any: (1) Entry for consumption or warehouse (including...

  17. 17 CFR 201.326 - Evidence: Presentation, rebuttal and cross-examination.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Evidence: Presentation... EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice Rules Regarding Hearings § 201.326 Evidence: Presentation, rebuttal and cross-examination. In any proceeding in which a hearing is required to be...

  18. Evaluation of Tl-201 lung uptake and impairment of pulmonary perfusion on scintigraphies in pulmonary tuberculosis

    Energy Technology Data Exchange (ETDEWEB)

    Fujii, Tadashige [Shinshu Univ., Matsumoto, Nagano (Japan). School of Allied Medical Sciences; Tanaka, Masao; Koizumi, Tomonori; Kubo, Keishi

    2000-02-01

    Tl-201 lung uptake in 74 patients (85 lesions) and pulmonary perfusion in 105 patients were studied to evaluate clinical usefulness of Tl-201 lung uptake and perfusion lung scintigraphy in pulmonary tuberculosis, using a scintillation camera with a mini-computer system. As indices of Tl-201 lung uptake, lung (lesion) to upper mediastinum uptake ratio (L/M) and visual grading were used. L/M in pulmonary tuberculosis was 1.96{+-}0.66, which was significantly larger than 1.04{+-}0.24 in healthy controls and lower than that in heart diseases with left heart failure and idiopathic interstitial pneumonia, and showed no significant differences with that in acute pneumonia, pyothorax, primary lung cancer and malignant mediastinal tumor. L/M in pulmonary tuberculosis did not correlate with CRP, erythrocyte sedimentation rate, Gaffky number of sputum and body temperature. It correlated with the type of pulmonary tuberculosis according to the Gakken Classification reflecting the disease activity. It was larger in the exudative type, caseo-infiltrative one, disseminated one, one with cavity in infiltrative lesion than the fibro-caseous one. On perfusion lung scintigram, impairment of pulmonary perfusion larger than area of the entire unilateral lung was observed in 68 cases (64.8%). Area of hypoperfused lung field, which correlated with % vital capacity (r=0.60, p=0.0002) and PaO{sub 2} (r=0.39,p=0.0024), was significantly larger in patients with silicosis and those with bilateral pleural involvements such as pleural callosity than in those with type III according to the Gakkai Classification. Most of the patients showed decreased pulmonary perfusion and Tl-201 accumulation of which grade reflects the disease activity in active tuberculous lesion. Patients with miliary tuberculosis and those with silicotuberculosis showed diffuse Tl-201 accumulation in the both lungs. Tl-201 lung scintigraphy seems to be useful for visualizing active tuberculous lesions, particularly the ones

  19. Evaluation of Tl-201 lung uptake and impairment of pulmonary perfusion on scintigraphies in pulmonary tuberculosis

    International Nuclear Information System (INIS)

    Tl-201 lung uptake in 74 patients (85 lesions) and pulmonary perfusion in 105 patients were studied to evaluate clinical usefulness of Tl-201 lung uptake and perfusion lung scintigraphy in pulmonary tuberculosis, using a scintillation camera with a mini-computer system. As indices of Tl-201 lung uptake, lung (lesion) to upper mediastinum uptake ratio (L/M) and visual grading were used. L/M in pulmonary tuberculosis was 1.96±0.66, which was significantly larger than 1.04±0.24 in healthy controls and lower than that in heart diseases with left heart failure and idiopathic interstitial pneumonia, and showed no significant differences with that in acute pneumonia, pyothorax, primary lung cancer and malignant mediastinal tumor. L/M in pulmonary tuberculosis did not correlate with CRP, erythrocyte sedimentation rate, Gaffky number of sputum and body temperature. It correlated with the type of pulmonary tuberculosis according to the Gakken Classification reflecting the disease activity. It was larger in the exudative type, caseo-infiltrative one, disseminated one, one with cavity in infiltrative lesion than the fibro-caseous one. On perfusion lung scintigram, impairment of pulmonary perfusion larger than area of the entire unilateral lung was observed in 68 cases (64.8%). Area of hypoperfused lung field, which correlated with % vital capacity (r=0.60, p=0.0002) and PaO2 (r=0.39,p=0.0024), was significantly larger in patients with silicosis and those with bilateral pleural involvements such as pleural callosity than in those with type III according to the Gakkai Classification. Most of the patients showed decreased pulmonary perfusion and Tl-201 accumulation of which grade reflects the disease activity in active tuberculous lesion. Patients with miliary tuberculosis and those with silicotuberculosis showed diffuse Tl-201 accumulation in the both lungs. Tl-201 lung scintigraphy seems to be useful for visualizing active tuberculous lesions, particularly the ones that could

  20. LDEF (Prelaunch), AO201 : Interplanetary Dust Experiment, Tray B12

    Science.gov (United States)

    1984-01-01

    LDEF (Prelaunch), AO201 : Interplanetary Dust Experiment, Tray B12 The prelaunch photograph shows the six (6) inch deep Interplanetary Dust Experiment (IDE) master control tray. The tray has three (3) mounting/cover plates elevated on fiberglass stand-offs to provide clearance and protection for hardware and electronics located underneath. The stand-offs also raise the plates to a level that minimizes shading of detectors by the tray sidewalls. The mounting plate located at the left hand end of the tray is populated with eighty (80) metaloxide-silicon (MOS) capacitor-type impact sensors and one (1) solar sensor that is located approximately in the center of the mounting plate. The IDE sensors are two (2) inch diameter MOS capacitor structures approximately 250 um thick. The detectors are formed by growing either 0.4um or 1.0um thick silicon oxide, SiO2, layer on the 250um thick, B-doped polished silicon wafer. The top metal contact, the visible surface, was formed by vapor deposition of 1000A of aluminum on the SiO2 surface. Aluminum was also vapor deposited on the backside to form the contact with the silicon substrate. Gold wires are bonded to the front and back aluminum layers for use in connecting the detectors to the circuits. The complete wafers, IDE detectors, are mounted on chromic anodized aluminum frames by bonding the detector backside to the aluminum frame with a space qualified RTV silicon adhesive, de-volatized RTV-511. The difference in colors of the detectors is caused by reflections in the metallized surfaces. A reflection of one of the technicians is visible in the three (3) rows of detector on the left hand side of the mounting plate. The solar sensor, located at the mounting plate center, consist of four (4) silicon solar cells connected in series and associated circuity bonded to an aluminum baseplate. The solar sensor registered each orbital sunrise independant of LDEF orientation at the time of sunrise. When IDE solar sensor data from the six