Energy Technology Data Exchange (ETDEWEB)
Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E
1988-01-01
This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)
Discovery of the astatine, radon, francium, and radium isotopes
Energy Technology Data Exchange (ETDEWEB)
Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu
2013-09-15
Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.
Discovery of the astatine, radon, francium, and radium isotopes
Fry, C
2012-01-01
Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.
Discovery of the astatine, radon, francium, and radium isotopes
Fry, C.; Thoennessen, M.
2013-09-01
Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.
Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line
Energy Technology Data Exchange (ETDEWEB)
Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration
2011-11-30
Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.
Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line
Uusitalo, J.; Jakobsson, U.
2011-11-01
Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.
Measurement of the first ionization potential of astatine by laser ionization spectroscopy
Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A
2013-01-01
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.
Measurement of the first ionization potential of astatine by laser ionization spectroscopy.
Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A
2013-01-01
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.
Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei
Energy Technology Data Exchange (ETDEWEB)
Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others
2015-10-15
Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.
Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei
Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.
2015-10-01
Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.
Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials
DEFF Research Database (Denmark)
Aneheim, Emma; Albertsson, Per; Bäck, Tom
2015-01-01
To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...
Measurement of the first ionization potential of astatine by laser ionization spectroscopy
Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical
An attempt to explore the production routes of Astatine radionuclides: Theoretical approach
Maiti, Moumita; Lahiri, Susanta
2008-01-01
In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...
DEFF Research Database (Denmark)
Aneheim, Emma; Gustafsson, Anna; Albertsson, Per
2016-01-01
Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....
Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag
2017-01-01
Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
Energy Technology Data Exchange (ETDEWEB)
Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)
2008-12-15
No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.
Determination of the electron affinity of astatine and polonium by laser photodetachment
We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.
Adsorption of the astatine species on a gold surface: A relativistic density functional theory study
Demidov, Yuriy; Zaitsevskii, Andréi
2018-01-01
We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).
ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS
Energy Technology Data Exchange (ETDEWEB)
MICHAEL R. ZALUTSKY
2012-08-08
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At
Energy Technology Data Exchange (ETDEWEB)
Rothe, Sebastian
2012-09-24
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Rothe, Sebastian; Nörtershäuser, W
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Energy Technology Data Exchange (ETDEWEB)
Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)
2011-12-14
The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and
Lifescience Database Archive (English)
Full Text Available method Diversification of protein structural analysis technologies by the SAIL method Masatsune Kainosho Graduate School of Science, Nagoya University SAD201.csml ... ...SAD201 SAD2 Diversification of protein structural analysis technologies by the SAIL
Lifescience Database Archive (English)
Full Text Available Magellanic penguin Spheniscus magellanicus Spheniscus_magellanicus_L.png 201.png Ta...keru Nakazato (Database Center for Life Science) licensed under CC Attribution2.1 Japan マゼランペンギン Spheniscus
Energy Technology Data Exchange (ETDEWEB)
O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.
2017-04-01
Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.
Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick
2007-01-01
Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.
7 CFR 201.42 - Small containers.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Small containers. 201.42 Section 201.42 Agriculture... REGULATIONS Sampling in the Administration of the Act § 201.42 Small containers. In sampling seed in small containers that it is not practical to sample as required in § 201.41, a portion of one unopened container or...
43 CFR 20.201 - Ethics officials.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Ethics officials. 20.201 Section 20.201... Department Ethics Program § 20.201 Ethics officials. (a) Designated Agency Ethics Official refers to the official designated under 5 CFR 2638.201 to coordinate and manage the Department's ethics program. (b) The...
Lifescience Database Archive (English)
Full Text Available roaki Kato Graduate School of Pharmaceutical Sciences, Kyoto University Nat Protoc (2006)|Protein Expr. Purif. (2009)|Biotechnol. Prog. (1996) 17406338|8845106|18984054 PPD201.csml ...
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Computation. 201.51 Section 201.51 Shipping MARITIME... (Rule 5) § 201.51 Computation. In computing any period of time under these Rules, the time begins with... seven (7) days, intermediate Saturdays, Sundays, and holidays shall be excluded from the computation. ...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Origin. 201.14 Section 201.14 Agriculture Regulations... Labeling Agricultural Seeds § 201.14 Origin. (a) Alfalfa, red clover, white clover, and field corn (except hybrid seed corn) shall be labeled to show: (1) The origin, if known; or (2) if the origin is not known...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Origin. 201.58b Section 201.58b Agriculture... REGULATIONS Examinations in the Administration of the Act § 201.58b Origin. The presence of incidental weed seeds, foreign matter, or any other existing circumstances shall be considered in determining the origin...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Seal. 201.0 Section 201.0 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION § 201.0 Seal. (a) Pursuant to... Trade Commission has adopted an official seal, the depiction of which follows: EC05OC91.026 (b) Custody...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Program. 201.43 Section 201.43 Customs Duties... Information § 201.43 Program. The Director of Administration is designated as the official of the Commission who is responsible for implementation and oversight of information security programs and procedures...
49 CFR 384.201 - Testing program.
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Testing program. 384.201 Section 384.201... COMMERCIAL DRIVER'S LICENSE PROGRAM Minimum Standards for Substantial Compliance by States § 384.201 Testing program. The State shall adopt and administer a program for testing and ensuring the fitness of persons to...
46 CFR 201.17 - Written appearance.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Written appearance. 201.17 Section 201.17 Shipping... PROCEDURE Appearance and Practice Before the Administration (Rule 2) § 201.17 Written appearance. Persons who appear at any hearing shall deliver a written notation of appearance to the reporter, stating for...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Requests. 201.12 Section 201.12 Customs Duties... of Investigations § 201.12 Requests. Any party to a nonadjudicative investigation may request the Commission to take particular action with respect to that investigation. Such requests shall be by letter...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seed. 201.50 Section 201.50 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.50 Weed seed. Seeds (including bulblets or...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seed. 201.30 Section 201.30 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Vegetable Seeds § 201.30 Hard seed. The label shall show the percentage of hard seed, if...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seed. 201.21 Section 201.21 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.21 Hard seed. The label shall show the percentage of hard seed...
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Authority. 201.3 Section 201.3 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Administration § 201...
17 CFR 201.58 - Judicial review.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Judicial review. 201.58 Section 201.58 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Regulations Pertaining to the Equal Access to Justice Act § 201.58 Judicial review. Judicial review of final...
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Background. 201.0 Section 201.0 Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL EXECUTIVE POLICY § 201.0 Background. National policy with respect to the conservation, allocation and use of the Nation's...
21 CFR 201.105 - Veterinary drugs.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Veterinary drugs. 201.105 Section 201.105 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.105 Veterinary drugs. A drug subject to the...
22 CFR 201.52 - Required documents.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Required documents. 201.52 Section 201.52... TRANSACTIONS FINANCED BY USAID Payment and Reimbursement § 201.52 Required documents. (a) Commodities and...-related services shall be supported by the documents listed in paragraphs (a)(1) through (8) of this...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Hard seeds. 201.57 Section 201.57 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.57 Hard seeds. Seeds which remain hard at...
46 CFR 201.136 - Evidence admissible.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Evidence admissible. 201.136 Section 201.136 Shipping... PROCEDURE Evidence (Rule 14) § 201.136 Evidence admissible. In any proceeding under the regulations in this part all evidence which is relevant, material, reliable and probative, and not unduly repetitious or...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1260.201 Section 1260.201 Agriculture... Promotion and Research Order Reports, Books and Records § 1260.201 Reports. Each importer, person marketing... shall report to the Board periodically information required by regulations prescribed by the Board and...
46 CFR 199.201 - Survival craft.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft. 199.201 Section 199.201 Shipping COAST... SYSTEMS FOR CERTAIN INSPECTED VESSELS Additional Requirements for Passenger Vessels § 199.201 Survival craft. (a) Each survival craft must be approved and equipped as follows: (1) Each lifeboat must be...
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety. ...
49 CFR 382.201 - Alcohol concentration.
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Alcohol concentration. 382.201 Section 382.201... ALCOHOL USE AND TESTING Prohibitions § 382.201 Alcohol concentration. No driver shall report for duty or... concentration of 0.04 or greater. No employer having actual knowledge that a driver has an alcohol concentration...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Separation. 201.47 Section 201.47 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.47 Separation. (a) The working sample shall... percentage of each part shall be determined to two decimal places. (b) Aids for the classification of pure...
5 CFR 412.201 - Management succession.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Management succession. 412.201 Section 412.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS SUPERVISORY, MANAGEMENT, AND EXECUTIVE DEVELOPMENT Succession Planning § 412.201 Management succession. The head of each...
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Definitions. 2.201 Section 2.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PUBLIC INFORMATION Confidentiality of Business Information § 2.201 Definitions. For the purposes of this subpart: (a) Person means an individual...
17 CFR 201.104 - Business hours.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Business hours. 201.104 Section 201.104 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice General Rules § 201.104 Business hours. The Headquarters office of the Commission, at...
31 CFR 800.201 - Business day.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Business day. 800.201 Section 800.201 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.201 Business day. The term business day means Monday through Friday...
2010-10-01
... enforcement responsibilities of importance to national security and emergency preparedness telecommunications... 47 Telecommunication 5 2010-10-01 2010-10-01 false Definitions. 201.2 Section 201.2 Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL EXECUTIVE POLICY § 201.2...
40 CFR 201.22 - Measurement instrumentation.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Measurement instrumentation. 201.22 Section 201.22 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT... Criteria § 201.22 Measurement instrumentation. (a) A sound level meter or alternate sound level measurement...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Employment. 201.140 Section 201.140 Customs Duties... Commission § 201.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Inert matter. 201.19 Section 201.19 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.19 Inert matter. The label shall show the percentage by weight of inert matter. [5 FR 31, Jan. 4, 1940] ...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Weed seeds. 201.15 Section 201.15 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.15 Weed seeds. The percentage of weed seeds shall include seeds of plants considered weeds in the State into which the seed is offered for transportation or...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLF201 (Link to dictyBase) - - - Contig-U15434-1 SLF201Z (Link... to Original site) - - SLF201Z 620 - - - - Show SLF201 Library SL (Link to library) Clone ID SLF201 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLF2-A/SLF201Q.Seq.d/ Representative seq. ID SLF20...1Z (Link to Original site) Representative DNA sequence >SLF201 (SLF201Q) /CSM/SL/SLF2-A/SLF201Q.Seq.d/ XXXXX...FCNQT LAQIALWTKTEEYPLGVHFLPKILDEEVARLHLDQLGAKLTTLTEKQSEYLSVPVAGPYK VDHYRY*nllfnkyiklf
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC201 (Link to dictyBase) - - - Contig-U16325-1 SLC201E (Link... to Original site) - - - - - - SLC201E 510 Show SLC201 Library SL (Link to library) Clone ID SLC201 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-A/SLC201Q.Seq.d/ Representative seq. ID SLC20...1E (Link to Original site) Representative DNA sequence >SLC201 (SLC201Q) /CSM/SL/SLC2-A/SLC201Q.Seq.d/ AACCA...hqqvdgvmisqi*vtikqvlklqlmlm kpkgvkdhiiifhqtiyikktmiiwvmvfmmvlklvsltevst*tismvf Frame B: tns*tktttpwlssr*lr*r*emylc
2010-01-01
... on which it was delivered to him. [5 FR 30, Jan. 4, 1940, as amended at 20 FR 7929, Oct. 21, 1955] ... 7 Agriculture 3 2010-01-01 2010-01-01 false Origin. 201.5 Section 201.5 Agriculture Regulations of... Records for Agricultural and Vegetable Seeds § 201.5 Origin. (a) The complete record for any lot of seed...
17 CFR 201.160 - Time computation.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Time computation. 201.160... Rules of Practice General Rules § 201.160 Time computation. (a) Computation. In computing any period of... legal holidays shall be excluded from the computation when the period of time prescribed or allowed is...
24 CFR 201.24 - Security requirements.
2010-04-01
... manufactured home. (c) Recording and perfection of security. The lender shall assure that the legal description... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Security requirements. 201.24... TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Eligibility and Disbursement Requirements § 201...
9 CFR 201.81 - Suspended registrants.
2010-01-01
... 201.81 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Services § 201.81 Suspended registrants. No stockyard owner, packer, market agency, or dealer shall employ...
17 CFR 201.57 - Commission review.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Commission review. 201.57... Regulations Pertaining to the Equal Access to Justice Act § 201.57 Commission review. In accordance with the... Division of the Commission may seek review of the initial decision on the fee application, or the...
2010-04-01
...) Any person who stores explosive materials shall notify the authority having jurisdiction for fire... 555.201 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE EXPLOSIVES COMMERCE IN EXPLOSIVES Storage § 555.201 General. (a) Section 842(j) of the...
31 CFR 0.201 - Political activity.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Political activity. 0.201 Section 0... EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.201 Political activity. (a) Employees may: (1) Take an... significantly reduced the statutory restrictions on the political activity of most Department employees. However...
21 CFR 155.201 - Canned mushrooms.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned mushrooms. 155.201 Section 155.201 Food and... mushrooms. (a) Identity—(1) Definition. Canned mushrooms is the food properly prepared from the caps and stems of succulent mushrooms conforming to the characteristics of the species Agaricus (Psalliota...
17 CFR 201.320 - Evidence: Admissibility.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Evidence: Admissibility. 201... PRACTICE Rules of Practice Rules Regarding Hearings § 201.320 Evidence: Admissibility. The Commission or the hearing officer may receive relevant evidence and shall exclude all evidence that is irrelevant...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Definitions. 1416.201 Section 1416.201 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... (including but not limited to water and nutrients) by the producer, is in fact controlled by the producer...
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Reports. 419.201-73... SMALL BUSINESS PROGRAMS Policies 419.201-73 Reports. The Director, OSDBU, shall be responsible for submitting reports concerning USDA's progress and achievements in the procurement preference program. ...
24 CFR 201.31 - Insurance charge.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance charge. 201.31 Section... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Insurance of Loans § 201.31 Insurance charge. (a...
9 CFR 201.97 - Annual reports.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Annual reports. 201.97 Section 201.97 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND... (except a packer buyer registered to purchase livestock for slaughter only) shall file annually with the...
7 CFR 1430.201 - Administration.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1430.201 Section 1430.201 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF... Administration. (a) This program is administered under the general supervision of the Executive Vice President...
48 CFR 1419.201 - General policy.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false General policy. 1419.201 Section 1419.201 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR SOCIOECONOMIC PROGRAMS...., procurement analyst or other non-operational contract person), for each contracting office where: (i) Annual...
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Purpose. 9701.201 Section 9701.201 Administrative Personnel DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES MANAGEMENT SYSTEM (DEPARTMENT OF HOMELAND SECURITY-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES...
44 CFR 201.3 - Responsibilities.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Responsibilities. 201.3... HOMELAND SECURITY DISASTER ASSISTANCE MITIGATION PLANNING § 201.3 Responsibilities. (a) General. This section identifies the key responsibilities of FEMA, States, and local/tribal governments in carrying out...
Lifescience Database Archive (English)
Full Text Available CF (Link to library) CFD201 (Link to dictyBase) - - - Contig-U12865-1 | Contig-U16524-1 CFD...201P (Link to Original site) CFD201F 257 CFD201Z 283 CFD201P 540 - - Show CFD201 Library CF (Link to library) Clone ID CFD...65-1 | Contig-U16524-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-A/CFD...201Q.Seq.d/ Representative seq. ID CFD201P (Link to Original site) Representative DNA sequence >CFD201 (CFD...201Q) /CSM/CF/CFD2-A/CFD201Q.Seq.d/ CATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTAGCAAACTGCGATAATT
Repeat thallium-201 SPECT in cerebral lymphoma.
Borggreve, F; Dierckx, R A; Crols, R; Mathijs, R; Appel, B; Vandevivere, J; Mariën, P; Martin, J J; De Deyn, P P
1993-01-01
The authors report on the contribution of Thallium-201 brain SPECT in the diagnosis and follow-up of a non-immunosuppressed patient, presenting with primary cerebral lymphoma. The tumoral process was at first not diagnosed on CT-scan, but Thallium-201 SPECT suggested a tumoral invasion. During corticosteroid treatment the tumor volume on CT-scan decreased, while on Thallium-201 SPECT there was an enhancement of the accumulation and an increasing tumor to non-tumor ratio. These scintigraphical findings more closely reflected the clinical course and the postmortem results.
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT
27 CFR 24.201 - Formula required.
2010-04-01
... OF THE TREASURY LIQUORS WINE Production of Agricultural Wine § 24.201 Formula required. Before producing any agricultural wine, the proprietor shall obtain an approval of the formula and process by which...
Thallium-201 scintigraphy in unstable angina pectoris
Energy Technology Data Exchange (ETDEWEB)
Wackers, F.J.T.; Lie, K.I.; Liem, K.L.; Sokole, E.B.; Samson, G.; Van Der Schoot, J.B.; Durrer, D.
1978-04-01
Thallium-201 scintigraphy was performed during the pain free period in 98 patients with unstable angina. Scintiscans were positive in 39 patients, questionable in 27 patients and normal in 32 patients. Eighty-one patients responded favorably to treatment (group I). Seventeen patients had complicated courses (group II) and despite maximal treatment with propranolol either developed infarction (six patients) or continued to have angina necessitating coronary surgery (11 patients). In group I during the pain free period 26 of 81 patients had positive thallium-201 scans, whereas 20 patients had an abnormal ECG at that time; during angina 18 patients had transient ECG changes. In group II during the pain free period 13 of 17 patients had positive scans, whereas two patients had abnormal ECG at that time; during angina 12 patients showed transient ECG changes. The sensitivity to recognize group II was 76% for thallium-201 scintigraphy, 11% for ECG during the pain free period; 70% for ECG during angina; 94% for the combination of either positive scans or abnormal ECG. Thus, positive thallium-201 scans occur in patients with unstable angina, positive scans can be obtained during the pain free period, thallium-201 scans are more frequently positive in patients with complicated course.
47 CFR 2.201 - Emission, modulation, and transmission characteristics.
2010-10-01
... characteristics. 2.201 Section 2.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL FREQUENCY..., and transmission characteristics. The following system of designating emission, modulation, and transmission characteristics shall be employed. (a) Emissions are designated according to their classification...
46 CFR 201.20 - Attorneys at law.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Attorneys at law. 201.20 Section 201.20 Shipping... PROCEDURE Appearance and Practice Before the Administration (Rule 2) § 201.20 Attorneys at law. Attorneys at law who are admitted to practice before the Federal courts or before the courts of any State or...
40 CFR 240.201 - Solid wastes excluded.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Solid wastes excluded. 240.201 Section 240.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.201 Solid...
46 CFR 108.201 - Size of sleeping spaces.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Size of sleeping spaces. 108.201 Section 108.201... AND EQUIPMENT Construction and Arrangement Accommodation Spaces § 108.201 Size of sleeping spaces. (a) No sleeping space may berth more than four persons, except that a sleeping space for personnel not...
46 CFR 201.6 - Documents in foreign languages.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Documents in foreign languages. 201.6 Section 201.6... PRACTICE AND PROCEDURE General Information (Rule 1) § 201.6 Documents in foreign languages. Every document, exhibit, or other paper written in a language other than English and filed with the Administration or...
7 CFR 201.1 - Meaning of words.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Meaning of words. 201.1 Section 201.1 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... REGULATIONS Definitions § 201.1 Meaning of words. Words in the regulations in this part in the singular form...
9 CFR 201.1 - Meaning of words.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Meaning of words. 201.1 Section 201.1 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND... § 201.1 Meaning of words. Words used in this part in the singular form shall be deemed to import the...
7 CFR 201.31a - Labeling treated seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Labeling treated seed. 201.31a Section 201.31a..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling in General § 201.31a Labeling treated seed. (a) Contents of label. Any agricultural seed...
7 CFR 201.69 - Classes of certified seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Classes of certified seed. 201.69 Section 201.69..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.69 Classes of certified seed. (a) Classes of certified seed are as follows...
7 CFR 201.64 - Pure live seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Pure live seed. 201.64 Section 201.64 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.64 Pure live seed. The tolerance for pure live seed shall be determined by...
7 CFR 201.49 - Other crop seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Other crop seed. 201.49 Section 201.49 Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.49 Other crop seed. (a) Seeds of plants...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Seed unit. 201.47a Section 201.47a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.47a Seed unit. The seed unit is the...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Treated seed. 201.7a Section 201.7a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Records for Agricultural and Vegetable Seeds § 201.7a Treated seed. The complete record for any...
7 CFR 201.24a - Inoculated seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Inoculated seed. 201.24a Section 201.24a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.24a Inoculated seed. Seed claimed to be inoculated shall be...
9 CFR 201.73-1 - Instructions for weighing livestock.
2010-01-01
.... 201.73-1 Section 201.73-1 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Services § 201.73-1 Instructions for weighing livestock. Stockyard operators, market agencies...
37 CFR 201.1 - Communication with the Copyright Office.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Communication with the Copyright Office. 201.1 Section 201.1 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.1 Communication with the Copyright Office...
40 CFR 57.201 - Where to apply.
2010-07-01
... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Where to apply. 57.201 Section 57.201... NONFERROUS SMELTER ORDERS The Application and the NSO Process § 57.201 Where to apply. Any eligible smelter may apply for an NSO to the appropriate EPA Regional Office or to the appropriate State or local air...
7 CFR 201.57a - Dormant seeds.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Dormant seeds. 201.57a Section 201.57a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.57a Dormant seeds. Dormant seeds are...
7 CFR 201.54 - Number of seeds for germination.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Number of seeds for germination. 201.54 Section 201.54..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.54 Number of seeds for germination. At...
7 CFR 201.53 - Source of seeds for germination.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Source of seeds for germination. 201.53 Section 201.53..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Germination Tests in the Administration of the Act § 201.53 Source of seeds for germination. (a...
7 CFR 201.58a - Indistinguishable seeds.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Indistinguishable seeds. 201.58a Section 201.58a..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Examinations in the Administration of the Act § 201.58a Indistinguishable seeds. When the...
21 CFR 201.61 - Statement of identity.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.61 Section 201.61 Food...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.61 Statement of identity. (a) The... features a statement of the identity of the commodity. (b) Such statement of identity shall be in terms of...
7 CFR 201.36c - Hermetically-sealed containers.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Hermetically-sealed containers. 201.36c Section 201... ACT FEDERAL SEED ACT REGULATIONS Advertising § 201.36c Hermetically-sealed containers. The 5-month... been met: (a) The seed was packaged within 9 months after harvest; (b) The container used does not...
5 CFR 582.201 - Agent to receive process.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Agent to receive process. 582.201 Section 582.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS COMMERCIAL GARNISHMENT OF FEDERAL EMPLOYEES' PAY Service of Legal Process § 582.201 Agent to receive process. (a) Except...
5 CFR 581.201 - Agent to receive process.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Agent to receive process. 581.201 Section 581.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROCESSING GARNISHMENT ORDERS FOR CHILD SUPPORT AND/OR ALIMONY Service of Process § 581.201 Agent to receive process. (a...
41 CFR 50-201.1101 - Minimum wages.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Minimum wages. 50-201... Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 201-GENERAL REGULATIONS § 50-201.1101 Minimum wages. Determinations of prevailing minimum wages or changes therein will be published in the Federal Register by the...
Thallium-201 accumulation in cerebral candidiasis: Unexpected finding on SPECT
Energy Technology Data Exchange (ETDEWEB)
Tonami, N.; Matsuda, H.; Ooba, H.; Yokoyama, K.; Hisada, K.; Ikeda, K.; Yamashita, J. (Kanazawa Univ. (Japan))
1990-06-01
The authors present an unexpected finding of Tl-201 uptake in the intracerebral lesions due to candidiasis. SPECT demonstrated the extent of the lesions and a high target-to-background ratio. The regions where abnormal Tl-201 accumulation was seen were nearly consistent with CT scans of those enhanced by a contrast agent. After treatment, most of the abnormal Tl-201 accumulation disappeared.
48 CFR 3036.201 - Evaluation of contractor performance.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Evaluation of contractor performance. 3036.201 Section 3036.201 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY... ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 3036.201 Evaluation of...
48 CFR 2936.201 - Evaluation of contractor performance.
2010-10-01
... Construction 2936.201 Evaluation of contractor performance. The HCA must establish procedures to evaluate... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Evaluation of contractor performance. 2936.201 Section 2936.201 Federal Acquisition Regulations System DEPARTMENT OF LABOR GENERAL...
19 CFR 201.110 - Self-evaluation.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Self-evaluation. 201.110 Section 201.110 Customs... Commission § 201.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies... in the self-evaluation process by submitting comments (both oral and written). (c) The agency shall...
46 CFR 201.55 - Postponement of hearing.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Postponement of hearing. 201.55 Section 201.55 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Time (Rule 5) § 201.55 Postponement of hearing. Applications for postponement of any hearing date...
7 CFR 810.201 - Definition of barley.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of barley. 810.201 Section 810.201... GRAIN United States Standards for Barley Terms Defined § 810.201 Definition of barley. Grain that, before the removal of dockage, consists of 50 percent or more of whole kernels of cultivated barley...
48 CFR 1427.201-2 - Contract clauses.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 1427.201-2 Section 1427.201-2 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 1427.201-2 Contract clauses...
46 CFR 201.117 - Inclusion in record.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part thereof...
10 CFR 830.201 - Performance of work.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Performance of work. 830.201 Section 830.201 Energy DEPARTMENT OF ENERGY NUCLEAR SAFETY MANAGEMENT Safety Basis Requirements § 830.201 Performance of work. A contractor must perform work in accordance with the safety basis for a hazard category 1, 2, or 3 DOE nuclear...
7 CFR 201.13 - Lot number or other identification.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Lot number or other identification. 201.13 Section 201... ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.13 Lot number or other identification. The lot number or other identification shall be shown on the label and shall be the same as that...
21 CFR 201.60 - Principal display panel.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Principal display panel. 201.60 Section 201.60...: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.60 Principal display panel. The term principal display panel, as it applies to over-the-counter drugs in package form and as used in...
7 CFR 201.52 - Noxious-weed seeds.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds. 201.52 Section 201.52 Agriculture... REGULATIONS Purity Analysis in the Administration of the Act § 201.52 Noxious-weed seeds. (a) The determination of the number of seeds, bulblets, or tubers of individual noxious weeds present per unit weight...
17 CFR 201.222 - Prehearing submissions.
2010-04-01
... PRACTICE Rules of Practice Initiation of Proceedings and Prehearing Rules § 201.222 Prehearing submissions... information as deemed appropriate, including any or all of the following: (1) An outline or narrative summary of its case or defense; (2) The legal theories upon which it will rely; (3) Copies and a list of...
2010-01-01
... Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Services § 201.76 Reweighing. Stockyard owners, market agencies, dealers, packers and live poultry dealers shall...
2010-01-01
... Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Definitions... in the Regulations under the Packers and Stockyards Act, 9 CFR part 201; Rules of Practice Governing...
50 CFR 216.201 - Effective dates.
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Construction and Operation of Offshore Oil and Gas Facilities in the U.S. Beaufort Sea § 216.201 Effective dates. Regulations in this subpart are effective from April 6...
2010-10-01
... significant effect beyond the internal operating procedures of DoD or a significant cost or administrative... Logistics) (USD (AT&L)) approval for use of the policy, procedure, clause, or form (see 201.304(1)) must include an analysis of the public comments in the request for approval. ...
2010-01-01
..., Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.10 Variety. (a) The following kinds of agricultural seeds are generally..., striate; Millet, foxtail; Millet, pearl; Oat; Pea, field; Peanut; Rice; Rye; Safflower; Sorghum; Sorghum...
22 CFR 201.43 - Diversion clause.
2010-04-01
... Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES AND PROCEDURES APPLICABLE TO COMMODITY TRANSACTIONS FINANCED BY USAID General Provisions Relating to USAID Financing of Commodities and Commodity-Related Services § 201.43 Diversion clause. USAID may require that charter parties, bills of lading, or other ocean...
2010-10-01
... strict accounting principles, is the heart of a settlement. (b) The primary objective is to negotiate a... TERMINATION OF CONTRACTS Additional Principles for Fixed-Price Contracts Terminated for Convenience 49.201... on or segregating the particular elements of costs or profit comprising this amount. (c) Cost and...
16 CFR 20.1 - Deception generally.
2010-01-01
..., RECONDITIONED AND OTHER USED AUTOMOBILE PARTS INDUSTRY § 20.1 Deception generally. (a) It is unfair or deceptive to represent, directly or by implication, that any industry product or part of an industry product is... previous use, reconstruction or repair of any industry product. (b) It is unfair or deceptive to offer for...
2010-10-01
... GOVERNMENT SOURCES BY CONTRACTORS Contractor Use of Interagency Fleet Management System (IFMS) 51.201 Policy... contractors to obtain, for official purposes only, interagency fleet management system (IFMS) vehicles and... instance. (c) Government contractors shall not be authorized to obtain interagency fleet management system...
48 CFR 201.404 - Class deviations.
2010-10-01
..., and the Defense Logistics Agency, may approve any class deviation, other than those described in 201...) Diminish any preference given small business concerns by the FAR or DFARS; or (D) Extend to requirements imposed by statute or by regulations of other agencies such as the Small Business Administration and the...
48 CFR 219.201 - General policy.
2010-10-01
... business goal has caused non-SDB firms in a particular North American Industry Classification System... OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 219.201 General policy. (d) For the defense agencies, the director of the Office of Small Business Programs must be appointed by, be...
19 CFR 10.201 - Applicability.
2010-04-01
... eligible articles from any beneficiary country and to designate countries as beneficiary countries. The... purposes of obtaining that duty-free treatment for certain articles from a beneficiary country which are... ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. Andean Trade Preference § 10.201 Applicability...
2010-01-01
... certification status under 5 CFR part 430, subpart D, of the performance appraisal system covering that employee...) Aggregate Limitation on Pay § 530.201 Purpose. This subpart establishes regulations for limiting an employee's aggregate annual compensation. An employee's aggregate compensation received in any given calendar...
2010-01-01
... Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees § 430.201 General. (a... requirements for agency performance appraisal system(s) and program(s) for employees covered by subchapter I of... performance appraisal systems and requires the Office of Personnel Management (OPM) to prescribe regulations...
2010-10-01
..., injury or other loss to citizens or institutions of the United States. Block certification means SAFETY... certification means a determination by DHS pursuant to 6 U.S.C. 442(d), as further delineated in 6 CFR 25.8 and... Act of 2002 50.201 Definitions. Act of terrorism means any act determined to have met the following...
7 CFR 201.16 - Noxious-weed seeds.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds. 201.16 Section 201.16 Agriculture... REGULATIONS Labeling Agricultural Seeds § 201.16 Noxious-weed seeds. (a) Except for those kinds of noxious-weed seeds shown in paragraph (b) of this section, the names of the kinds of noxious-weed seeds and the...
14 CFR 23.201 - Wings level stall.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Wings level stall. 23.201 Section 23.201 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT AIRWORTHINESS.... Starting from a speed at least 10 knots above the stall speed, the elevator control must be pulled back so...
9 CFR 201.10 - Requirements and procedures.
2010-01-01
... operate as a market agency or dealer as defined in section 301 of the Act shall apply for registration... registration, on forms furnished by the Agency, and the bond as required in §§ 201.27 through 201.34. (b) Each... desiring to clear the buying operations of other registrants shall apply for registration as a market...
22 CFR 201.63 - Maximum prices for commodities.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Maximum prices for commodities. 201.63 Section 201.63 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES AND PROCEDURES APPLICABLE TO... producer. The purchase price shall not exceed a price established in accordance with the customary pricing...
41 CFR 50-201.502 - Record of injuries.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Record of injuries. 50-201.502 Section 50-201.502 Public Contracts and Property Management Other Provisions Relating to... injuries. Every person who is or shall become a party to a Government contract which is subject to the...
24 CFR 100.201a - Incorporation by reference.
2010-04-01
... FAIR HOUSING DISCRIMINATORY CONDUCT UNDER THE FAIR HOUSING ACT Prohibition Against Discrimination... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Incorporation by reference. 100.201a Section 100.201a Housing and Urban Development Regulations Relating to Housing and Urban...
50 CFR 223.201 - Guadalupe fur seal.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Guadalupe fur seal. 223.201 Section 223... Applicable to Threatened Marine and Anadromous Species § 223.201 Guadalupe fur seal. (a) Prohibitions. The... seal except as provided in paragraph (b) of this section. (b) Exceptions. (1) The Assistant...
48 CFR 9903.201-3 - Solicitation provisions.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Solicitation provisions. 9903.201-3 Section 9903.201-3 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD... practices disclosed in the applicable Disclosure Statement. □ (3) Certificate of Monetary Exemption. The...
49 CFR 1542.201 - Security of the secured area.
2010-10-01
... SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.201 Security of the secured area. (a) Each airport operator required to have a security... 49 Transportation 9 2010-10-01 2010-10-01 false Security of the secured area. 1542.201 Section...
46 CFR 201.16 - Authority for representation.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Authority for representation. 201.16 Section 201.16 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF... representation. Any individual acting in a representative capacity in any proceeding before the Administration...
9 CFR 201.73 - Scale operators to be qualified.
2010-01-01
....73 Section 201.73 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Services § 201.73 Scale operators to be qualified. Stockyard owners, market agencies, dealers...
46 CFR 201.76 - Applications for Government aid.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Applications for Government aid. 201.76 Section 201.76... Government aid. Applications for operating-differential subsidies, charter of Government-owned vessels, and other types of Government aid shall conform to the requirements set forth in the various general orders...
31 CFR 595.201 - Prohibited transactions involving blocked property.
2010-07-01
... this section and a party to the transaction believes the funds have been blocked due to mistaken... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Prohibited transactions involving blocked property. 595.201 Section 595.201 Money and Finance: Treasury Regulations Relating to Money and...
31 CFR 536.201 - Prohibited transactions involving blocked property.
2010-07-01
... institution pursuant to this section and a party to the transaction believes the funds have been blocked due... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Prohibited transactions involving blocked property. 536.201 Section 536.201 Money and Finance: Treasury Regulations Relating to Money and...
21 CFR 201.63 - Pregnancy/breast-feeding warning.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Pregnancy/breast-feeding warning. 201.63 Section...) DRUGS: GENERAL LABELING Labeling Requirements for Over-the-Counter Drugs § 201.63 Pregnancy/breast... labeling. (b) Where a specific warning relating to use during pregnancy or while nursing has been...
7 CFR 201.18 - Other agricultural seeds (crop seeds).
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Other agricultural seeds (crop seeds). 201.18 Section... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.18 Other agricultural seeds (crop...
21 CFR 201.50 - Statement of identity.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Statement of identity. 201.50 Section 201.50 Food... identity. (a) The label of prescription and insulin-containing drugs in package form shall bear as one of its principal features a statement of the identity of the drug. (b) Such statement of identity shall...
27 CFR 31.201 - Refilling of liquor bottles.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Refilling of liquor bottles. 31.201 Section 31.201 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Reuse and Possession of Used Liquor...
Mechanism of /sup 201/Tl uptake in tumours
Energy Technology Data Exchange (ETDEWEB)
Sehweil, A.M.; Omar, Y.T.; McKillop, J.H.; Milroy, R.; Wilson, R.; Abdel-Dayem, H.M.
1989-07-01
We have studied the mechanism of tumour uptake of /sup 201/Tl by in vivo and in vitro studies. In a series of patients with breast cancer (n=26), lung cancer (n=56) and lymphoma (n=15), the time course of tumour uptake of /sup 201/Tl paralleled that in the myocardium with almost identical times of peak uptake being obtained in tumours and myocardium. In a patient with hepatic metastases from colonic cancer undergoing laparotomy, /sup 99m/Tc labelled microspheres and /sup 201/Tl were injected into the hepatic artery and biopsies of metastatic and normal liver tissue obtained. The tumour to normal liver activity ratios for /sup 201/Tl were one tenth of those for /sup 99m/Tc microspheres. In the final part of the study, cells from a lung cancer tissue culture line were incubated for 30 min with /sup 201/Tl with and without the addition of cardiac glycoside, which acts a sodium potassium pump blocker. The cells exposed to the cardiac glycoside showed markedly decreased uptake of /sup 201/Tl compared to the cells not so exposed (0.6%+-0.1% vs 11.8+-0.7% of the administered dose). The mechanism of /sup 201/Tl uptake of tumours is similar to that in the myocardium. Sodium potassium pump activity appears to be more important than tumour blood flow. /sup 201/Tl uptake may provide a useful means of studying tumour viability.
37 CFR 201.25 - Visual Arts Registry.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Visual Arts Registry. 201.25... AND PROCEDURES GENERAL PROVISIONS § 201.25 Visual Arts Registry. (a) General. This section prescribes the procedures relating to the submission of Visual Arts Registry Statements by visual artists and...
48 CFR 436.201 - Evaluation of contractor performance.
2010-10-01
... Construction 436.201 Evaluation of contractor performance. Preparation of performance evaluation reports. In addition to the requirements of FAR 36.201, performance evaluation reports shall be prepared for indefinite... of services to be ordered exceeds $500,000.00. For these contracts, performance evaluation reports...
40 CFR 86.201-94 - General applicability.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false General applicability. 86.201-94 Section 86.201-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...
40 CFR 86.201-11 - General applicability.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false General applicability. 86.201-11 Section 86.201-11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...
17 CFR 201.36 - Allowable fees and expenses.
2010-04-01
... compensate an expert witness may exceed the reasonable rate at which the Commission pays witnesses with.... 201.36 Section 201.36 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION RULES OF...) Subject to the limitation of paragraph (b), awards will be based on rates customarily charged, in the...
5 CFR 178.201 - Scope of subpart.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Scope of subpart. 178.201 Section 178.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROCEDURES FOR SETTLING CLAIMS... of the Federal land banks, Federal intermediate credit banks, or regional banks for cooperatives (see...
20 CFR 201.1 - Words and phrases.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Words and phrases. 201.1 Section 201.1 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT DEFINITIONS..., sleeping-car company, or carrier by railroad, subject to part I of the Interstate Commerce Act (24 Stat...
29 CFR 18.201 - Official notice of adjudicative facts.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Official notice of adjudicative facts. 18.201 Section 18.201... of adjudicative facts. (a) Scope of rule. This rule governs only official notice of adjudicative facts. (b) Kinds of facts. An officially noticed fact must be one not subject to reasonable dispute in...
49 CFR 575.201 - Child restraint performance.
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Child restraint performance. 575.201 Section 575... Recall Enhancement, Accountability, and Documentation Act; Consumer Information § 575.201 Child restraint... performance of child restraints. The agency makes the information developed under this rating program...
40 CFR 33.201 - What does this subpart require?
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false What does this subpart require? 33.201 Section 33.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE PARTICIPATION BY DISADVANTAGED BUSINESS ENTERPRISES IN UNITED STATES ENVIRONMENTAL PROTECTION...
5 CFR 250.201 - Coverage and purpose.
2010-01-01
....201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERSONNEL MANAGEMENT IN AGENCIES Strategic Human Capital Management § 250.201 Coverage and purpose. The Chief Human... effective and efficient operation of Government. As a part of OPM's overall leadership responsibilities in...
7 CFR 201.56-2 - Sunflower family, Asteraceae (Compositae).
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Sunflower family, Asteraceae (Compositae). 201.56-2...-2 Sunflower family, Asteraceae (Compositae). Kinds of seed: Artichoke, cardoon, chicory, dandelion... discolored. (Toxic materials in the substratum may cause short, blunt roots; see § 201.58(a)(9).) (C) Primary...
22 CFR 201.32 - Suppliers of delivery services.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Suppliers of delivery services. 201.32 Section 201.32 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES AND PROCEDURES APPLICABLE TO... makes under a marine insurance policy financed pursuant to this part, the supplier of marine insurance...
48 CFR 1327.201 - Patent and copyright infringement liability.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Patent and copyright... GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 1327.201 Patent and copyright infringement liability. ...
48 CFR 1427.201 - Patent and copyright infringement liability.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Patent and copyright... INTERIOR GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 1427.201 Patent and copyright infringement liability. ...
48 CFR 27.201 - Patent and copyright infringement liability.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Patent and copyright... REGULATION GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Patents and Copyrights 27.201 Patent and copyright infringement liability. ...
29 CFR 1603.201 - Referral and scheduling for hearing.
2010-07-01
... FOR PREVIOUSLY EXEMPT STATE AND LOCAL GOVERNMENT EMPLOYEE COMPLAINTS OF EMPLOYMENT DISCRIMINATION UNDER SECTION 304 OF THE GOVERNMENT EMPLOYEE RIGHTS ACT OF 1991 Hearings § 1603.201 Referral and...
29 CFR 553.201 - Statutory provisions: section 7(k).
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Statutory provisions: section 7(k). 553.201 Section 553.201...: section 7(k). (a) Section 7(k) of the Act provides a partial overtime pay exemption for fire protection.... (b) As specified in §§ 553.20 through 553.28 of subpart A, workers employed under section 7(k) may...
Energy Technology Data Exchange (ETDEWEB)
Derebek, E. [Dept. of Nuclear Medicine, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Biberoglu, S. [Dept. of Internal Medicine, Div. of Endocrinology, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Kut, O. [Dept. of Nuclear Medicine, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Yesil, S. [Dept. of Internal Medicine, Div. of Endocrinology, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Saydam, S. [Dept. of Surgery, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Yilmaz, M. [Dept. of Nuclear Medicine, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Yenici, O. [Dept. of Nuclear Medicine, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Igci, E. [Dept. of Radiology, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Gokce, O. [Dept. of Surgery, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Canda, S. [Dept. of Pathology, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Bueyuekgebiz, A. [Dept. of Pediatrics, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Dogan, A.S. [Dept. of Nuclear Medicine, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey); Durak, H. [Dept. of Nuclear Medicine, Dokuz Eylul Univ., School of Medicine, Izmir (Turkey)
1996-05-01
Seventy-six patients with tyroid nodules were studied. Initially, 75 MBq of thallium-201 was injected. The thyroid gland was imaged 15 min (early) and 3 h (delayed) after the injection. Thereafter, 185 MBq technetium-99m pertechnetate was injected. Immediately after the injection, a 1-min perfusion image was acquired, followed by an image at 20 min. Increased early and delayed {sup 201}Tl uptake compared with the contralateral thyroid tissue was adopted as the criterion for malignancy. Sensitivity, specificity and negative predictive values were found to be 85%, 64% and 78%, respectively, in operated patients, but these values were 86%, 87% and 95%, respectively, in the whole group, including patients followed with fine-needle aspiration biopsy. With the purpose of investigating the relationship between perfusion and early {sup 201}Tl uptake, bot perfusion and early images were graded comparing nodular activity with contralateral thyroid activity. There was a poor correlation between perfusion and {sup 201}Tl uptake. The correlation was even worse in hyperactive nodules. It is concluded that early and delayed {sup 201}Tl imaging should not be used in the differential diagnosis of cold nodules and that early {sup 201}Tl uptake seems to be more closely related to factors other than perfusion. (orig.)
Sequential thallium-201 myocardial scintigraphy after acute infarction in man
Energy Technology Data Exchange (ETDEWEB)
Fletcher, J.W.; Mueller, H.S.; Rao, P.S.
1980-07-01
Three sequential Tl-201 myocardial perfusion studies were performed in 21 patients (18 men, 3 women) with first acute transmural myocardia infarction. The Tl-201 image defect size was determined with a semiquantitative visual scoring method and temporal changes in image defect size were compared to CK-MB infarct size and enzymatic evidence of progressive myocardial necrosis and infarct extension. Progressive decreases in Tl-201 image defect size were observed and the visual score in all 21 patients decreased significantly from 6.5 +- 3.7 (mean +- SD) on day 1 to 4.9 +- 3.5 on day 12. Eleven patients without evidence of infarct extension had significantly lower infarct size, a significant decrease in visual score by the 12th day and had significantly smaller Tl-201 defects at all three study times compared to 10 patients with infarct extension. Seven of 10 (70%) with extension had an initial visual score greater than or equal to 7 compared to only 2/11 (18%) without extension. The temporal behavior of Tl-201 image defects is related to the size of the infarction and presence or absence of extension. Sequential studies comparing early initial and subsequent defect size may assist in evaluating the behavior of ischemic and infarcted myocardium in the postinfarction period.
Energy Technology Data Exchange (ETDEWEB)
Fujii, Tadashige; Tanaka, Masao; Hirose, Yoshiki; Hirayama, Jiro; Handa, Kenjiro; Nakanishi, Fumiko; Yano, Kesato; Ueda, Hitoshi
1989-04-01
Thallium-201 (Tl-201) uptake in the bone and bone marrow was examined in a total of 93 patients with various diseases. Sternal uptake of Tl-201 was observed when patients had bone marrow abnormality especially associated with hematopoietic disease. It was associated with proliferation of immature cells and of various types of bone marrow cells, especially erythroblastic and plasma cells. Whole-body Tl-201 scanning showed a high uptake (82%) in the sternum, chest, lumbar vertebrae, and pelvis. Thallium-201 was definitively taken up by the sternum in polycythemia (5/41), hemolytic anemia (2/2), iron deficiency anemia (2/2), and multiple myeloma (2/5). For leukemia, Tl-201 uptake was slight or negative. Thallium-201 scanning proved useful in visualizing bone marrow abnormality, although careful interpretation of bone and bone marrow uptake is required. (Namekawa, K).
41 CFR 50-201.1102 - Tolerance for apprentices, student-learners, and handicapped workers.
2010-07-01
..., student-learners, and handicapped workers. 50-201.1102 Section 50-201.1102 Public Contracts and Property... REGULATIONS § 50-201.1102 Tolerance for apprentices, student-learners, and handicapped workers. (a... standards and procedures as are prescribed for the employment of apprentices, student-learners, handicapped...
9 CFR 201.32 - Trustee in market agency, dealer and packer bonds.
2010-01-01
... STOCKYARDS ACT Market Agency, Dealer and Packer Bonds § 201.32 Trustee in market agency, dealer and packer... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Trustee in market agency, dealer and packer bonds. 201.32 Section 201.32 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS...
9 CFR 201.43 - Payment and accounting for livestock and live poultry.
2010-01-01
... and live poultry. 201.43 Section 201.43 Animals and Animal Products GRAIN INSPECTION, PACKERS AND... PACKERS AND STOCKYARDS ACT Accounts and Records § 201.43 Payment and accounting for livestock and live... nature of the transaction. (b) Prompt payment for livestock and live poultry—terms and conditions. (1) No...
34 CFR 75.201 - How the selection criteria will be used.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false How the selection criteria will be used. 75.201 Section 75.201 Education Office of the Secretary, Department of Education DIRECT GRANT PROGRAMS How Grants Are Made Selection of New Projects § 75.201 How the selection criteria will be used. (a) In the...
24 CFR 201.6 - Disclosure and verification of Social Security and Employer Identification Numbers.
2010-04-01
... HOME LOANS General § 201.6 Disclosure and verification of Social Security and Employer Identification... Social Security and Employer Identification Numbers. 201.6 Section 201.6 Housing and Urban Development... the disclosure and verification of Social Security and Employer Identification Numbers, as provided by...
47 CFR 73.201 - Numerical designation of FM broadcast channels.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Numerical designation of FM broadcast channels. 73.201 Section 73.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES RADIO BROADCAST SERVICES FM Broadcast Stations § 73.201 Numerical designation of FM broadcast...
17 CFR 201.601 - Prompt payment of disgorge-ment, interest and penalties.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Prompt payment of disgorge-ment, interest and penalties. 201.601 Section 201.601 Commodity and Securities Exchanges SECURITIES AND... § 201.601 Prompt payment of disgorge-ment, interest and penalties. (a) Timing of payments. Unless...
7 CFR 201.71 - Establishing the source of all classes of certified seed.
2010-01-01
... seed. 201.71 Section 201.71 Agriculture Regulations of the Department of Agriculture (Continued... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.71 Establishing the source of all classes of certified seed. The certifying agency shall have evidence of the class and source of...
7 CFR 201.51b - Purity procedures for coated seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Purity procedures for coated seed. 201.51b Section 201... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.51b Purity...
7 CFR 201.73 - Processors and processing of all classes of certified seed.
2010-01-01
... seed. 201.73 Section 201.73 Agriculture Regulations of the Department of Agriculture (Continued... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.73 Processors and processing of all classes of certified seed. The following requirements must be met by processors of all classes...
9 CFR 201.95 - Inspection of business records and facilities.
2010-01-01
... facilities. 201.95 Section 201.95 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT General § 201.95 Inspection of business records and facilities. Each stockyard owner, market...
21 CFR 250.201 - Preparations for the treatment of pernicious anemia.
2010-04-01
... anemia. 250.201 Section 250.201 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... Drugs and Foods § 250.201 Preparations for the treatment of pernicious anemia. (a) The ninth announcement of the Anti-anemia Preparations Advisory Board of the United States Pharmacopeia is concerned with...
21 CFR 201.310 - Phenindione; labeling of drug preparations intended for use by man.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Phenindione; labeling of drug preparations intended for use by man. 201.310 Section 201.310 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Specific Labeling Requirements for Specific Drug Products § 201.310 Phenindione;...
37 CFR 201.2 - Information given by the Copyright Office.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Information given by the Copyright Office. 201.2 Section 201.2 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.2 Information given by the Copyright...
37 CFR 201.14 - Warnings of copyright for use by certain libraries and archives.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Warnings of copyright for use by certain libraries and archives. 201.14 Section 201.14 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.14 Warnings...
37 CFR 201.6 - Payment and refund of Copyright Office fees.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Payment and refund of Copyright Office fees. 201.6 Section 201.6 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.6 Payment and refund of Copyright Office...
37 CFR 201.23 - Transfer of unpublished copyright deposits to the Library of Congress.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Transfer of unpublished copyright deposits to the Library of Congress. 201.23 Section 201.23 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES GENERAL PROVISIONS § 201.23 Transfer...
48 CFR 31.201-7 - Construction and architect-engineer contracts.
2010-10-01
...-engineer contracts. 31.201-7 Section 31.201-7 Federal Acquisition Regulations System FEDERAL ACQUISITION... Organizations 31.201-7 Construction and architect-engineer contracts. Specific principles and procedures for... architect-engineer contracts related to construction projects, are in 31.105. The applicability of these...
30 CFR 201.100 - Responsibilities of the Associate Director for Minerals Revenue Management.
2010-07-01
... Minerals Revenue Management. 201.100 Section 201.100 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT GENERAL Oil and Gas, Onshore § 201.100 Responsibilities of the Associate Director for Minerals Revenue Management. The Associate Director is responsible...
31 CFR 560.201 - Prohibited importation of goods or services from Iran.
2010-07-01
... services from Iran. 560.201 Section 560.201 Money and Finance: Treasury Regulations Relating to Money and... REGULATIONS Prohibitions § 560.201 Prohibited importation of goods or services from Iran. Except as otherwise... origin or owned or controlled by the Government of Iran, other than information and informational...
5 CFR 839.201 - Do these rules apply to me?
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Do these rules apply to me? 839.201 Section 839.201 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE... COVERAGE CORRECTIONS ACT Eligibility General Provisions § 839.201 Do these rules apply to me? (a) These...
21 CFR 201.115 - New drugs or new animal drugs.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false New drugs or new animal drugs. 201.115 Section 201.115 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Exemptions From Adequate Directions for Use § 201.115 New drugs or new animal...
21 CFR 201.2 - Drugs and devices; National Drug Code numbers.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs and devices; National Drug Code numbers. 201.2 Section 201.2 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING General Labeling Provisions § 201.2 Drugs and devices; National Drug Code...
40 CFR 267.201 - What must I do when I stop operating the tank system?
2010-07-01
... OPERATING UNDER A STANDARDIZED PERMIT Tank Systems § 267.201 What must I do when I stop operating the tank... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What must I do when I stop operating the tank system? 267.201 Section 267.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...
46 CFR 201.46 - Copies of documents for use of the Administration.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Copies of documents for use of the Administration. 201.46 Section 201.46 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Form, Execution and Service of Documents (Rule 4) § 201.46 Copies of documents for use of the...
40 CFR 246.201-6 - Recommended procedures: Transportation to market.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Transportation to market. 246.201-6 Section 246.201-6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Procedures § 246.201-6 Recommended procedures: Transportation to market. Transportation to market may be...
38 CFR 3.201 - Exchange of evidence; Social Security and Department of Veterans Affairs.
2010-07-01
...; Social Security and Department of Veterans Affairs. 3.201 Section 3.201 Pensions, Bonuses, and Veterans... Compensation Evidence Requirements § 3.201 Exchange of evidence; Social Security and Department of Veterans... Social Security Administration or to have the Department of Veterans Affairs obtain such evidence from...
46 CFR 201.88 - Postponement or change of place by presiding officer.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Postponement or change of place by presiding officer. 201.88 Section 201.88 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE...) § 201.88 Postponement or change of place by presiding officer. If, in the judgment of the presiding...
47 CFR 54.201 - Definition of eligible telecommunications carriers, generally.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Definition of eligible telecommunications carriers, generally. 54.201 Section 54.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... § 54.201 Definition of eligible telecommunications carriers, generally. (a) Carriers eligible to...
40 CFR 1033.201 - General requirements for obtaining a certificate of conformity.
2010-07-01
... certificate of conformity. 1033.201 Section 1033.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY....201 General requirements for obtaining a certificate of conformity. Certification is the process by... certificate of conformity for freshly manufactured locomotives. Anyone meeting the definition of...
17 CFR 300.201 - Accounts introduced by same or different broker or dealer.
2010-04-01
... different broker or dealer. 300.201 Section 300.201 Commodity and Securities Exchanges SECURITIES AND... CORPORATION Accounts Introduced by Other Brokers Or Dealers § 300.201 Accounts introduced by same or different broker or dealer. All accounts of a person which are introduced by the same broker or dealer shall be...
19 CFR 201.11 - Appearance in an investigation as a party.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Appearance in an investigation as a party. 201.11 Section 201.11 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION GENERAL RULES OF GENERAL APPLICATION Initiation and Conduct of Investigations § 201.11 Appearance in an investigation as a party. (a...
Nitroglycerin Attenuates Vasoconstriction of HBOC-201 during Hemorrhagic Shock Resuscitation
2010-01-01
Noack E. Nitric oxide (NO) formation from nitrovasodilators occurs independently of hemoglobin or non-heme iron . Eur 1 Pharmacol 1987;142:465-9...gen monitoring during hemorrhagic shock and resuscitation: a comparison or lactated Ringer’s solution, hypertonic saline dextran , and HBOC-201.1
5 CFR 2610.201 - Contents of application.
2010-01-01
... 2610.201 Administrative Personnel OFFICE OF GOVERNMENT ETHICS ORGANIZATION AND PROCEDURES... purpose of its organization or business. The application shall also: (1) Show that the applicant has... organization described in section 501(c)(3) of the Internal Revenue Code (26 U.S.C. 501(c)(3)) or, in the case...
A comparison of the clinical relevance of thallium201 and ...
African Journals Online (AJOL)
Thallium-201 is at present the radiotracer of choice for the clinical evaluation of myocardial blood flow. Although different technetium-99m-isonitrile agents have been synthesised recently, only 99mTc-melhoxyisobutyl-isonitrile (99mTc_MIBI) has proved to hold promise for clinical implementation. The myocardial distribution ...
24 CFR 206.201 - Mortgage servicing generally; sanctions.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage servicing generally... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Servicing Responsibilities § 206.201 Mortgage servicing...
44 CFR 201.4 - Standard State Mitigation Plans.
2010-10-01
... vulnerability assessments. The risk assessment shall include the following: (i) An overview of the type and..., DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE MITIGATION PLANNING § 201.4 Standard State Mitigation... was involved in the process, and how other agencies participated. (2) Risk assessments that provide...
44 CFR 201.7 - Tribal Mitigation Plans.
2010-10-01
... OF HOMELAND SECURITY DISASTER ASSISTANCE MITIGATION PLANNING § 201.7 Tribal Mitigation Plans. The... events. (ii) A description of the Indian tribal government's vulnerability to the hazards described in... its impact on the tribe. The plan should describe vulnerability in terms of: (A) The types and numbers...
9 CFR 201.42 - Custodial accounts for trust funds.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Custodial accounts for trust funds... STOCKYARDS ACT Proceeds of Sale § 201.42 Custodial accounts for trust funds. (a) Payments for livestock are trust funds. Each payment that a livestock buyer makes to a market agency selling on commission is a...
48 CFR 31.201-6 - Accounting for unallowable costs.
2010-10-01
... Organizations 31.201-6 Accounting for unallowable costs. (a) Costs that are expressly unallowable or mutually... accounting for and presentation of unallowable costs must be those described in 48 CFR 9904.405, Accounting... accounting for and presenting unallowable costs provided the following criteria in paragraphs (c)(2)(i), (c...
9 CFR 201.17 - Requirements for filing tariffs.
2010-01-01
....17 Section 201.17 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS... changes for stockyard services. Each stockyard owner and market agency operating at a posted stockyard...
9 CFR 201.72 - Scales; testing of.
2010-01-01
....72 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Services § 201.72 Scales; testing of. (a) Each stockyard owner, market agency, dealer, packer, or live poultry...
24 CFR 201.13 - Interest and discount points.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest and discount points. 201... discount points. The interest rate for any loan shall be negotiated and agreed to by the borrower and the... basis. The lender and the borrower may negotiate the amount of discount points, if any, to be paid by...
Phenotype abnormality: 201 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 201 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u707i decreased number... of trichome in organ named shoot system ... shoot system ... present in fewer numbers in organism ... trichome ...
17 CFR 232.201 - Temporary hardship exemption.
2010-04-01
... no later than one business day after the date on which the filing was to be made. (1) An electronic... submitted to the Commission within six business days of filing the paper format document. The electronic... REGULATION S-T-GENERAL RULES AND REGULATIONS FOR ELECTRONIC FILINGS Hardship Exemptions § 232.201 Temporary...
Knowledge and True Belief at Theaetetus 201a–c
Nawar, Tamer
2013-01-01
This paper examines a passage in the Theaetetus (201a–c) where Plato distinguishes knowledge from true belief by appealing to the example of a jury hearing a case. While the jurors may have true belief, Socrates puts forward two reasons why they cannot achieve knowledge. The reasons for this
48 CFR 30.201-3 - Solicitation provisions.
2010-10-01
... GENERAL CONTRACTING REQUIREMENTS COST ACCOUNTING STANDARDS ADMINISTRATION CAS Program Requirements 30.201... Accounting Standards Notices and Certification, in solicitations for proposed contracts subject to CAS as... prior to July 1, 1997, the contracting officer shall insert the basic provision set forth at 52.230-1...
7 CFR 201.56-5 - Grass family, Poaceae (Gramineae).
2010-01-01
... family, Poaceae (Gramineae). Kinds of seed: Bentgrasses, bluegrasses, bluestems, bromes, cereals, fescues... 7 Agriculture 3 2010-01-01 2010-01-01 false Grass family, Poaceae (Gramineae). 201.56-5 Section... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED...
48 CFR 39.201 - Scope of subpart.
2010-10-01
... CONTRACTING ACQUISITION OF INFORMATION TECHNOLOGY Electronic and Information Technology 39.201 Scope of... the Architectural and Transportation Barriers Compliance Board Electronic and Information Technology... via the Internet at http://www.section508.gov. (c) When acquiring EIT, agencies must ensure that— (1...
19 CFR 201.21 - Availability of specific records.
2010-04-01
... meetings and conversations, film impressions, magnetic tapes, and sound or mechanical reproductions; the... 19 Customs Duties 3 2010-04-01 2010-04-01 false Availability of specific records. 201.21 Section... specific records. (a) Records available. The following information, on request to the Secretary of the...
48 CFR 36.201 - Evaluation of contractor performance.
2010-10-01
... Contracting for Construction 36.201 Evaluation of contractor performance. See 42.1502(e) for the requirements for preparing past performance evaluations for construction contracts. ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Evaluation of contractor...
48 CFR 236.201 - Evaluation of contractor performance.
2010-10-01
... CONTRACTS Special Aspects of Contracting for Construction 236.201 Evaluation of contractor performance. (a) Preparation of performance evaluation reports. Use DD Form 2626, Performance Evaluation (Construction... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation of contractor...
48 CFR 1536.201 - Evaluation of contracting performance.
2010-10-01
... Contracting for Construction 1536.201 Evaluation of contracting performance. (a) The Contracting Officer will... will file the form in the contractor performance evaluation files which it maintains. (e) The Quality... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Evaluation of contracting...
41 CFR 101-39.201 - Services available.
2010-07-01
...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services § 101-39.201 Services available. GSA Interagency Fleet Management System (IFMS) vehicles and services shall be used in... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Services available. 101...
28 CFR 2.201 - Period of supervised release.
2010-07-01
... probation, parole or supervised release for another offense, but does not run while the offender is... imprisonment resulting from a probation, parole, or supervised release revocation) unless the period of... Section 2.201 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT...
18 CFR 4.201 - Contents of application.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Contents of application... OF PROJECT COSTS Application for Amendment of License § 4.201 Contents of application. An application... inappropriate with respect to the particular amendment of license sought by the applicant, a petition for waiver...
49 CFR 1580.201 - Rail security coordinator.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Rail security coordinator. 1580.201 Section 1580... ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY MARITIME AND LAND TRANSPORTATION SECURITY RAIL TRANSPORTATION..., including heavy rail transit, light rail transit, automated guideway, cable car, inclined plane, funicular...
48 CFR 614.201-70 - Use of English language.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Use of English language... METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 614.201-70 Use of English language. Use of English language solicitations and contracts is mandatory unless a deviation has been approved by the...
A comparison of the clinical relevance of thallium- 201 and ...
African Journals Online (AJOL)
1990-09-01
Sep 1, 1990 ... group of 20 patients, who underwent both 201TI single photon emission computed tomography and 99mTc_MIBI study as well as coronary angiography. The sensitivity for predicting a lesion ranged from 25% to 88% in different areas of the heart and was comparable for the two radiophannaceuticals. The.
5 CFR 315.201 - Service requirement for career tenure.
2010-01-01
... employment to accompany a spouse or parent (if the employee is their unmarried child under 21 years of age... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Service requirement for career tenure... REGULATIONS CAREER AND CAREER-CONDITIONAL EMPLOYMENT The Career-Conditional Employment System § 315.201...
29 CFR 20.1 - Purpose and scope.
2010-07-01
... Secretary of Labor FEDERAL CLAIMS COLLECTION Disclosure of Information to Credit Reporting Agencies § 20.1... Collection Act of 1982 (Pub. L. 97-365), 31 U.S.C. 3711(f). This statute, and other applicable authority, authorizes Department heads to disclose to credit reporting agencies information concerning claims owed the...
48 CFR 14.201-9 - Simplified contract format.
2010-10-01
... CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.201-9 Simplified contract format...) Contract line item number. (2) Description of supplies or services, or data sufficient to identify the..., but shall retain them in the contract file. Award by acceptance of a bid on the award portion of SF...
Verification of RESRAD-RDD. (Version 2.01)
Energy Technology Data Exchange (ETDEWEB)
Cheng, Jing-Jy [Argonne National Lab. (ANL), Argonne, IL (United States); Flood, Paul E. [Argonne National Lab. (ANL), Argonne, IL (United States); LePoire, David [Argonne National Lab. (ANL), Argonne, IL (United States); Kamboj, Sunita [Argonne National Lab. (ANL), Argonne, IL (United States); Yu, Charley [Argonne National Lab. (ANL), Argonne, IL (United States)
2015-09-01
In this report, the results generated by RESRAD-RDD version 2.01 are compared with those produced by RESRAD-RDD version 1.7 for different scenarios with different sets of input parameters. RESRAD-RDD version 1.7 is spreadsheet-driven, performing calculations with Microsoft Excel spreadsheets. RESRAD-RDD version 2.01 revamped version 1.7 by using command-driven programs designed with Visual Basic.NET to direct calculations with data saved in Microsoft Access database, and re-facing the graphical user interface (GUI) to provide more flexibility and choices in guideline derivation. Because version 1.7 and version 2.01 perform the same calculations, the comparison of their results serves as verification of both versions. The verification covered calculation results for 11 radionuclides included in both versions: Am-241, Cf-252, Cm-244, Co-60, Cs-137, Ir-192, Po-210, Pu-238, Pu-239, Ra-226, and Sr-90. At first, all nuclidespecific data used in both versions were compared to ensure that they are identical. Then generic operational guidelines and measurement-based radiation doses or stay times associated with a specific operational guideline group were calculated with both versions using different sets of input parameters, and the results obtained with the same set of input parameters were compared. A total of 12 sets of input parameters were used for the verification, and the comparison was performed for each operational guideline group, from A to G, sequentially. The verification shows that RESRAD-RDD version 1.7 and RESRAD-RDD version 2.01 generate almost identical results; the slight differences could be attributed to differences in numerical precision with Microsoft Excel and Visual Basic.NET. RESRAD-RDD version 2.01 allows the selection of different units for use in reporting calculation results. The results of SI units were obtained and compared with the base results (in traditional units) used for comparison with version 1.7. The comparison shows that RESRAD
Performance of the Microwave Anisotropy Probe AST-201 Star Trackers
Ward, David K.; vanBezooijen, Roelof; Bauer, Frank H. (Technical Monitor)
2002-01-01
The Microwave Anisotropy Probe (MAP) was launched to create a full-sky map of the cosmic microwave background. MAP incorporates two modified Lockheed Martin AST-201 (Autonomous Star Tracker) star trackers. The AST-201 employs an eight element radiation hardened lens assembly which is used to focus an image on a charge coupled device (CCD). The CCD image is then processed by a star identification algorithm which outputs a three-axis attitude. A CCD-shift algorithm called Time Delayed Integration (TDI) was also included in each star tracker. In order to provide some radiation effect filtering during MAP's three to five phasing loop passes through the Van Allen radiation belts, a simple pixel filtering scheme was implemented, rather than using a more complex, but more robust windowing algorithm. The trackers also include a fiber optic data interface. This paper details the ground testing that was accomplished on the MAP trackers.
[{sup 201}Tl](III)-bleomycin for tumor imaging
Energy Technology Data Exchange (ETDEWEB)
Jalilian, A.R.; Akhlaghi, M.; Shirazi, B.; Aboudzadeh, R.; Raisali, G.; Salouti, G.; Babaii, M. [Cyclotron and Nuclear Medicine Dept., Nuclear Research Center for Agriculture and Medicine, Karaj (Iran)
2006-07-01
Due to interesting physical properties and wide availability of thallium-201 as a SPECT radionuclide, the idea of incorporation of this nuclide into biologically active compounds was targeted. Thallium-201 (T{sub 1/2} = 3.04d) in Tl{sup +} form was converted to Tl{sup 3+} cation in presence of O{sub 3} in 6 M HCl controlled by RTLC/gel electrophoresis methods. The final evaporated activity was reacted with bleomycin in normal saline to yield [{sup 201}Tl]BLM at room temperature after 0.5 h (radiochemical yield > 999%) followed by HPLC analysis. The studies showed that thallic ion is mostly incorporated into bleomycin A{sub 2} while other species in the pharmaceutical sample almost remain unlabeled. Radiochemical purity of more than 99% was obtained using RTLC, HPLC with specific activity of about 7 Ci/mmol. The stability of the tracer was checked in the final product in presence of human serum at 37 C up to 3 d. The tracer accumulated in tumors of fibrosarcoma-bearing mice after 72 h. (orig.)
9 CFR 201.28 - Duplicates of bonds or equivalents to be filed with Regional Supervisors.
2010-01-01
... INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT General Bonding Provisions § 201.28 Duplicates of...
9 CFR 201.70 - Restriction or limitation of competition between packers and dealers prohibited.
2010-01-01
... INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Trade Practices § 201.70 Restriction or...
2010-01-01
... INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Trade Practices § 201.61 Market agencies selling...
DEFF Research Database (Denmark)
Mulkey, Sarah B; Ben-Zeev, Bruria; Nicolai, Joost
2017-01-01
patients had encephalopathy from birth and presented with prominent startle-like myoclonus, which could be triggered by sound or touch. In seven patients, electroencephalography (EEG) was performed in the neonatal period and showed a burst-suppression pattern. However, myoclonus did not have an EEG...... respiratory failure and/or chronic hypoventilation), hypomyelination, reduced brain volume, and profound developmental delay. One patient had a later onset, and sequencing indicated that a low abundance (~20%) R201C variant had arisen by postzygotic mosaicism. SIGNIFICANCE: Heterozygous KCNQ2 R201C and R201H...
Phenotype-gene: 201 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 201 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1199i decreased size in organ named aerial...metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15829606i decreased size in organ named aerial organ http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u722i AT3G55360
Evaluation of Tl-201 SPECT imaging findings in prostate cancer
Directory of Open Access Journals (Sweden)
Sinem Ozyurt
2015-07-01
Full Text Available Objectives: To compare with histopathological findings the findings of prostate cancer imaging by SPECT method using Tl-201 as a tumor seeking agent. Methods: The study comprised 59 patients (age range 51-79 years, mean age 65.3 ± 6.8 years who were planned to have transrectal ultrasonography (TRUS-guided biopsies due to suspicion of prostate cancer between April 2011 and September 2011. Early planar, late planar and SPECT images were obtained for all patients. Scintigraphic evaluation was made in relation to uptake presence and patterns in the visual assessment and to Tumor/Background (T/Bg ratios for both planar and SPECT images in the quantitative assessment. Histopathological findings were compatible with benign etiology in 36 (61% patients and malign etiology in 23 (39% patients. Additionally, comparisons were made to evaluate the relationships between uptake patterns,total PSA values and Gleason scores. Results: A statistically significant difference was found between the benign and malignant groups in terms of uptake in planar and SPECT images and T/Bg ratios and PSA values. No statistically significant difference was found between uptake patterns of planar and SPECT images and Gleason scores in the malignant group. Conclusions: SPECT images were superior to planar images in the comparative assessment. Tl-201 SPECT imaging can provide an additional contribution to clinical practice in the diagnosis of prostate cancer and it can be used in selected patients.
30 CFR 77.201-1 - Tests for methane; qualified person; use of approved device.
2010-07-01
... approved device. 77.201-1 Section 77.201-1 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH MANDATORY SAFETY STANDARDS, SURFACE COAL MINES AND SURFACE... welding or an open flame is used, or a spark may be produced. ...
9 CFR 201.200 - Sale of livestock to a packer on credit.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Sale of livestock to a packer on credit. 201.200 Section 201.200 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS... credit to ________, a packer, and I understand that in doing so I will have no rights under the trust...
9 CFR 201.56 - Market agencies selling on commission; purchases from consignment.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Market agencies selling on commission; purchases from consignment. 201.56 Section 201.56 Animals and Animal Products GRAIN INSPECTION, PACKERS AND... openly, at the highest available bid, and in such a manner as to best promote the interest of each...
9 CFR 201.11 - Suspended registrants; officers, agents, and employees.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Suspended registrants; officers, agents, and employees. 201.11 Section 201.11 Animals and Animal Products GRAIN INSPECTION, PACKERS AND... partnership or corporation in which any such person has a substantial financial interest or exercises...
No association between the Arg201Gly polymorphism of the DCC gene and colorectal cancer
de Jong, MM; Meerman, GJT; van der Graaf, WTA; de Vries, EGE; Nolte, IM; Mulder, MJ; Bruinenberg, M; van der Steege, G; Schaapveld, M; Sijmons, RH; Hofstra, RMW; Kleibeuker, JH
2004-01-01
Background and aims. In one small study, the DCC Arg201Gly polymorphism has been observed more frequently in colorectal cancer cases compared with controls. We wondered whether these results could be replicated in a much larger study. Methodology. The DCC Arg201Gly polymorphism was genotyped in 625
37 CFR 201.38 - Designation of agent to receive notification of claimed infringement.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Designation of agent to receive notification of claimed infringement. 201.38 Section 201.38 Patents, Trademarks, and Copyrights... Designation of agent to receive notification of claimed infringement. (a) General. This section prescribes...
17 CFR 201.630 - Inability to pay disgorge-ment, interest or penalties.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Inability to pay disgorge-ment, interest or penalties. 201.630 Section 201.630 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Inability to pay disgorge-ment, interest or penalties. (a) Generally. In any proceeding in which an order...
48 CFR 201.109 - Statutory acquisition-related dollar thresholds-adjustment for inflation.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Statutory acquisition-related dollar thresholds-adjustment for inflation. 201.109 Section 201.109 Federal Acquisition...-adjustment for inflation. (d) A matrix showing the most recent escalation adjustments of statutory...
7 CFR 201.72 - Production of all classes of certified seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Production of all classes of certified seed. 201.72... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.72 Production of all classes of certified seed...
7 CFR 201.48 - Kind or variety considered pure seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Kind or variety considered pure seed. 201.48 Section... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Purity Analysis in the Administration of the Act § 201.48 Kind or...
7 CFR 201.74 - Labeling of all classes of certified seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Labeling of all classes of certified seed. 201.74... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.74 Labeling of all classes of certified seed. (a...
7 CFR 201.70 - Limitations of generations for certified seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Limitations of generations for certified seed. 201.70... SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.70 Limitations of generations for certified seed...
7 CFR 201.58c - Detection of captan, mercury, or thiram on seed.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Detection of captan, mercury, or thiram on seed. 201...) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Examinations in the Administration of the Act § 201.58c Detection of captan, mercury, or thiram on seed. The bioassay method may be used according to the procedure...
7 CFR 201.67 - Seed certifying agency standards and procedures.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Seed certifying agency standards and procedures. 201...) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.67 Seed certifying agency standards and procedures. In order to qualify as a seed certifying agency for purposes of section 101(a)(25) of the Federal...
41 CFR 50-201.1 - The Walsh-Healey Public Contracts Act.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true The Walsh-Healey Public Contracts Act. 50-201.1 Section 50-201.1 Public Contracts and Property Management Other Provisions Relating... Walsh-Healey Public Contracts Act. The Walsh-Healey Public Contracts Act, as amended (41 U.S.C. 35-45...
37 CFR 201.28 - Statements of Account for digital audio recording devices or media.
2010-07-01
... digital audio recording devices or media. 201.28 Section 201.28 Patents, Trademarks, and Copyrights... of Account for digital audio recording devices or media. (a) General. This section prescribes rules... United States any digital audio recording device or digital audio recording medium. (b) Definitions. For...
37 CFR 201.27 - Initial notice of distribution of digital audio recording devices or media.
2010-07-01
... distribution of digital audio recording devices or media. 201.27 Section 201.27 Patents, Trademarks, and... Initial notice of distribution of digital audio recording devices or media. (a) General. This section..., any digital audio recording device or digital audio recording medium in the United States. (b...
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Corrections and amplifications of copyright registrations; applications for supplementary registration. 201.5 Section 201.5 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES...
22 CFR 201.15 - U.S. flag vessel shipping requirements.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false U.S. flag vessel shipping requirements. 201.15... for USAID Financing § 201.15 U.S. flag vessel shipping requirements. (a) General requirements. Unless... vessels are not available does not carry with it the authorization for USAID to finance freight on a...
30 CFR 243.201 - How will MMS determine if I am financially solvent?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How will MMS determine if I am financially solvent? 243.201 Section 243.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial...
Effect of procainamide, lidocaine and diphenylhydantoin on thallium-201 chloride uptake
Energy Technology Data Exchange (ETDEWEB)
Schachner, E.R.; Oster, Z.H.; Sacker, D.F.; Som, P.; Atkins, H.L.
1987-01-01
The effect of procainamide, lidocaine and diphenylhydantoin on the organ distribution (particularly the heart) of /sup 201/Tl chloride in rats was studied. The results show that diphenylhydantoin significantly decreases the uptake of /sup 201/Tl chloride in several organs of rats previously treated with this drug. No statistically significant effects were noted with procainamide and lidocaine.
20 CFR 25.201 - How is the Special Schedule applied for employees in Australia?
2010-04-01
... employees in Australia? 25.201 Section 25.201 Employees' Benefits OFFICE OF WORKERS' COMPENSATION PROGRAMS... How is the Special Schedule applied for employees in Australia? (a) The special schedule of compensation established by subpart B of this part shall apply in Australia with the modifications or additions...
45 CFR 201.10 - Review of State and local administration.
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false Review of State and local administration. 201.10 Section 201.10 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS TO STATES FOR PUBLIC ASSISTANCE PROGRAMS...
21 CFR 201.1 - Drugs; name and place of business of manufacturer, packer, or distributor.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs; name and place of business of manufacturer, packer, or distributor. 201.1 Section 201.1 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF...) molding, (5) lyophilizing, (6) tableting, (7) encapsulating, (8) coating, (9) sterilizing, and (10...
40 CFR 272.201 - Arkansas State-administered program: Final authorization.
2010-07-01
... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Arkansas State-administered program: Final authorization. 272.201 Section 272.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...-7-308(4). (iii) Arkansas Department of Pollution Control and Ecology (ADPC&E) Regulation No. 23...
37 CFR 201.24 - Warning of copyright for software lending by nonprofit libraries.
2010-07-01
... software lending by nonprofit libraries. 201.24 Section 201.24 Patents, Trademarks, and Copyrights... copyright for software lending by nonprofit libraries. (a) Definition. A Warning of Copyright for Software... required by that paragraph, the “Warning of Copyright for Software Rental” shall be affixed to the...
7 CFR 205.201 - Organic production and handling system plan.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Organic production and handling system plan. 205.201... Requirements § 205.201 Organic production and handling system plan. (a) The producer or handler of a production... ingredients or food group(s))” must develop an organic production or handling system plan that is agreed to by...
49 CFR 178.318 - Specification MC 201; container for detonators and percussion caps.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Specification MC 201; container for detonators and percussion caps. 178.318 Section 178.318 Transportation Other Regulations Relating to Transportation PIPELINE....318 Specification MC 201; container for detonators and percussion caps. ...
42 CFR 1001.201 - Conviction relating to program or health care fraud.
2010-10-01
... 42 Public Health 5 2010-10-01 2010-10-01 false Conviction relating to program or health care fraud. 1001.201 Section 1001.201 Public Health OFFICE OF INSPECTOR GENERAL-HEALTH CARE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OIG AUTHORITIES PROGRAM INTEGRITY-MEDICARE AND STATE HEALTH CARE PROGRAMS...
2011-03-08
... (FIPS) 201-2, Personal Identity Verification of Federal Employees and Contractors Standard, Request for... Processing Standard (FIPS) Publication 201-2, ``Personal Identity Verification of Federal Employees and..., removal of conflicting requirements, additional text to improve clarity, adaptation to changes in the...
40 CFR 1042.201 - General requirements for obtaining a certificate of conformity.
2010-07-01
... certificate of conformity. 1042.201 Section 1042.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... of conformity. (a) You must send us a separate application for a certificate of conformity for each engine family. A certificate of conformity is valid starting with the indicated effective date, but it is...
40 CFR 1045.201 - What are the general requirements for obtaining a certificate of conformity?
2010-07-01
... obtaining a certificate of conformity? 1045.201 Section 1045.201 Protection of Environment ENVIRONMENTAL... obtaining a certificate of conformity? Engine manufacturers must certify their engines with respect to the... conformity: (a) You must send us a separate application for a certificate of conformity for each engine...
40 CFR 1039.201 - What are the general requirements for obtaining a certificate of conformity?
2010-07-01
... obtaining a certificate of conformity? 1039.201 Section 1039.201 Protection of Environment ENVIRONMENTAL... obtaining a certificate of conformity? (a) You must send us a separate application for a certificate of conformity for each engine family. A certificate of conformity is valid from the indicated effective date...
36 CFR 223.201 - Limitations on unprocessed timber harvested in Alaska.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Limitations on unprocessed timber harvested in Alaska. 223.201 Section 223.201 Parks, Forests, and Public Property FOREST SERVICE...) Permit the salvage of timber damaged by wind, insects, fire or other catastrophe, (d) Bring into use a...
7 CFR 201.65 - Noxious weed seeds in interstate commerce.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious weed seeds in interstate commerce. 201.65... ACT FEDERAL SEED ACT REGULATIONS Tolerances § 201.65 Noxious weed seeds in interstate commerce. Tolerances for rates of occurrence of noxious-weed seeds shall be recognized and shall be applied to the...
7 CFR 201.17 - Noxious-weed seeds in the District of Columbia.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Noxious-weed seeds in the District of Columbia. 201.17... ACT FEDERAL SEED ACT REGULATIONS Labeling Agricultural Seeds § 201.17 Noxious-weed seeds in the District of Columbia. (a) Noxious-weed seeds in the District of Columbia are: Quackgrass (Elytrigia repens...
Threonine 201 in the diiron enzyme toluene 4-monooxygenase is not required for catalysis.
Pikus, J D; Mitchell, K H; Studts, J M; McClay, K; Steffan, R J; Fox, B G
2000-02-01
The diiron enzyme toluene 4-monooxygenase from Pseudomonas mendocina KR1 catalyzes the NADH- and O(2)-dependent hydroxylation of toluene. A combination of sequence alignments and spectroscopic studies indicate that T4MO has an active site structure closely related to the crystallographically characterized methane monooxygenase hydroxylase. In the methane monooxygenase hydroxylase, active site residue T213 has been proposed to participate in O(2) activation by analogy to certain proposals made for cytochrome P450. In this work, mutagenesis of the comparable residue in the toluene 4-monooxygenase hydroxylase, T201, has been used to investigate the role of an active site hydroxyl group in catalysis. Five isoforms (T201S, T201A, T201G, T201F, and T201K) that retain catalytic activity based on an in vivo indigo formation assay were identified, and detailed characterizations of the purified T201S, T201A, and T201G variants are reported. These isoforms have k(cat) values of 1.2, 1.0, and 0.6 s(-)(1), respectively, and k(cat)/K(M) values that vary by only approximately 4-fold relative to that of the native isoform. Moreover, these isoforms exhibit 80-90% coupling efficiency, which also compares favorably to the >94% coupling efficiency determined for the native isoform. For the T201S, T201A, and T201G isoforms, the regiospecificity of toluene hydroxylation was nearly identical to that of the natural isoform, with p-cresol representing 90-95% of the total product distribution. In contrast, the T201F isoform caused a substantial shift in the product distribution, and gave o- and p-cresol in a 1:1 ratio. In addition, the amount of benzyl alcohol was increased approximately 10-fold with the T201F isoform. For reaction with p-xylene, previous studies have shown that the native isoform reacted to give 4-methybenzyl alcohol and 2, 5-dimethylphenol in a 4:1 ratio [Pikus, J. D., Studts, J. M., McClay, K., Steffan, R. J., and Fox, B. G. (1997) Biochemistry 36, 9283-9289]. For
Energy Technology Data Exchange (ETDEWEB)
Elkadri, N.; Slim, I.; Blondet, C.; Choquet, Ph.; Constantinesco, A. [Hopital Hautepierre, Service de Biophysique et Medecine Nucleaire, 67 - Strasbourg (France); Lecocq, J. [Hopital Hautepierre, Service de Medecine Physique et Readaptation, 67 - Strasbourg (France)
2004-06-01
Leg {sup 201}Tl-SPECT in chronic exertional compartment syndrome Background: The chronic exertional compartment syndrome is one of the most frequent origins regarding leg pain due to sport training. The diagnosis can be established by invasive compartment pressure measurement. The aim of this study is to evaluate the role that could have {sup 201}Tl-SPECT for patients with suspicion of compartment syndrome. Patients and methods: 51 leg {sup 201}Tl-SPECT exams were performed (exercise - and rest without reinjection) in 49 patients; 28 had compartment syndrome confirmed by pressure measurement. About 100 MBq of {sup 201}Tl were injected during exercise, when pain appeared or at least after 25 minutes exercise. We studied mean percentages of level uptake for each compartment, referred to the maximal uptake of both legs. Results: 47 compartments were concerned by compartment syndrome and 361 compartments were not. Scintigraphic patterns in compartments are reversible ischaemia (45%), uptake stability (36%) or reverse redistribution (19%); these patterns are not linked to compartment syndrome. However, there is a significant difference of rest {sup 201}Tl level uptake between compartments with and without compartment syndrome and a significant correlation between muscular pressure measurement and rest level uptake. Conclusion: {sup 201}Tl-SPECT shows that only ischaemia does not explain compartment syndrome. Moreover, it allows to predict pressure variation during exercise but it does not offer any interest in order to select patients for muscular invasive pressure measurement. (author)
2010-01-01
... Crossarms (Solid and Laminated), Transmission Timbers and Pole Keys. 1728.201 Section 1728.201 Agriculture... ELECTRIC STANDARDS AND SPECIFICATIONS FOR MATERIALS AND CONSTRUCTION § 1728.201 RUS Bulletin 1728H-701, RUS Specification for Wood Crossarms (Solid and Laminated), Transmission Timbers and Pole Keys. (a) General...
2010-07-01
... pertaining to computer shareware and donation of public domain computer software. 201.26 Section 201.26... GENERAL PROVISIONS § 201.26 Recordation of documents pertaining to computer shareware and donation of public domain computer software. (a) General. This section prescribes the procedures for submission of...
2011-11-28
... Upgrade of FMVSS No. 201, Upper-Interior Components AGENCY: National Highway Traffic Safety Administration... Standard 201, Occupant Protection in Interior Impact. The report's title is: Evaluation of the 1999-2003 Head Impact Upgrade of FMVSS No. 201-- Upper-Interior Components: Effectiveness of Energy-Absorbing...
2010-01-01
... PROCEDURES Paperwork Reduction Act Control Numbers § 11.201 Office of Management and Budget (OMB) control... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Office of Management and Budget (OMB) control numbers assigned under the Paperwork Reduction Act. 11.201 Section 11.201 Aeronautics and Space...
Brain abscess uptake at TI-201 brain SPECT
Energy Technology Data Exchange (ETDEWEB)
Lee, Won Hyoung; Han, Eun Ji; Yoo, Ie Ryung; Chung, Yong An; Sohn, Hyung Sun; Kim, Sung Hoon; Chung, Soo Kyo; Choi, Yeong Jin [The Catholic University of Korea, Seoul (Korea, Republic of)
2007-08-15
A 22-year-old woman with a history of acute lymphoblastic leukemia was hospitalized for headache and vomiting CT scan showed a well-defined, ring like enhancing mass in the left frontal lobe with surrounding edema and midline shift. Magnetic resonance imaging demonstrated a round homogeneous mass with a ring of enhancement in the left frontal lobe. TI-201 brain SPECT showed increased focal uptake coinciding with the CT and MRI abnormality. Aspiration of the lesion performed through a burr hole yielded many neutrophils, a few lymphocytes and histiocytes with some strands of filamentous microorganism-like material. Modified AFB stained negative for norcardia. Gram stain showed a few white blood cells and no microorganism. Antibiotics were started and produced a good clinical response. After one month, CT scan showed markedly reduction in size and extent was observed.
S201 Catalog of Far-Ultraviolet Objects. Revised.
1982-05-06
constellation name and the field center coordinates. The errors in position of the detected (Continued) DO IOR. 1473 EDITION OF I NOV as iS OSOLETE S/N 0102...0 p. ~1 A, .t .. -. Fig. lOb - S201 starfield photograph ( Aquarius -Geocorona). frame A156 (iCa. 10-mm exposure) 21 A ~ A - ~’ PAGE, CARRUTHERS, AND...Is 1.5 220 20-28 159 24 149 4.1 Ca 260.96 -59.08 -70.16 15 1.7 296 25-35 197 27 Total 895 (281) (39) Aquarius (geocorona) A1S0 1/4 Li 344.26 -05.16
Energy Technology Data Exchange (ETDEWEB)
Chida, Kouji; Sugiura, Masaya; Ohkawa, Shin-ichiro
1987-05-01
In a series of 1,000 consecutive autopsy cases, we evaluated the clinical utility of thallium-201 (Tl-201) myocardial scintigraphy and electrocardiography (ECG) in 101 patients who had been studied while alive. Fifty-five cases had myocardial infarctions (MI) at autopsy. The Tl-201 scintigram and ECG in diagnosis of MI showed sensitivities of 68 % and 60 %, specificities of 87 % and 83 %, and diagnostic accuracies of 76 % and 70 %, respectively. The sensitivity of the Tl-201 scintigram was 70 % in anterior MI, 80 % in postero-inferior MI, 25 % in lateral and subendocardial infarction. The sensitivity was 88 % for large massive MI, but was low in scattered (50 %) or middle-sized MI (17 %). The diagnostic limit of the resolution of Tl-201 scintigrams was 4.5 cm in long diameter. All 8 cases with MI of less than 4 cm could not be diagnosed with the technique. There were 48 cases of large MI (more than 5 cm), but 8 cases could not be diagnosed by scintigraphy because of non-transmural or scattered MI. A comparison of the Tl-201 scintigram and ECG showed that 27 cases out of 60 cases were diagnosed by both methods, 14 only by the Tl-201 scintigram, 9 only by ECG and 10 by neither method.
Codon 201Gly Polymorphic Type of the DCC Gene is Related to Disseminated Neuroblastoma
Directory of Open Access Journals (Sweden)
Xiao-Tang Kong
2001-01-01
Full Text Available The deleted in colorectal carcinoma (DCC gene is a potential tumor- suppressor gene on chromosome 18821.3. The relatively high frequency of loss of heterozygosity (LOH and loss of expression of this gene in neuroblastoma, especially in the advanced stages, imply the possibility of involvement of the DCC gene in progression of neuroblastoma. However, only few typical mutations have been identified in this gene, indicating that other possible mechanisms for the inactivation of this gene may exist. A polymorphic change (Arg to Gly at DCC codon 201 is related to advanced colorectal carcinoma and increases in the tumors with absent DCC protein expression. In order to understand whether this change is associated with the development or progression of neuroblastoma, we investigated codon 201 polymorphism of the DCC gene in 102 primary neuroblastomas by polymerase chain reaction single-strand conformation polymorphism. We found no missense or nonsense mutations, but a polymorphic change from CGA (Arg to GGA (Gly at codon 201 resulting in three types of polymorphism: codon 201Gly type, codon 201Arg/Gly type, and codon 201Arg type. The codon 201Gly type occurred more frequently in disseminated (stages IV and IVs neuroblastomas (72% than in localized (stages I, II, and III tumors (48% (P=.035, and normal controls (38% (P=.024. In addition, the codon 201Gly type was significantly more common in tumors found clinically (65% than in those found by mass screening (35% (P=.002. The results suggested that the codon 201Gly type of the DCC gene might be associated with a higher risk of disseminating neuroblastoma.
9 CFR 201.100 - Records to be furnished poultry growers and sellers.
2010-01-01
... STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Poultry-Packers and Live Poultry Dealers § 201.100 Records to be furnished...
9 CFR 201.44 - Market agencies to render prompt accounting for purchases on order.
2010-01-01
..., PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Accounts and Records § 201.44 Market agencies to render...
9 CFR 201.27 - Underwriter; equivalent in lieu of bonds; standard forms.
2010-01-01
... STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT General Bonding Provisions § 201.27 Underwriter; equivalent in lieu of bonds...
IPCC Fifth Assessment Report (AR5) Observed Climate Change Impacts Database, Version 2.01
National Aeronautics and Space Administration — The Intergovernmental Panel on Climate Change Fifth Assessment Report (AR5) Observed Climate Change Impacts Database, Version 2.01 contains observed responses to...
In vivo effects of radioactive properties of Tl-201 on human carbonic anhydrase activity
Sahin, Ali; Senturk, Murat
2017-04-01
Carbonic anhydrase (CA) is a family of metalloenzymes that requires Zn as a cofactor and catalyze the quick conversion of CO2 to HCO3- and H+. Inhibitors of the carbonic anhydrases (CAs) have medical usage of significant diseases such as glaucoma, epilepsy, gastroduodenal ulcers, acid-base disequilibria and neurological disorders. The most useful radioisotope, Tl-201, decays by electron capture, emitting Hg X-rays ( 70-80 keV), and photons of 135 and 167 keV in 10% total abundance. Therefore, it has good imaging characteristics without excessive patient radiation dose. It is the most popular isotope used for thallium 201 nuclear cardiac stress tests. In the present study, In vivo inhibitory effect of Tl-201 (Thallium-201) on human erythrocyte carbonic anhydrase (CA) activity were investigated.
5 CFR 890.201 - Minimum standards for health benefits plans.
2010-01-01
... SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES HEALTH BENEFITS PROGRAM Health Benefits Plans § 890.201... dentistry or cosmetic surgery, or both, limited to conditions arising after the effective date of coverage...
Role of Dopamine Receptors in the Anticancer Activity of ONC201
Directory of Open Access Journals (Sweden)
Christina Leah B. Kline
2018-01-01
Full Text Available ONC201/TIC10 is a first-in-class small molecule inducer of TRAIL that causes early activation of the integrated stress response. Its promising safety profile and broad-spectrum efficacy in vitro have been confirmed in Phase I/II trials in several advanced malignancies. Binding and reporter assays have shown that ONC201 is a selective antagonist of the dopamine D2-like receptors, specifically, DRD2 and DRD3. We hypothesized that ONC201’s interaction with DRD2 plays a role in ONC201’s anticancer effects. Using cBioportal and quantitative reverse-transcription polymerase chain reaction analyses, we confirmed that DRD2 is expressed in different cancer cell types in a cell type–specific manner. On the other hand, DRD3 was generally not detectable. Overexpressing DRD2 in cells with low DRD2 levels increased ONC201-induced PARP cleavage, which was preceded and correlated with an increase in ONC201-induced CHOP mRNA expression. On the other hand, knocking out DRD2 using CRISPR/Cas9 in three cancer cell lines was not sufficient to abrogate ONC201’s anticancer effects. Although ONC201’s anticancer activity was not dependent on DRD2 expression in the cancer cell types tested, we assessed the cytotoxic potential of DRD2 blockade. Transient DRD2 knockdown in HCT116 cells activated the integrated stress response and reduced cell number. Pharmacological antagonism of DRD2 significantly reduced cell viability. Thus, we demonstrate in this study that disrupting dopamine receptor expression and activity can have cytotoxic effects that may at least be in part due to the activation of the integrated stress response. On the other hand, ONC201’s anticancer activity goes beyond its ability to antagonize DRD2, potentially due to ONC201’s ability to activate other pathways that are independent of DRD2. Nevertheless, blocking the dopamine D1-like receptor DRD5 via siRNA or the use of a pharmacological antagonist promoted ONC201-induced anticancer activity.
Energy Technology Data Exchange (ETDEWEB)
Oshima, Motoo; Higashi, Shizuka; Yasukochi, Hiroshi [Teikyo Univ., Tokyo (Japan). Faculty of Medicine; Hayase, Shuhei
1995-03-01
In this study, the effect of coronary artery bypass grafting (CABG) in 35 patients (pts) (male 29, female 6) with fixed defects were evaluated before and one month after surgery using resting {sup 201}Tl SPECT. Nine pts (7 old myocardial infarction; OMI) had 2 vessel disease (VD) and 26 pts (19 OMI) had 3 VD. Pts ages ranged from 41 to 75 (mean 61.4{+-}8.4) years. All 35 pts were divided into 4 groups according to the results of {sup 201}Tl SPECT and left ventriculogram pre- and post-CABG. Thirteen pts who improved of both {sup 201}Tl SPECT and wall motion scores post-CABG were considered as hibernating myocardium (group I). Nine patients who improved of {sup 201}Tl SPECT score but no change of wall motion were group II. Seven pts who improved of wall motion but no change of {sup 201}Tl SPECT score were group III. Six pts who had no improvement of both {sup 201}Tl SPECT and wall motion scores were group IV and considered as myocardial infarction. (author).
Energy Technology Data Exchange (ETDEWEB)
Lee, Do Yun; Lee, Jong Doo; Cho, Seung Yun; Shim, Won Heum; Ha, Jong Won; Kim, Han Soo; Kwon, Hyuk Moon; Jang, Yang Soo; Chung, Nam Sik; Kim, Sung Soon [Yonsei University College of Medicine, Seoul (Korea, Republic of); Park, Chang Yun; Kim, Young Soo [Inje University College of Medicine, Seoul (Korea, Republic of)
1993-07-15
To compare the myocardial viability in patients suffering from total occlusion of the right coronary artery (RCA) with the angiographic collaterals, intracoronary injection of Thallium-201 (T1-201) was done to 14 coronary artery disease (CAD) patients (pts) with total occlusion of RCA and into four normal subjects for control. All 14 CAD pts had Grade 2 or 3 collateral circulations. There were 14 male and 4 females, and their ages ranged from 31 to 70 years. In nine pts, T1-201 was injected into left main coronary artery (LCA) (300 approx 350 mu Ci) to evaluate the myocardial viability of RCA territory through collateral circulations. The remaining five pts received T1-201 into RCA (200-250 mu Ci) because two had intraarterial bridging collaterals and three had previous successful PTCA. Planar and SPECT myocardial perfusion images were obtained 30 minutes, and four to five hours after T1-201 reinjection. Intravenous T1-201 reinjection (six pts) or {sup 99m}Tc-MIBI (two pts) were also performed in eight CAD pts. Intracoronary myocardial perfusion images were compared with intravenous T1-201(IV T1-201) images, EGG, and ventriculography. Intracoronary TI-201 images proved to be superior to that of IV T1-201 due to better myocardial to background uptake ratio and more effective in the detection of viable tissue. We also found that perfusion defects were smaller on intracoronary T1-201 images than those on the IV T1-201. All of the 14 CAD pts had either mostly viable myocardium (seven pts) or large area of T1-201 perfusion (seven pts) in RCA territory, however ventriculographic wall motion and ECG did not correlate well with intracoronary myocardial perfusion images. In conclusion, total RCA occlusion patients with well developed collateral circulation had large area of viable myocardial in the corresponding territory.
James, W. F.
1985-01-01
An experimental investigation was made to evaluate two nickel base alloys (Nickel-201 and Inconel-718) in three heat treated conditions. These conditions were: (1) annealed; (2) after thermal exposure simulating a braze cycle; and (3) after a thermal exposure simulating a braze cycle plus one operational lifetime of high temperature service. For the Nickel-201, two different braze cycle temperatures were evaluated. A braze cycle utilizing a lower braze temperature resulted in less grain growth for Nickel-201 than the standard braze cycle used for joining Nickel-201 to Inconel-718. It was determined, however, that Nickel-201, was marginal for temperatures investigated due to large grain growth. After the thermal exposures described above, the mechanical properties of Nickel-201 were degraded, whereas similar exposure on Inconel-718 actually strengthened the material compared with the annealed condition. The investigation included tensile tests at both room temperature and elevated temperatures, stress-rupture tests, and metallographic examination.
Dar, Pervaiz; Kalaivanan, Ramya; Sied, Nuru; Mamo, Bedaso; Kishore, Subodh; Suryanarayana, V V S; Kondabattula, Ganesh
2013-07-18
Despite significant advancements in modern vaccinology, inactivated whole virus vaccines for foot-and-mouth disease (FMD) remain the mainstay for prophylactic and emergency uses. Many efforts are currently devoted to improve the immune responses and protective efficacy of these vaccines. Adjuvants, which are often used to potentiate immune responses, provide an excellent mean to improve the efficacy of FMD vaccines. This study aimed to evaluate three oil adjuvants namely: Montanide ISA-201, ISA-206 (SEPPIC, France) and GAHOL (an in-house developed oil-adjuvant) for adjuvant potential in inactivated FMD vaccine. Groups of cattle (n=6) were immunized once intramuscularly with monovalent FMDV 'O' vaccine formulated in these adjuvants, and humoral (serum neutralizing antibody, IgG1 and IgG2) and cellular (lymphoproliferation) responses were measured. Montanide ISA-201 adjuvanted vaccine induced earlier and higher neutralizing antibody responses as compared to the two other adjuvants. All the adjuvants induced mainly serum IgG1 isotype antibody responses against FMDV. However, Montanide ISA-201 induced relatively higher IgG2 responses than the other two adjuvants. Lymphoproliferative responses to recall FMDV antigen were relatively higher with Montanide ISA-201, although not always statistically significant. On homologous FMDV challenge at 30 days post-vaccination, 100% (6/6) of the cattle immunized with Montanide-201 adjuvanted vaccine were protected, which was superior to those immunized with ISA-206 (66.6%, 4/6) or GAHOL adjuvanted vaccine (50%, 3/6). Virus replication following challenge infection, as determined by presence of the viral genome in oropharynx and non-structural protein serology, was lowest with Montanide ISA-201 adjuvant. Collectively, these results indicate that the Montanide ISA-201 adjuvanted FMD vaccine induces enhanced immune responses and protective efficacy in cattle. Copyright © 2013 Elsevier Ltd. All rights reserved.
Donepezil Plus Solifenacin (CPC-201) Treatment for Alzheimer's Disease.
Chase, Thomas N; Farlow, Martin R; Clarence-Smith, Kathleen
2017-04-01
Available cholinergic drugs for treating Alzheimer's disease (AD) provide modest symptomatic benefit. We hypothesized that co-administration of a peripheral anticholinergic to reduce dose-limiting adverse effects (AEs) would enable the safe/tolerable use of higher cholinesterase inhibitor doses and thus improve their antidementia efficacy. A modified single-blind, ascending-dose, phase IIa study of donepezil plus solifenacin (CPC-201) lasting 26 weeks was conducted in 41 patients with probable AD of moderate severity. Entry criteria included the use of donepezil at a dose of 10 mg/day during the preceding 3 months. The primary outcome measure was the maximum tolerated dose (MTD) of donepezil achieved (to protocol limit of 40 mg/day) when administered with the anticholinergic solifenacin 15 mg/day. Secondary measures included assessments of cognitive and global function, as well as of AEs. The mean ± SD donepezil MTD increased to 38 ± 0.74 mg/day (median 40 mg/day; p donepezil AE frequency, especially gastrointestinal, allowed this dose increase. There were no drug-related serious AEs or clinically significant laboratory abnormalities. At 26 weeks, Alzheimer's Disease Assessment Scale Cognitive Component scores in the efficacy evaluable population improved by 0.35 ± 0.85 points over baseline (p donepezil and 5.4 ± 0.84 points above historic placebo (both p donepezil AEs by co-administration of solifenacin allows the safe administration of substantially higher cholinesterase inhibitors doses that may augment cognitive and global benefits in patients with AD.
2010-01-01
... Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Accounts and Records § 201.45...
Evaluation of muscular lesions in connective tissue diseases: thallium 201 muscular scans
Energy Technology Data Exchange (ETDEWEB)
Guillet, G.; Guillet, J.; Sanciaume, C.; Maleville, J.; Geniaux, M.; Morin, P.
1988-04-01
We performed thallium 201 muscle scans to assess muscular involvement in 40 patients with different connective tissue diseases (7 with dermatomyositis, 7 with systemic lupus erythematosus, 12 with progressive systemic scleroderma, 2 with calcinosis, Raynaud's phenomenon, esophageal involvement, sclerodactyly, and telangiectasia (CREST) syndrome, 3 with monomelic scleroderma, 6 with morphea, and 3 with Raynaud's disease). Only 12 of these patients complained of fatigability and/or myalgia. Electromyography was performed and serum levels of muscle enzymes were measured in all patients. Comparison of thallium 201 exercise recording with the other tests revealed that scan sensitivity is greater than electromyographic and serum muscle enzymes levels. Thallium 201 scans showed abnormal findings in 32 patients and revealed subclinical lesions in 18 patients, while electromyography findings were abnormal in 25 of these 32 patients. Serum enzyme levels were raised in only 8 patients. Thallium 201 scanning proved to be a useful guide for modifying therapy when laboratory data were conflicting. It was useful to evaluate treatment efficacy. Because our data indicate a 100% positive predictive value, we believe that thallium 201 scanning should be advised for severe systemic connective tissue diseases with discordant test results.
Energy Technology Data Exchange (ETDEWEB)
Nakazato, Masayasu; Maruoka, Yuji; Sunagawa, Osahiko; Kinjo, Kunihiko; Tomori, Masayuki; Fukiyama, Koshiro (Ryukyu Univ., Nishihara, Okinawa (Japan). School of Medicine)
1990-01-01
We performed exercise thallium-201 myocardial scintigraphy in 32 patients with angina pectoris to study the incidence of perfusion defects, who had no significant organic stenosis on coronary angiography. None of them had myocardial infarction or cardiomyopathy. Thallium-201 myocardial scintigraphy and 12-lead ECG recording were performed during supine bicycle ergometer exercise. Perfusion defects in thallium-201 scintigrams in SPECT images were assessed during visual analysis by two observers. In the coronary angiograms obtained during intravenous infusion of nitroglycerin, the luminal diameter of 75% stenosis or less in the AHA classification was regarded as an insignificant organic stenosis. Myocardial perfusion defects in the thallium-201 scintigrams were detected in eight (25%) of the 32 patients. Six of these eight patients had variant angina documented during spontaneous attacks with ST elevations in standard 12-lead ECGs. Perfusion defects were demonstrated at the inferior or infero-posterior regions in six patients, one of whom had concomitant anteroseptal defect. The defects were not always accompanied by chest pain. All but one patient demonstrating inferior or inferoposterior defects showed ST depression in leads II, III and aV{sub F} on their ECGs, corresponding to inferior wall ischemia. The exception was a case with right bundle branch block. Thus, 25% of the patients with angina pectoris, who had no evidence of significant organic stenosis on their coronary angiograms, exhibited exercise-induced perfusion defects in their thallium-201 scintigrams. Coronary spasms might have caused myocardial ischemia in these patients. (author).
Thallium-201 for cardiac stress tests: residual radioactivity worries patients and security.
Geraci, Matthew J; Brown, Norman; Murray, David
2012-12-01
A 47-year-old man presented to the Emergency Department (ED) in duress and stated he was "highly radioactive." There were no reports of nuclear disasters, spills, or mishaps in the local area. This report discusses the potential for thallium-201 (Tl-201) patients to activate passive radiation alarms days to weeks after nuclear stress tests, even while shielded inside industrial vehicles away from sensors. Characteristics of Tl-201, as used for medical imaging, are described. This patient was twice detained by Homeland Security Agents and searched after he activated radiation detectors at a seaport security checkpoint. Security agents deemed him not to be a threat, but they expressed concern regarding his health and level of personal radioactivity. The patient was subsequently barred from his job and sent to the hospital. Tl-201 is a widely used radioisotope for medical imaging. The radioactive half-life of Tl-201 is 73.1h, however, reported periods of extended personal radiation have been seen as far out as 61 days post-administration. This case describes an anxious, but otherwise asymptomatic patient presenting to the ED with detection of low-level personal radiation. Documentation should be provided to and carried by individuals receiving radionuclides for a minimum of five to six half-lives of the longest-lasting isotope provided. Patients receiving Tl-201 should understand the potential for security issues; reducing probable tense moments, confusion, and anxiety to themselves, their employers, security officials, and ED staff. Copyright © 2012 Elsevier Inc. All rights reserved.
2010-01-01
... or legal entity is actively engaged in farming. 1400.201 Section 1400.201 Agriculture Regulations of... person or legal entity is actively engaged in farming. (a) To be considered eligible to receive payments with respect to a particular farming operation, a person or legal entity must be actively engaged in...
19 CFR 201.36 - Closing a portion or portions of a meeting or a series of meetings.
2010-04-01
... series of meetings. 201.36 Section 201.36 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION...: (i) Interfere with enforcement proceedings, (ii) deprive a person of a right to a fair trial or to an... identity of a confidential source, and, in the case of a record compiled by a criminal law-enforcement...
2010-01-01
... of by packers, swine contractors, live poultry dealers, stockyard owners, market agencies, and dealers. 201.94 Section 201.94 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND...
2010-01-01
... of naval stores and drum containers of rosin. 160.201 Section 160.201 Agriculture Regulations of the... Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) NAVAL STORES REGULATIONS AND STANDARDS FOR NAVAL STORES... of naval stores and drum containers of rosin. Except as provided in § 160.204, the following fees...
21 CFR 201.323 - Aluminum in large and small volume parenterals used in total parenteral nutrition.
2010-04-01
... used in total parenteral nutrition. 201.323 Section 201.323 Food and Drugs FOOD AND DRUG ADMINISTRATION... parenteral nutrition. (a) The aluminum content of large volume parenteral (LVP) drug products used in total parenteral nutrition (TPN) therapy must not exceed 25 micrograms per liter (µg/L). (b) The package insert of...
2010-07-01
... infringement of works consisting of sounds, images, or both. 201.22 Section 201.22 Patents, Trademarks, and... Advance notices of potential infringement of works consisting of sounds, images, or both. (a) Definitions... after the first fixation of a work consisting of sounds, images, or both that is first fixed...
2010-04-01
... available concerning the use of the drug in other specified subpopulations (e.g., renal or hepatic... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Specific requirements on content and format of labeling for human prescription drug and biological products described in § 201.56(b)(1). 201.57 Section...
48 CFR 915.201 - Exchanges with industry before receipt of proposals. (DOE coverage-paragraph (e)).
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Exchanges with industry before receipt of proposals. (DOE coverage-paragraph (e)). 915.201 Section 915.201 Federal Acquisition... proposals. (DOE coverage—paragraph (e)). (e) Approval for the use of solicitations for information or...
2010-04-01
... sodium phosphates shall contain the following directions in boldface type immediately preceding the..., warnings, and directions for over-the-counter sale. 201.307 Section 201.307 Food and Drugs FOOD AND DRUG... directions for over-the-counter sale. (a) Reports in the medical literature and data accumulated by the Food...
47 CFR 95.201 - (R/C Rule 1) What is the Radio Control (R/C) Radio Service?
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false (R/C Rule 1) What is the Radio Control (R/C) Radio Service? 95.201 Section 95.201 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PERSONAL RADIO SERVICES Radio Control (R/C) Radio Service General...
DEFF Research Database (Denmark)
Charabi, Samih Ahmed; Lassen, N A; Thomsen, J
1997-01-01
Thallium chloride 201Tl combined with SPECT was performed in a series of 29 patients with neuroradiological evidence of vestibular schwannoma (VS). The relative tumor uptake (U) and relative tumor concentration (C) of the radiotracer 201Tl was determined, and the cerebellum served as a reference...
2010-07-01
... certain noncommercial performances of nondramatic literary or musical works. 201.13 Section 201.13 Patents... preventing the noncommercial performance of a nondramatic literary or musical work under certain... musical work or works, to the performance of which the copyright owner thereof is lodging objection; a...
2010-04-01
... tribe's agricultural resource management plan? 162.201 Section 162.201 Indians BUREAU OF INDIAN AFFAIRS... Must agricultural land be managed in accordance with a tribe's agricultural resource management plan... and objectives in any agricultural resource management plan developed by the tribe, or by us in close...
Energy Technology Data Exchange (ETDEWEB)
Songy, B. [Service de medecine et imagerie nucleaire, centre cardiologique du Nord (CCN), 93 - Saint-Denis (France)
2010-08-15
Myocardial perfusion imaging is widely used for management of coronary artery disease. However, it suffers from technical limitations. New cardiac cameras using CZT detectors are now available and increase spatial (x2) and energy (x2) resolutions and photons sensitivity (x5). We describe here the General Electric Discovery NM 530c new camera and summarize the validation studies with technetium agents and with thallium 201, protocols to reduce doses, ultrafast protocols and perspectives offered with this new technology. (author)
9 CFR 201.34 - Termination of market agency, dealer and packer bonds.
2010-01-01
... PACKERS AND STOCKYARDS ACT Market Agency, Dealer and Packer Bonds § 201.34 Termination of market agency... bond filed by a market agency who clears other registrants who are named in the bond shall contain a... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Termination of market agency, dealer...
9 CFR 201.29 - Market agencies, packers and dealers required to file and maintain bonds.
2010-01-01
... REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Market Agency, Dealer and Packer Bonds § 201.29 Market agencies, packers and dealers required to file and maintain bonds. (a) Every market agency, packer, and... effect a bond complying with the regulations in this part. (b) Every market agency buying on a commission...
9 CFR 201.31 - Conditions in market agency, dealer and packer bonds.
2010-01-01
... PACKERS AND STOCKYARDS ACT Market Agency, Dealer and Packer Bonds § 201.31 Conditions in market agency, dealer and packer bonds. Each market agency, dealer and packer bond shall contain conditions applicable... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Conditions in market agency, dealer...
9 CFR 201.108-1 - Instructions for weighing live poultry.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Instructions for weighing live poultry... STOCKYARDS ACT Poultry-Packers and Live Poultry Dealers § 201.108-1 Instructions for weighing live poultry. Live poultry dealers who operate scales on which live poultry is weighed for purposes of purchase, sale...
7 CFR 767.201 - Real estate inventory property with important resources.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Real estate inventory property with important... SERVICE AGENCY, DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS INVENTORY PROPERTY MANAGEMENT Real Estate Property With Important Resources or Located in Special Hazard Areas § 767.201 Real estate inventory...
2013-09-05
...-2 offers fingerprint biometric and iris recognition for general-purpose physical access control... commenter requested that the Standard prohibit the long-term storage of biometric data. Response: FIPS 201-2 does not require the long-term storage of biometric data. However, PIV Card maintenance processes, such...
22 CFR 201.73 - Limitations on the responsibilities of banks.
2010-04-01
... banks issuing, advising, or confirming letters of credit and making payments under letters of credit or... accepted by the bank in the ordinary course of business in good faith. Except as may be required in the... this part 201, the letter of commitment, or any other implementing document, or may be inconsistent...
21 CFR 201.316 - Drugs with thyroid hormone activity for human use; required warning.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Drugs with thyroid hormone activity for human use... Drug Products § 201.316 Drugs with thyroid hormone activity for human use; required warning. (a) Drugs with thyroid hormone activity have been promoted for, and continue to be dispensed and prescribed for...
Genotoxic and mutagenic effects of the diagnostic use of thallium-201 in nuclear medicine
Energy Technology Data Exchange (ETDEWEB)
Kelsey, K.T. (Harvard School of Public Health, Boston, MA (United States)); Donohoe, K.J. (Beth Israel Hospital, Boston, MA (United States). Div. of Nuclear Medicine); Baxter, Barbara; Memisoglu, Asli; Little, J.B.; Caggana, Michele; Liber, H.L. (Harvard School of Public Health, Boston, MA (United States))
1991-07-01
In order to investigate possible mutagenetic effects of in vivo exposure to low levels of ionizing radiation used in nuclear medicine, the authors examined hypoxanthine guanine phosphoribosyl transferase (hprt) mutant fraction (MF) and chromosome aberration (CA) frequency in 24 nuclear medicine patients before and after injection of thallium-201. The mean MF of the thallium-201-exposed cohort was 5.2{+-}4.4 x 10{sup -6} before injection exposure. No significant difference in MF was observed 24 h later. In 11 patients who were studied on a 3rd occasion, 30 days after thallium-201 exposure, there was again no significant difference in post-exposure as compared with the pre-exposure MF. The frequency of CA in peripheral blood lymphocytes was not significantly different, comparing pre- and 24h to 1 month post-radionuclide exposure . Thus, thallium-201 exposure was not associated with significant elevations in MF or CA frequency in lymphocytes of exposed individuals. (author). 40 refs.; 3 tabs.
14 CFR 121.201 - Nontransport category airplanes: En route limitations: One engine inoperative.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Nontransport category airplanes: En route...: CERTIFICATION AND OPERATIONS OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Airplane Performance Operating Limitations § 121.201 Nontransport category airplanes: En route limitations: One engine...
49 CFR 1540.201 - Applicability and terms used in this subpart.
2010-10-01
...) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY CIVIL AVIATION SECURITY: GENERAL RULES Security Threat Assessments § 1540.201 Applicability and terms used in this subpart... have security threat assessments performed on certain individuals pursuant to 49 CFR 1522.121, 1544.228...
7 CFR 201.33 - Seed in bulk or large quantities; seed for cleaning or processing.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Seed in bulk or large quantities; seed for cleaning or... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Labeling in General § 201.33 Seed in bulk or large quantities; seed for cleaning or processing. (a) In the case of seed in bulk, the information required under...
29 CFR 780.201 - Meaning of “forestry or lumbering operations.”
2010-07-01
... STANDARDS ACT Agriculture as It Relates to Specific Situations Forestry Or Lumbering Operations § 780.201 Meaning of “forestry or lumbering operations.” The term “forestry or lumbering operations” refers to the... and in part 788 of this chapter which considers the section 13(a)(13) exemption for forestry or...
9 CFR 201.82 - Care and promptness in weighing and handling livestock and live poultry.
2010-01-01
..., PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Services § 201.82 Care and promptness in weighing and handling livestock and live poultry. (a) Each stockyard owner, market agency, dealer, packer and live...
9 CFR 201.96 - Unauthorized disclosure of business information prohibited.
2010-01-01
... STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT General § 201.96 Unauthorized disclosure of business information prohibited. No agent or employee of the United States shall, without the consent of the stockyard owner, market agency...
9 CFR 201.71 - Scales; accurate weights, repairs, adjustments or replacements after inspection.
2010-01-01
... INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Services § 201.71 Scales; accurate weights, repairs, adjustments or replacements after inspection. (a) All scales used by stockyard owners, swine...
Energy Technology Data Exchange (ETDEWEB)
Watanabe, Motohiro; Gotoh, Kohshi; Nagashima, Kenshi [Gifu Univ. (Japan). School of Medicine] (and others)
2001-02-01
The purpose of this study was to clarify which myocardial histological findings associated with dilated cardiomyopathy (DCM) are reflected in quantitative {sup 201}Tl myocardial SPECT. We obtained studied SPECT images from 21 patients with DCM 10 minutes and 2 hours after they received an injection of 111 MBq {sup 201}Tl at rest. We calculated the percent coefficient of variation of myocardial {sup 201}Tl counts [%CV(Tl)], the washout rate (WR), standard deviation of WR [SD(WR)], extent score (ES) and severity score (SS). We used image analysis to measure % fibrosis, % myocytes, the ratio of fibrous tissue to myocyte tissue (F/My), myocyte size and standard deviation of myocyte size [SD(My)] in left ventricular endomyocardial biopsy specimens. The %CV(Tl) was correlated with % fibrosis and F/My. The ES and SS also correlated with F/My. The correlation between SD(WR) and SD(My) was significant. The present findings suggest that %CV(Tl), ES and SS of rest {sup 201}Tl SPECT reflect myocardial fibrosis and that the standard deviation of washout reflects the distribution of myocyte size. (author)
2018 : tööstust veavad keskkond ja tervis / Ain Alvela
Alvela, Ain, 1967-
2008-01-01
Arengufondi foorumil "Tööstusvedurid 2018" tõdeti, et kümne aasta pärast peab Eesti majandus olulises osas toetuma töötlevale tööstusele. Kommenteerivad: Arvo Kivikas, Heikki Mäki ja Jaanus Purga
Maailmas edukas ja koduselt armas Eesti aastal 2018 / Ott Pärna
Pärna, Ott, 1976-
2010-01-01
Eesti seisab küsimuste ees, kuhu ja kuidas edasi. Arengufond on algatanud diskussiooni teemal "Eesti kasvuvisioon 2018", selleks aastaks peavad olema tehtud olulised muutused. Arengufoorumil "Maailmas edukas ja koduselt armas Eesti" tehakse esimene avalik ajurünnak visiooni poole
17 CFR 201.100 - Scope of the rules of practice.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Scope of the rules of practice... PRACTICE Rules of Practice General Rules § 201.100 Scope of the rules of practice. (a) Unless provided otherwise, these Rules of Practice govern proceedings before the Commission under the statutes that it...
9 CFR 201.67 - Packers not to own or finance selling agencies.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Packers not to own or finance selling... STOCKYARDS ACT Trade Practices § 201.67 Packers not to own or finance selling agencies. No packer subject to the Act shall have an ownership interest in, finance, or participate in the management or operation of...
49 CFR 373.201 - Receipts and bills of lading for freight forwarders.
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Receipts and bills of lading for freight... REGULATIONS RECEIPTS AND BILLS Freight Forwarders; Bills of Lading § 373.201 Receipts and bills of lading for freight forwarders. Each freight forwarder must issue the shipper a receipt or through bill of lading...
17 CFR 201.326 - Evidence: Presentation, rebuttal and cross-examination.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Evidence: Presentation... EXCHANGE COMMISSION RULES OF PRACTICE Rules of Practice Rules Regarding Hearings § 201.326 Evidence... present its case or defense by oral or documentary evidence, to submit rebuttal evidence, and to conduct...
Investigating Validity of Math 105 as Prerequisite to Math 201 among Undergraduate Students, Nigeria
Zakariya, Yusuf F.
2016-01-01
In this study, the author examined the validity of MATH 105 as a prerequisite to MATH 201. The data for this study was extracted directly from the examination results logic of the university. Descriptive statistics in form of correlations and linear regressions were used to analyze the obtained data. Three research questions were formulated and…
Vaessen; H.A.M.G.; Kamp; C.G.van de
1985-01-01
Onderzocht werden 201 duplicaten van evenzovele 24-uurs voedingen op gehalte aan chloride, natrium, kalium, calcium, magnesium, rubidium en lithium en hieruit werd de opname van deze elementen per persoon en per etmaal berekend. De gemiddelde opname bedroeg voor chloride 5,08 gram, voor natrium
2010-01-01
... prevent the legitimate application or enforcement of any valid bylaw, rule or regulation, or requirement... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Bylaws, rules and regulations, and... Applicability of Industry Rules § 201.4 Bylaws, rules and regulations, and requirements of exchanges...
24 CFR 201.28 - Flood and hazard insurance, and Coastal Barriers properties.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Flood and hazard insurance, and... Disbursement Requirements § 201.28 Flood and hazard insurance, and Coastal Barriers properties. (a) Flood... part if the property securing repayment of the loan is located in a special flood hazard area...
21 CFR 201.304 - Tannic acid and barium enema preparations.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Tannic acid and barium enema preparations. 201.304... Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished liver...
Effect of chemotherapy on survival of craniofacial osteosarcoma: a systematic review of 201 patients
Smeele, L. E.; Kostense, P. J.; van der Waal, I.; Snow, G. B.
1997-01-01
To evaluate the possible value of chemotherapy in the treatment of craniofacial osteosarcoma (CFOS). In a systematic review, data of 201 patients (age, 36.6 +/- 19.0 years [mean +/- SD]) from 20 uncontrolled series on CFOS indexed in Medline and Excerpta Medica between 1974 and 1994 were pooled; 180
21 CFR 201.300 - Notice to manufacturers, packers, and distributors of glandular preparations.
2010-04-01
... structure or any function of the body. (b) Manufacturers have heretofore taken advantage of § 201.100... function of the human body that they are intended to affect. Since any such representations offering these..., DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL LABELING Specific Labeling Requirements...
7 CFR 201.76 - Minimum Land, Isolation, Field, and Seed Standards.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Minimum Land, Isolation, Field, and Seed Standards... (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Certified Seed § 201.76 Minimum Land, Isolation, Field, and Seed Standards. In the following Table 5 the figures in the “Land” column indicate the number...
[Corrosion of stainless steel 201, 304 and 316L in the simulated sewage pipes reactor].
Bao, Guo-Dong; Zuo, Jian-E; Wang, Ya-Jiao; Gan, Li-Li
2014-08-01
The corrosion behavior of stainless steel 201, 304 and 316L which would be used as sewer in-situ rehabilitation materials was studied in the simulated sewage pipes reactor. The corrosion potential and corrosion rate of these three materials were studied by potentiodynamic method on the 7th, 14th, 21st, 56th day under two different conditions which were full immersion condition or batch immersion condition with a 2-day cycle. The electrode process was studied by Electrochemical Impedance Spectroscopy (EIS) on the 56th day. The microstructure and composition of the corrosion pitting were analyzed by Scanning Electron Microscope (SEM) and Energy Dispersive Spectrometer (EDS) on the 56th day. The results showed that 304 and 316L had much better corrosion resistance than 201 under both conditions. 304 and 316L had much smaller corrosion rate than 201 under both conditions. The corrosion resistance of all three kinds of stainless steel under the batch immersion condition was much better than those under the full immersion condition. The corrosion rate of all three kinds of stainless steel under the batch immersion condition was much smaller than those under the full immersion condition. Point pitting corrosion was formed on the surfaces of 304 and 316L. In comparison, a large area of corrosion was formed in the surface of 201.
31 CFR 560.803 - Customs procedures: Goods specified in § 560.201.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Customs procedures: Goods specified... REGULATIONS Procedures § 560.803 Customs procedures: Goods specified in § 560.201. (a) With respect to goods... Customs officers shall not accept or allow any: (1) Entry for consumption or warehouse (including any...
49 CFR 179.201-5 - Postweld heat treatment and corrosion resistance.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Postweld heat treatment and corrosion resistance....201-5 Postweld heat treatment and corrosion resistance. (a) Tanks and attachments welded directly... tested to demonstrate that they possess the corrosion resistance specified in § 179.200-7(d), Footnote 2...
49 CFR 397.201 - Purpose and scope of the procedures.
2010-10-01
...., formerly known as the Hazardous Materials Transportation Act. Administrator means the Federal Highway... highway transportation of hazardous materials over a specific highway route or portion of a route. State... TRANSPORTATION OF HAZARDOUS MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.201 Purpose and...
Effects of organic acids of different molecular size on phosphate removal by HZO-201 nanocomposite.
Lin, Bin; Hua, Ming; Zhang, Yanyang; Zhang, Weiming; Lv, Lu; Pan, Bingcai
2017-01-01
Various organic acids in wastewater effluent could significantly influence the performance of phosphate adsorbent. This study focused on the effects of organic acids of different-molecular-size on phosphate adsorption by a novel nanocomposite HZO-201. Three organic acids (gallic acid (GA), tannic acid (TA) and humic acid (HA)) with distinct molecular size (HA > TA > GA) were chosen for this purpose. Both isotherm and kinetic tests of phosphate adsorption were conducted in the single-phosphate and binary system, and a series of microscopic techniques (i.e., XPS, FT-IR and SEM-EDX) and N2 adsorption-desorption test were employed to explore the underlying mechanism. It was found that GA could greatly weaken phosphate adsorption capability of HZO-201 by directly competing for ammonium group on the nanocomposite, TA exhibited significant inhibition on phosphate adsorption rate mainly through pore constriction/blockage, while HA posed negligible impact on phosphate adsorption because of the size exclusion effect. It was also observed that although GA, TA and HA showed substantial influence on bulky HZO due to complexation, their impact on the nano-HZO loaded inside HZO-201 was little. The covalently bounded ammonium group and the networking pore structure of HZO-201 may play important roles in it. Copyright © 2016 Elsevier Ltd. All rights reserved.
Clinical features and applications of thallium-201. With reference to scintigraphy
Energy Technology Data Exchange (ETDEWEB)
Fujii, Tadashige
1988-12-01
Thallium-201 is not only used widely in myocardial imaging but also has a great potential in other various nuclear medicine imaging studies. This paper presents clinical features and applications of thallium-201, focusing on clinical trials with thallium-201 at the Shinshu University School of Medicine. Thallium-201 myocardial scintigraphy offers information on (1) ventricular position and morphology, (2) hypertrophy or dilatation of the left ventricle, (3) hypertrophy or dilatation of the right ventricle, (4) site and extent of myocardial ischemia and infarct, (5) myocardial blood flow, (6) pulmonary congestion or interstitial pulmonary edema, and (7) pericardial effusion. It can be used in the following evaluation or diagnosis: (1) acute or old myocardial infarction, (2) angina pectoris, (3) treatment strategy or prognosis of ischemic heart disease, (4) treatment strategy or observation of bypass graft or drug therapy, (5) hypertrophic or dilated idiopathic cardiomyopathy, (6) myocardial lesions induced by sarcoidosis, collagen disease, and neuro-muscular disease, (7) ventricular hypertrophy and pulmonary edema, and (9) pericarditis, pericardial effusion, and systolic pericarditis associated with underlying disease. The significance of tumor, liver, bone marrow scintigraphies is also referred to. (Namekawa, K) 69 refs.
MRI and thallium-201 SPECT in the prediction of survival in glioma
Energy Technology Data Exchange (ETDEWEB)
Vos, Maaike J. [VU University Medical Center, Department of Neurology, Amsterdam (Netherlands); Medical Center Haaglanden, Department of Neurology, PO Box 432, The Hague (Netherlands); Berkhof, Johannes [VU University Medical Center, Department of Epidemiology and Biostatistics, Amsterdam (Netherlands); Hoekstra, Otto S. [VU University Medical Center, Department of Nuclear Medicine and PET Research, Amsterdam (Netherlands); Bosma, Ingeborg; Sizoo, Eefje M.; Heimans, Jan J.; Reijneveld, Jaap C.; Postma, Tjeerd J. [VU University Medical Center, Department of Neurology, Amsterdam (Netherlands); Sanchez, Esther [VU University Medical Center, Department of Radiology, Amsterdam (Netherlands); Lagerwaard, Frank J. [VU University Medical Center, Department of Radiation Oncology, Amsterdam (Netherlands); Buter, Jan [VU University Medical Center, Department of Medical Oncology, Amsterdam (Netherlands); Noske, David P. [VU University Medical Center, Department of Neurosurgery and Neuro-Oncology Research Group, Amsterdam (Netherlands)
2012-06-15
This paper aims to study the value of MRI and Thallium 201 ({sup 201}Tl) single-photon emission computed tomography (SPECT) in the prediction of overall survival (OS) in glioma patients treated with temozolomide (TMZ) and to evaluate timing of radiological follow-up. We included patients treated with TMZ chemoradiotherapy for newly diagnosed glioblastoma multiforme (GBM) and with TMZ for recurrent glioma. MRIs and {sup 201}Tl SPECTs were obtained at regular intervals. The value of both imaging modalities in predicting OS was examined using Cox regression analyses. Altogether, 138 MRIs and 113 {sup 201}Tl SPECTs in 46 patients were performed. Both imaging modalities were strongly related to OS (P {<=} 0.02). In newly diagnosed GBM patients, the last follow-up MRI (i.e., after six adjuvant TMZ courses) and SPECT (i.e., after three adjuvant TMZ courses) were the strongest predictors of OS (P = 0.01). In recurrent glioma patients, baseline measurements appeared to be the most predictive of OS (P < 0.01). The addition of one imaging modality to the other did not contribute to the prediction of OS. Both MRI and {sup 201}Tl SPECT are valuable in the prediction of OS. It is adequate to restrict to one of both modalities in the radiological follow-up during treatment. In the primary GBM setting, MRI after six adjuvant TMZ courses contributes significantly to the prediction of survival. In the recurrent glioma setting, baseline MRI appears to be a powerful predictor of survival, whereas follow-up MRIs during TMZ seem to be of little additional value. (orig.)
Thallium-201 SPECT in the diagnosis of head and neck cancer.
Valdés Olmos, R A; Balm, A J; Hilgers, F J; Koops, W; Loftus, B M; Tan, I B; Muller, S H; Hoefnagel, C A; Gregor, R T
1997-06-01
The accuracy of SPECT with 201Tl-chloride for the diagnosis of primary tumors, lymph node metastases and recurrences in head and neck cancer was evaluated for clinical applicability. SPECT images, obtained 60 min after administration of 150 MBq 201Tl-chloride, were compared with clinical, CT and/or MRI and histology results. In addition, whole-body images were obtained to detect distant metastases. In 79 patients studied for primary tumors (principally larynix, hypopharynx, oropharynx, nasopharynx and oral cavity), 201Tl SPECT correctly identified 69 of 73 (95% versus 88% for CT/MRI) histologically confirmed malignancies including 63 squamous-cell carcinomas. The method localized four occult naso- and oropharynx carcinomas not seen on CT/MRI and was correctly negative in two patients without tumor and in three of four patients with no confirmed primary tumor in the head and neck. With respect to regional spread, only patients who had cervical lymph node dissection were evaluated, and the findings were recorded per side of the neck. Thallium-201 SPECT correctly identified metastases in 31 of 36 neck dissections with proven lymph node involvement (86%), was correctly negative in nine and false-positive in one. Although the sensitivity of CT/MRI was clearly higher (97%), considerably more false-positive cases affected its accuracy (81% versus 87% for SPECT). In 30 patients investigated for recurrences, 201Tl SPECT correctly identified 27 of 29 microscopically confirmed tumor sites (93%) and was correctly negative in seven. Sensitivity of CT/MRI was lower (76%), and a greater number of false-positives (seven versus three for SPECT) further decreased its accuracy (64% versus 87% for SPECT). Distant metastases were detected in five patients. Thallium-201 SPECT appears to be an accurate method for the diagnosis of head and neck cancer. The method is particularly useful for detection of occult head and neck tumors and for assessing recurrences. It also may be of
2010-01-01
... Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT General § 201.98 Packers and...
9 CFR 201.39 - Payment to be made to consignor or shipper by market agencies; exceptions.
2010-01-01
..., PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Proceeds of Sale § 201.39 Payment to be made to consignor or...
(-201) β-Gallium oxide substrate for high quality GaN materials
Roqan, Iman S.
2015-03-13
(-201) oriented β-Ga2O3 has the potential to be used as a transparent and conductive substrate for GaN-growth. The key advantages of Ga2O3 are its small lattice mismatches (4.7%), appropriate structural, thermal and electrical properties and a competitive price compared to other substrates. Optical characterization show that GaN layers grown on (-201) oriented β-Ga2O3 are dominated by intense bandedge emission with a high luminescence efficiency. Atomic force microscopy studies show a modest threading dislocation density of ~108 cm-2, while complementary Raman spectroscopy indicates that the GaN epilayer is of high quality with slight compressive strain. Room temperature time-findings suggest that the limitation of the photoluminescence lifetime (~500 ps) is due to nonradiative recombination arising from threading dislocation. Therefore, by optimizing the growth conditions, high quality material with significant optical efficiency can be obtained.
Couper, R T; Berzen, A; Berall, G; Sherman, P M
1989-01-01
A 27 month old girl with congenital microvillus atrophy received two courses of SMS 201-995, a synthetic long acting analogue of native somatostatin, in an attempt to decrease profuse secretory diarrhoea. During the first trial at 13 months of age fluid and electrolytes administered by parenteral infusion were decreased as measured by water and faecal electrolyte losses. During the second trial of SMS 201-995 at 19 months fluid and electrolyte input were held constant for 14 days. Stool volum...
Yeast Interacting Proteins Database: YKR037C, YDR201W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YKR037C SPC34 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...201W SPC19 Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...34 Bait description Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force...ription Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced
Energy Technology Data Exchange (ETDEWEB)
Owada, K.; Tsukahara, Y.; Kijima, M.; Miyazaki, Y.; Ono, K. (Fukushima Medical Coll. (Japan))
1982-03-01
Thallium-201 myocardial scintigraphy was performed in 44 patients with various heart diseases including mitral stenosis, atrial septal defect, primary pulmonary hypertension, and left atrial myxoma. The morphological findings of right ventricular (RV) free wall on the scintigram and RV/IVS (interventricular septum) uptake ratio of the images obtained from the left anterior oblique projection were studied in the patients with RV pressure or volume overloading.
POPDC1(S201F) causes muscular dystrophy and arrhythmia by affecting protein trafficking.
Schindler, Roland F R; Scotton, Chiara; Zhang, Jianguo; Passarelli, Chiara; Ortiz-Bonnin, Beatriz; Simrick, Subreena; Schwerte, Thorsten; Poon, Kar-Lai; Fang, Mingyan; Rinné, Susanne; Froese, Alexander; Nikolaev, Viacheslav O; Grunert, Christiane; Müller, Thomas; Tasca, Giorgio; Sarathchandra, Padmini; Drago, Fabrizio; Dallapiccola, Bruno; Rapezzi, Claudio; Arbustini, Eloisa; Di Raimo, Francesca Romana; Neri, Marcella; Selvatici, Rita; Gualandi, Francesca; Fattori, Fabiana; Pietrangelo, Antonello; Li, Wenyan; Jiang, Hui; Xu, Xun; Bertini, Enrico; Decher, Niels; Wang, Jun; Brand, Thomas; Ferlini, Alessandra
2016-01-01
The Popeye domain-containing 1 (POPDC1) gene encodes a plasma membrane-localized cAMP-binding protein that is abundantly expressed in striated muscle. In animal models, POPDC1 is an essential regulator of structure and function of cardiac and skeletal muscle; however, POPDC1 mutations have not been associated with human cardiac and muscular diseases. Here, we have described a homozygous missense variant (c.602C>T, p.S201F) in POPDC1, identified by whole-exome sequencing, in a family of 4 with cardiac arrhythmia and limb-girdle muscular dystrophy (LGMD). This allele was absent in known databases and segregated with the pathological phenotype in this family. We did not find the allele in a further screen of 104 patients with a similar phenotype, suggesting this mutation to be family specific. Compared with WT protein, POPDC1(S201F) displayed a 50% reduction in cAMP affinity, and in skeletal muscle from patients, both POPDC1(S201F) and WT POPDC2 displayed impaired membrane trafficking. Forced expression of POPDC1(S201F) in a murine cardiac muscle cell line (HL-1) increased hyperpolarization and upstroke velocity of the action potential. In zebrafish, expression of the homologous mutation (popdc1(S191F)) caused heart and skeletal muscle phenotypes that resembled those observed in patients. Our study therefore identifies POPDC1 as a disease gene causing a very rare autosomal recessive cardiac arrhythmia and LGMD, expanding the genetic causes of this heterogeneous group of inherited rare diseases.
Characterization of Pu-contaminated soils from Nuclear Site 201 at the Nevada Test Site
Energy Technology Data Exchange (ETDEWEB)
Lee, S.Y.; Tamura, T.; Larsen, I.L.
1983-01-01
Distribution and characteristics of Pu-bearing radioactive particles throughout five soil profiles from Nuclear Site (NS) 201 were investigated. Concentrations of /sup 239/ /sup 240/Pu and /sup 241/Am decreased with depth and most of the contamination was contained in the top 5 cm except in profile 4 where it extended to 10 cm. The mean activity ratio of /sup 239/ /sup 240/Pu to /sup 241/Am and its standard error were 5.8 +- 0.3 (N=42). Most of the total radioactivity of the soils was contributed by 0.25 to 2 mm sand size fraction which comprised 20 to 50% by weight of the soils. The radioactive particles in the 0.25 to 2 mm size fraction occurred as spherical glass particles or as glass coatings on sand particles. The glass coatings had gas voids in the matrix but were not as porous as the radioactive particles from NS 219. After impact grinding the >0.25-mm size fractions for one hour, 85% of the initial activity in a NS 201 sample remained with the particles on the 0.25 mm sieve, whereas in the NS 219 sample only 10% remained. The results show that the radioactive particles from NS 201 were much more stable against the impact grinding force than those from NS 219. Therefore, the NS 201 soils would be expected to have a lower probability of producing respirable-size radioactive particles by saltation during wind erosion. 19 references, 3 figures, 3 tables.
Kemper, C; Spaans, M; Jansen, DJ; Hogerheijde, MR; van Dishoeck, EF; Tielens, AGGM
1999-01-01
Infrared Space Observatory (ISO) CC nl 158 mu m, [O I] 63 mu m, and H-2 9 and 17 mu m observations are presented of the reflection nebula Ced 201, which is a photon-dominated region (PDR) illuminated by a B9.5 star with a color temperature of 10,000 K (a cool PDR). In combination with ground-based
Quantitative evaluation of thallium-201 myocardial scintigram in coronary artery diseases
Energy Technology Data Exchange (ETDEWEB)
Mikada, Ken-etsu (Akita Univ. (Japan). School of Medicine)
1992-11-01
Quantitative indices from circumferential profile curves of thallium-201 ([sup 201]Tl) myocardial scintigram were evaluated for diagnostic utility in coronary artery diseases (CAD). Myocardial [sup 201]Tl scintigrams with single photon emission computed tomography (SPECT) were obtained 5 minutes (early) and 4 hours (delayed) after exercise in 20 normal subjects and 66 cases of CAD, of which 20 were angina pectoris without myocardial infarction (AP), 14 were subendocardial infarction (non-QMI) and 32 were Q-wave infarction (QMI). Tl counts, %Tl uptake and washout ratio (WR) were measured in 81 segments (9 apical segments of the slice from the longitudinal axis and all 72 segments of two slices from the short axis). A mean early defect (MED), a mean delayed defect (MDD), a mean delta washout rate (MDR), and a [Sigma] delayed defect ([Sigma]DD) were calculated from the areas which were below the two standard deviations of the mean %Tl uptake in normal subjects. A mean filling-in (MFI) was calculated from the difference of the %Tl uptake between early and delayed curves in each patient. In patients with CAD, the MED and MFI were higher, but MDW was lower with a more severe coronary stenosis, indicating that these indices were useful to detect myocardial hypo-perfuion. In severely stenotic regions, the MDD was higher in QMI than in AP and non-QMI, indicating that the ratio of infarct to the myocardium in the region was higher in QMI. In QMI, [Sigma]DD correlated well (r=0.723) with Total Wall Motion Scores with two-dimentional echocardiography which was directly related with infarct size. Further, MED, MFI and MDW were improved after aortocoronary bypass only in patients with patent graft. It is concluded that this quantitative evaluation with [sup 201]Tl-SPECT can provide an objective and quantitative estimate of regional myocardial ischemia and infarct. (author).
Tank 241-T-201, core 192 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
Nuzum, J.L.
1997-08-07
This document is the final laboratory report for Tank 241-T-201. Push mode core segments were removed from Riser 3 between April 24, 1997, and April 25, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-T-201 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997), Letter of Instruction for Core Sample Analysis of Tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204 (LOI) (Bell, 1997), Additional Core Composite Sample from Drainable Liquid Samples for Tank 241-T-2 01 (ACC) (Hall, 1997), and Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT) or differential scanning calorimetry (DSC) analyses exceeded the notification limits stated in DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report.
Energy Technology Data Exchange (ETDEWEB)
Nienaber, C.A.; Spielmann, R.P.; Hausdorf, G.
1988-12-01
Thallium-201 tomographic perfusion studies after pharmacologic vasodilation were performed in seven children (aged 2 years 8 months to 8 years 7 months), 3 to 20 months after the acute stage of the disease. In all patients coronary aneurysms were seen on cross-sectional echocardiograms. The scintigrams of six children showed no significant regional reduction of myocardial thallium-201 uptake. These children had remained asymptomatic in the follow-up period after the acute inflammatory stage of Kawasaki disease. Persistent and transient thallium defects were present in one child with acute posterolateral myocardial infarction; obstruction of two coronary vessels supplying the defect zones was confirmed by contrast angiography. After 8 months of treatment a follow-up nuclear scan showed marked reduction in the size of the defect and almost complete abolishment of the ischemic reaction. Thus tomographic thallium-201 perfusion scintigraphy in conjunction with vasodilation stress is useful to assess myocardial perfusion in children with Kawasaki disease and demonstrates marked improvement in regional perfusion after adequate medical therapy.
Detection of human collateral circulation by vasodilation-thallium-201 tomography
Energy Technology Data Exchange (ETDEWEB)
Nienaber, C.A.; Salge, D.; Spielmann, R.P.; Montz, R.; Bleifeld, W. (University Hospital Eppendorf, Hamburg (Germany, F.R.))
1990-04-15
Coronary arteriolar vasodilation may provoke redistribution of flow to collateral-dependent jeopardized myocardium. To assess the physiologic significance of collaterals, 80 consecutive post-infarction patients (age 58 +/- 8 years) underwent vasodilation-redistribution thallium-201 tomographic imaging after administration of 0.56 mg of intravenous dipyridamole/kg body weight. Circumferential profile analysis of thallium-201 uptake and redistribution in representative left ventricular tomograms provided quantitative assessment of transient and fixed defects and separation between periinfarctional and distant inducible hypoperfusion. Tomographic perfusion data were correlated to wall motion and collateral circulation between distinct anatomic perfusion territories. Patients were grouped according to presence (59%) or absence (41%) of angiographically visible collateral channels to jeopardized myocardium. In the presence of collaterals, distant reversible defects were larger than in absence of collaterals (p less than 0.05); the extent of combined periinfarctional and distant redistribution was also larger in collateralized patients (p less than 0.025), whereas the size of the persistent perfusion defect was similar in both groups. By prospective analysis the tomographic perfusion pattern of combined periinfarctional and distant redistribution revealed a sensitivity of 85% and a specificity of 78% for the detection of significant collateral circulation in this group of patients. Thus, using the exhausted flow reserve as a diagnostic tool, vasodilation-thallium-201 tomography has the potential to identify and quantitate collateralized myocardium in post-infarction patients and may guide diagnostic and therapeutic decision-making.
Helium Pressure Shift of the Hyperfine Clock Transition in Hg-201(+)
Larigani, S. Taghavi; Burt, E. A.; Tjoelker, R. L.
2010-01-01
There are two stable odd isotopes of mercury with singly ionized hyperfine structure suitable for a microwave atomic clock: Hg-199(+) and Hg-201(+). We are investigating the viability of a trapped ion clock based on Hg-201(+) in a configuration that uses a buffer gas to increase ion loading efficiency and counter ion heating from rf trapping fields. Traditionally, either helium or neon is used as the buffer gas at approx. 10(exp -5) torr to confine mercury ions near room temperature. In addition to the buffer gas, other residual background gasses such as H2O, N2, O2, CO, CO2, and CH2 may be present in trace quantities. Collisions between trapped ions and buffer gas or background gas atoms/molecules produce a momentary shift of the ion clock transition frequency and constitute one of the largest systematic effects in this type of clock. Here we report an initial measurement of the He pressure shift in Hg-201(+) and compare this to Hg-199(+).
Ostrander, Elizabeth L; Koh, Won Kyun; Mallaney, Cates; Kramer, Ashley C; Wilson, W Casey; Zhang, Bo; Challen, Grant A
2018-01-01
Genome sequencing efforts have identified virtually all of the important mutations in adult myeloid malignancies. More recently, population studies have identified cancer-associated variants in the blood of otherwise healthy individuals as they age, a phenomenon termed clonal hematopoiesis of indeterminate potential (CHIP). This suggests that these mutations may occur in hematopoietic stem cells (HSCs) long before any clinical presentation but are not necessarily harbingers of transformation because only a fraction of individuals with CHIP develop hematopoietic pathologies. Delineation between CHIP variants that predispose for disease versus those that are more benign could be used as a prognostic factor to identify individuals at greater risk for transformation. To achieve this, the biological impact of CHIP variants on HSC function must be validated. One variant that has been identified recurrently in CHIP is a gain-of-function missense mutation in the imprinted gene GNAS (Guanine Nucleotide Binding Protein, Alpha Stimulating). In this study, we examined the effect of the GNASR201C variant on HSC function. Ectopic expression of GNASR201C supported transplantable HSC activity and improved lymphoid output in secondary recipients. Because declining lymphoid output is a hallmark of aging, GNASR201C mutations may sustain lymphoid-biased HSCs over time and maintain them in a developmental state favorable for transformation. Copyright © 2018 ISEH – Society for Hematology and Stem Cells. Published by Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Marshall, Robert C.; Powers-Risius, Patricia; Reutter, Bryan W.; O' Neil, James P.; La Belle, Michael; Huesman, Ronald H.; VanBrocklin, Henry F.
2004-03-01
The goal of this investigation was to assess the accuracy of 18F-fluorodihydrorotenone (18F-FDHR) as a new deposited myocardial flow tracer and compare the results to those for 201Tl. Methods. The kinetics of these flow tracers were evaluated in 22 isolated, erythrocyte- and albumin-perfused rabbit hearts over a flow range encountered in patients. The two flow tracers plus a vascular reference tracer (131I-albumin) were introduced as a bolus through a port just above the aortic cannula. Myocardial extraction, retention, washout, and uptake parameters were computed from the venous outflow curves using the multiple indicator dilution technique and spectral analysis. Results. The mean initial extraction fractions of 18F-FDHR (0.85 +- 0.07) and 201Tl (0.87 +- 0.05) were not significantly different, although the initial extraction fraction for 18F-FDHR declined with flow (P < 0.0001), whereas the initial extraction fraction of 201Tl did not. Washout of 201Tl was faster (P < 0.001) and more affected by flow (P < 0.05) than 18F-FDHR washout. Except for initial extraction fraction, 18F-FDHR retention was greater (P < 0.001) and less affected by flow (P < 0.05) than 201Tl retention. Reflecting its superior retention, net uptake of 18F-FDHR was better correlated with flow than 201Tl uptake at both one and fifteen minutes after tracer introduction (P < 0.0001 for both comparisons). Conclusion. The superior correlation of 18F-FDHR uptake with flow indicates that it is a better flow tracer than 201Tl in the isolated rabbit heart. Compared to the other currently available positron-emitting flow tracers (82Rb, 13N-ammonia, and 15O-water), 18F-FDHR has the potential of providing excellent image resolution without the need for an on-site cyclotron.
Effects of potassium channel opener on the kinetics of thallium-201 in in-vitro and in-vivo
Energy Technology Data Exchange (ETDEWEB)
Lee, J.; Kim, E. J.; Ahn, B. C.; Chae, S. C.; Lee, K. B. [College of Medicine, Kyungpook National Univ., Taegu (Korea, Republic of); Kim, C. K. [Mt. Sinai Medical School, New York (United States)
1997-07-01
Potassium channel opener (K-opener) opens membrane ATP-sensitive K{sup +}-channel and induces and increase in potassium efflux from cells. K-openers are powerful smooth muscle relaxants and currently used as antihypertensive, antianginal drugs or bronchodilators in clinic. Pharmacologic potency of newly synthesized K-opener is being evaluated with efflux capacity of preincubated Rb-83 from the isolated aortic vascular tissue preparation. Thallium has similar characteristics to those of rubidium and potassium in vivo. To evaluate the effect of pinacidil (a potent K-opener) on Tl-201 biokinetics, we have performed uptake/washout studies in cultured myocytes, and mice biodistribution study. Primary culture of spontaneous contracting myocytes was undertake from hearts of newborn Sprague-Dawley rat. Different concentration of pinacidil (100nM or 10uM) was co-incubated with Tl-201 in HBSS buffer to evaluate its effect on cellular uptake, or challenged to myocyte preparations pre-incubated with Tl-201 for washout study. Pinacidil was injected into mice simultaneous or 10-min after Tl-201 injection, and organ uptake and whole body retention ratio was measured using gamma counter or dose calibrator. Co-incubation of pinacidil with Tl-201 resulted in a decrease in Tl uptake into myocytes by 1.6 - 2.5 times, and an increase in washout by 1.6 - 3.1 times. Pinacidil injection resulted in mild decrease in blood, heart and liver uptake in mice, bur renal uptake was markedly decreased in a dose dependent manner. These results suggest that the pinacidil Tl-201 kinetics and may potentially affect the interpretation of Tl-201 myocardial imaging.
Horng, Lin-Yea; Hsu, Pei-Lun; Chen, Li-Wen; Tseng, Wang-Zou; Hsu, Kai-Tin; Wu, Chia-Ling; Wu, Rong-Tsun
2015-10-01
Memory impairment can be progressive in neurodegenerative diseases, and physiological ageing or brain injury, mitochondrial dysfunction and oxidative stress are critical components of these issues. An early clinical study has demonstrated cognitive improvement during erythropoietin treatment in patients with chronic renal failure. As erythropoietin cannot freely cross the blood-brain barrier, we tested EH-201 (2,3,5,4'-tetrahydroxystilbene-2-O-β-d-glucoside, also known as TSG), a low MW inducer of erythropoietin, for its therapeutic effects on memory impairment in models of neurodegenerative diseases, physiological ageing or brain injury. The effects of EH-201 were investigated in astrocytes and PC12 neuronal-like cells. In vivo, we used sleep-deprived (SD) mice as a stress model, amyloid-β (Aβ)-injected mice as a physiological ageing model and kainic acid (KA)-injected mice as a brain damage model to assess the therapeutic effects of EH-201. EH-201 induced expression of erythropoietin, PPAR-γ coactivator 1α (PGC-1α) and haemoglobin in astrocytes and PC12 neuronal-like cells. In vivo, EH-201 treatment restored memory impairment, as assessed by the passive avoidance test, in SD, Aβ and KA mouse models. In the hippocampus of mice given EH-201 in their diet, levels of erythropoietin, PGC-1α and haemoglobin were increased The induction of endogenous erythropoietin in neuronal cells by inducers such as EH-201 might be a therapeutic strategy for memory impairment in neurodegenerative disease, physiological ageing or traumatic brain injury. © 2015 The Authors. British Journal of Pharmacology published by John Wiley & Sons Ltd on behalf of The British Pharmacological Society.
2010-01-01
... Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT General § 201.99 Purchase of...
Energy Technology Data Exchange (ETDEWEB)
Sahin, Ali [Faculty of Medicine, Department of Nuclear Medicine, Ataturk University, Erzurum 25240 (Turkey)], E-mail: alibabam2001@yahoo.com; Senturk, Murat [Science Faculty, Department of Chemistry, Ataturk University, Erzurum 25240 (Turkey); Ciftci, Mehmet [Science and Arts Faculty, Department of Chemistry, Agri Ibrahim Cecen University, 04100, Agri (Turkey); Varoglu, Erhan [Faculty of Medicine, Department of Nuclear Medicine, Ataturk University, Erzurum 25240 (Turkey); Kufrevioglu, Omer Irfan [Science and Arts Faculty, Department of Chemistry, Agri Ibrahim Cecen University, 04100, Agri (Turkey)
2010-04-15
Aim: The inhibitory effects of thallium-201 ({sup 201}Tl) solution on human erythrocyte glucose 6-phosphate dehydrogenase (G6PD) activity were investigated. Methods: For this purpose, erythrocyte G6PD was initially purified 835-fold at a yield of 41.7% using 2',5'-Adenosine diphosphate sepharose 4B affinity gel chromatography. The purification was monitored by sodium dodecyl sulfate-polyacrylamide gel electrophoresis, which showed a single band for the final enzyme preparation. The in vitro and in vivo effects of the {sup 201}Tl solution including Tl{sup +}, Fe{sup +3} and Cu{sup +2} metals and the in vitro effects of the radiation effect of the {sup 201}Tl solution and non-radioactive Tl{sup +}, Fe{sup +3} and Cu{sup +2} metals on human erythrocyte G6PD enzyme were studied. Enzyme activity was determined with the Beutler method at 340 nm using a spectrophotometer. All purification procedures were carried out at +4 deg. C. Results: {sup 201}Tl solution and radiation exposure had inhibitory effects on the enzyme activity. IC{sub 50} value of {sup 201}Tl solution was 36.86 {mu}l ([Tl{sup +}]: 0.0036 {mu}M, [Cu{sup +2}]: 0.0116 {mu}M, [Fe{sup +3}]: 0.0132 {mu}M), of human erythrocytes G6PD. Seven human patients were also used for in vivo studies of {sup 201}Tl solution. Furthermore, non-radioactive Tl{sup +}, Fe{sup +3} and Cu{sup +2} were found not to have influenced the enzyme in vitro. Conclusion: Human erythrocyte G6PD activity was inhibited by exposure for up to 10 minutes to 0.057 mCi/kg {sup 201}Tl solution. It was detected in in vitro and in vivo studies that the human erythrocyte G6PD enzyme is inhibited due to the radiation effect of {sup 201}Tl solution.
Energy Technology Data Exchange (ETDEWEB)
Shourian, Mostafa [Laboratory of Microanalysis, Institute of Biochemistry and Biophysics, University of Tehran, P.O. Box 13145-1384, Tehran (Iran, Islamic Republic of); Tavakoli, Hassan, E-mail: tavakoli@ibb.ut.ac.i [Faculty of Medicine, Department of Physiology and Biophysics, Faculty of Medicine, Baqiyatollah University of Medical Sciences, P.O. Box 19395-6558, Tehran (Iran, Islamic Republic of); Ghourchian, Hedayatollah, E-mail: hadi@ibb.ut.ac.i [Laboratory of Microanalysis, Institute of Biochemistry and Biophysics, University of Tehran, P.O. Box 13145-1384, Tehran (Iran, Islamic Republic of); Rafiee-Pour, Hossain-Ali [Laboratory of Microanalysis, Institute of Biochemistry and Biophysics, University of Tehran, P.O. Box 13145-1384, Tehran (Iran, Islamic Republic of)
2010-09-15
This report describes the detection and dosimetry of gamma ray emitted from Thallium-201 ({sup 201}Tl) and Technetium-99m ({sup 99m}Tc) based on chemiluminescence technique. H{sub 2}O{sub 2} produced by two gamma emitter radioisotopes of {sup 201}Tl and {sup 99m}Tc were quantitatively measured by chemiluminescence method. Upon producing H{sub 2}O{sub 2} in a luminol alkaline solution, in the presence of diperiodatocuprate, as catalyst a chemical reaction was accrued and consequently the emitted light was measured. The determined H{sub 2}O{sub 2} concentration was correlated with the gamma ray detection and dosimetry. The sensitivity of chemiluminescence technique for {sup 201}Tl and {sup 99m}Tc dosimetry was determined to be 0.20 and 0.08 MBq/l (Mega Becquerel per liter) respectively (R.S.D. = %5, N = 3). The plotted calibration curves showed detection limits of 3.24 and 1.76 MBq/l for {sup 201}Tl and {sup 99m}Tc, respectively.
Energy Technology Data Exchange (ETDEWEB)
Takeishi, Y.; Tono-oka, I.; Ikeda, K.; Komatani, A.; Tsuiki, K.; Yasui, S. (Yamagata Univ. School of Medicine (Japan))
1991-02-01
To investigate the significance and mechanism of dilatation of the left ventricular cavity on dipyridamole thallium-201 imaging, we performed both dipyridamole thallium-201 imaging and dipyridamole radionuclide angiography on 83 patients with known angiograms. The dipyridamole/delayed ratio of the left ventricular dimension from the thallium-201 image was defined as the left ventricular dilatation ratio (LVDR). An LVDR greater than the mean + two standard deviations in patients without coronary artery disease was defined as abnormal. Twenty-two of 83 patients showed an abnormal LVDR, and 18 of the 22 patients (82%) had triple-vessel disease. By defect and washout analysis, the sensitivity and specificity for correctly identifying the patients as having triple-vessel disease was 72% and 76%, respectively, whereas LVDR had a sensitivity of 72% and a specificity of 93%. When LVDR was used in combination with the defect and washout criteria, sensitivity increased to 84% without a loss of specificity. In those 22 patients with abnormal LVDRs, end-diastolic volume measured by radionuclide angiography did not change after dipyridamole infusion. Dilatation of the left ventricular cavity on dipyridamole thallium-201 imaging reflected relative subendocardial hypoperfusion induced by dipyridamole rather than actual chamber enlargement. The LVDR was moderately sensitive and highly specific for triple-vessel disease and provided complementary information to dipyridamole thallium-201 imaging.
Energy Technology Data Exchange (ETDEWEB)
Taguchi, Takahisa; Kobayashi, Akira; Kurata, Chinori; Tawarahara, Kei; Yamazaki, Noboru (Hamamatsu Univ. School of Medicine, Shizuoka (Japan))
1993-11-01
Dual-tracer imaging of the heart with [sup 125]I-metaiodobenzylguanidine (MIBG) and [sup 201]Tl can simultaneously demonstrate the distribution of sympathetic nerve endings and the underlying myocardial perfusion. A quantitative dual-tracer autoradiographic study with [sup 201]Tl and [sup 125]I-MIBG was performed to investigate changes in the distribution of cardiac sympathetic innervation with the progression of cardiomyopathy in BIO 14.6 hamsters. The distribution of [sup 201]Tl was uniform in control hamsters and BIO 14.6 hamsters at all stages of cardiomyopathy. In contrast, a reduction in MIBG accumulation occurred in the endocardial region of the left ventricular free wall and the left ventricular aspect of the interventricular septum in BIO 14.6 hamsters at 3 and 8 months of age. Thus, there was an uncoupling of the left ventricular distribution of [sup 201]Tl and [sup 125]I-MIBG in BIO 14.6 hamsters. In addition, interstitial fibrosis was increased in the interventricular septum, the subendocardial region of the left ventricular free wall, and the right ventricular wall, which were the sites of reduced MIBG accumulation. This study shows that dual myocardial imaging with MIBG and [sup 201]Tl may be useful for investigating patients with cardiomyopathy. (author).
Energy Technology Data Exchange (ETDEWEB)
Fernandez R, E.; Carreno de L, M. C.; Cuevas S, J. C.; Hernadez T, U. O. [Instituto Tecnologico de Toluca, Av. Tecnologico s/n, Fraccionamiento La Virgen, 52149 Metepec, Estado de Mexico (Mexico); Monroy G, F., E-mail: edelmiraf@yahoo.com [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)
2012-10-15
In this work the capacity of the water macrophyte Lemna gibba coming from San Pedro Tultepec in the Mexico State was studied to remove the radioisotopes {sup 99m}Tc and {sup 201}Tl, in order to show the capacity of this macrophyte for to treat some radioactive waste flowing that could contain this radioisotopes type. The removal capacity of {sup 99m}Tc and {sup 201}Tl of the macrophyte Lemna gibba was determined using the batch method. In accordance with the values of the obtained K{sub d}, the Lemna gibba with a size of particle diameter among 1mm - 300 {mu}m presents a better adsorption of {sup 99m}Tc. The {sup 201}Tl is adsorbed better in the bioadsorbent when it has a size of particle diameter <150{mu}m. (Author)
LPIC-2 Linux Professional Institute Certification Study Guide Exams 201 and 202
Smith, Roderick W
2011-01-01
The first book to cover the LPIC-2 certification Linux allows developers to update source code freely, making it an excellent, low-cost, secure alternative to alternate, more expensive operating systems. It is for this reason that the demand for IT professionals to have an LPI certification is so strong. This study guide provides unparalleled coverage of the LPIC-2 objectives for exams 201 and 202. Clear and concise coverage examines all Linux administration topics while practical, real-world examples enhance your learning process. On the CD, you'll find the Sybex Test Engine, electronic flash
Reactions sup 58,64 Ni( p ,. pi. sup + ) at 201 MeV
Energy Technology Data Exchange (ETDEWEB)
Badala, A.; Barbera, R.; Palmeri, A.; Pappalardo, G.S.; Bonasera, A. (Istituto Nazionale di Fisica Nucleare, Corso Italia 57, 95129 Catania (Italy)); Riggi, F.; Adorno, A. (Istituto Nazionale di Fisica Nucleare and Dipartimento di Fisica dell' Universita di Catania, Corso Italia 57, 95129 Catania (Italy)); Bimbot, L. (Institut de Physique Nucleaire, Boite Postale 1, 91406 Orsay CEDEX (France))
1992-08-01
The production of positive and negative pions induced by 201 MeV protons on {sup 58}Ni and {sup 64}Ni isotopes has been studied. The double differential cross sections have been measured at the laboratory angles 22{degree}, 35{degree}, 55{degree}, 72{degree}, 90{degree}, 105{degree}, 120{degree}, 138{degree}, 155{degree} and from 20 MeV kinetic energy up to the kinematical limit. Features of the double differential cross sections relative to the two targets are discussed and compared to results obtained at higher incident energies.
Ditrói, F.; Tárkányi, F.; Takács, S.; Hermanne, A.; Ignatyuk, A. V.
2014-01-01
Cross-sections of deuteron induced nuclear reactions on lead were measured up to 50 MeV using the standard stacked foil irradiation technique and high resolution $\\gamma$-ray spectrometry. Experimental cross-sections and derived integral yields are presented for the $^{nat}$Pb(d,x)$^{206,205,204,203,202}$Bi, $^{203cum,202m,201cum}$Pb and $^{202cum,201cum}$Tl reactions. The experimental data were compared with the results from literature and with the data in the TENDL-2013 library (obtained wi...
Activity determination of a {sup 201}Tl solution by 4πβ-γ and sum-peak coincidence methods
Energy Technology Data Exchange (ETDEWEB)
Ruzzarin, Anelise; Lopes, Ricardo Tadeu, E-mail: aruzzarin@nuclear.ufrj.br [Coordenacao dos Cursos de Pos-Graduacao em Engenharia (LIN/PEN/COPPE/UFRJ), RJ (Brazil). Programa de Engenharia Nuclear. Lab. de Instrumentacao Nuclear; Silva, Monica A. L. da [Comissao Nacional de Energia Nuclear (CNEN), Rio de Janeiro, RJ (Brazil); Iwahara, Akira; Silva, Ronaldo L. da; Filho, Octavio L.T.; Poledna, Roberto [Instituto de Radioprotecao e Dosimetria (LNMRI/IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Lab. Nacional de Metrologia das Radiacoes Ionizantes
2015-07-01
{sup 201}Tl is used in nuclear medicine in cardiac imaging for evaluating the injury level in cardiac muscle at rest and exercise. In this work the activity concentration of a {sup 201}Tl radioactive solution has been absolutely determined using the 4πβ-γ coincidence and sum-peak coincidence methods. The presence of {sup 202}Tl radioactive impurity that imposes some difficult in the activity measurements was taken into account in the measurements. In the sum-peak method a planar germanium detector was used. The half-lives were evaluated by the reference source method and the results obtained were (3.033 ± 0.004) d and (12.320 ± 0.163) d, respectively, for {sup 201}Tl and {sup 202}Tl. (author)
Energy Technology Data Exchange (ETDEWEB)
Hiasa, Go [Ehime Univ., Matsuyama (Japan). School of Medicine
2001-08-01
Many patients with hypertrophic cardiomyopathy (HCM) gradually changes from typical myocardial hypertrophy to dilated cardiomyopathy-like features. However, it is difficult to estimate the disease stage in HCM. To determine the disease stage, dual analysis of iodine-123-labeled metaiodobenzylguanidine ({sup 123}I-MIBG) and thallium-201 ({sup 201}Tl) myocardial scintigraphies were performed in 108 HCM patients. According to the scintigraphic distribution patterns, patients were divided into three groups. Group A (n=15): normal distributions of both {sup 123}I-MIBG and {sup 201}Tl, group B (n=71): normal {sup 201}Tl and low {sup 123}I-MIBG patterns, group C (n=22): low distributions of both scintigraphies. The decrease in {sup 201}Tl uptake was observed in only group C. Concerning {sup 123}I-MIBG, heart-to-mediastinum ratio (H/M) and washout rate (WOR) had good correlations with left ventricular systolic functions. H/M was decreased and WOR was increased in order of C, B and A groups. Left ventricular diastolic function reflected by isovolumic relaxation time was longer in group B than in group A. Attenuated left ventricular hypertrophy, enlarged left ventricular volumes, impaired left ventricular functions and serious clinical symptoms were observed in only group C. Myocardial sympathetic abnormalities in group B may be mainly due to myocardial hypertrophy, and those in group C may be due to myocardial injury. Dual analysis of {sup 123}I-MIBG and {sup 201}Tl scintigraphies may be useful to classify disease stages of HCM. (author)
Evaluation of myocardial abnormalities in collagen diseases by thallium-201 myocardial scintigraphy
Energy Technology Data Exchange (ETDEWEB)
Yamano, Shigeru; Kagoshima, Tadashi; Sugihara, Kiyotaka (Nara Medical Univ., Kashihara (Japan)) (and others)
1993-12-01
This study was performed to evaluate myocardial abnormalities in patients with collagen diseases by exercise and rest thallium-201 myocardial scintigrams. A total of 65 patients without ischemic ECG changes, consisting of 18 with systemic lupus erythematosus (SLE), 18 with polymyositis (PM), 8 with progressive systemic sclerosis (PSS), and 21 with Sjoegren's syndrome (SjS), was enrolled in this study. Reversible exercise-induced defects scintigraphically suggesting myocardial ischemia were noted in 8 cases of SLE, 4 cases of PM, 4 cases of PSS, and 3 cases of SjS. Nineteen patients had exercise-induced defects and underwent cardiac catheterization, 8 of whom had normal coronary angiograms. Fixed hypoperfusion areas were observed in one case of SLE, 6 cases of PM and 3 cases of SjS. Rest thallium-201 myocardial scintigram disclosed hypoperfusion areas which were not induced by exercise in 2 cases of SLE, 3 cases of PM, one case of PSS and 5 cases of SjS. Echocardiogram showed no significant differences in ejection fraction and % fractional shortening between the disease groups and healthy control group. These findings suggest that patients with collagen diseases have abnormalities of coronary circulation at the level of the intramural vasculature before cardiac function impairment, myocardial fibrosis and functional abnormalities at the cell membrane. (author).
Energy Technology Data Exchange (ETDEWEB)
Kleinman, B.; Henkin, R.E.; Glisson, S.N.; el-Etr, A.A.; Bakhos, M.; Sullivan, H.J.; Montoya, A.; Pifarre, R.
1986-02-01
Qualitative distribution of coronary flow using thallium-201 perfusion scans immediately postintubation was studied in 22 patients scheduled for elective coronary artery bypass surgery. Ten patients received a thiopental (4 mg/kg) and halothane induction. Twelve patients received a fentanyl (100 micrograms/kg) induction. Baseline thallium-201 perfusion scans were performed 24 h prior to surgery. These scans were compared with the scans performed postintubation. A thallium-positive scan was accepted as evidence of relative hypoperfusion. Baseline hemodynamic and ECG data were obtained prior to induction of anesthesia. These data were compared with the data obtained postintubation. Ten patients developed postintubation thallium-perfusion scan defects (thallium-positive scan), even though there was no statistical difference between their baseline hemodynamics and hemodynamics at the time of intubation. There was no difference in the incidence of thallium-positive scans between those patients anesthetized by fentanyl and those patients anesthetized with thiopental-halothane. The authors conclude that relative hypoperfusion, and possibly ischemia, occurred in 45% of patients studied, despite stable hemodynamics, and that the incidence of these events was the same with two different anesthetic techniques.
Thallium-201: Autoradiography in pigmented mice and melanin-binding in vitro
Energy Technology Data Exchange (ETDEWEB)
Tjaelve, H.; Nilsson, M.; Larsson, B. (Uppsala Univ. (Sweden))
1982-01-01
Autoradiography with /sup 201/Tl/sup +/ in C57Bl mice showed a strong labelling of the eye melanin and of pigmented hair follicles. An analysis of the affinity of thallium for pigment from cow eyes indicated a binding to three groups of sites and showed a marked sensitivity to the addition of H/sup +/-ions. The results are consistent with the conception that a binding of thallium occurs to the free carboxyl groups of the melanin and that the structure of the polymer has a marked influence on the affinity. Similar results have previously been obtained with other cations. There was no indication that the strong in vivo affinity of thallium to melanin is due to a more firm binding than for other cations which do not localize on melanin in vivo. Instead, the ability of cations to pass the melanocyte membranes and reach the melanin granules is probably decisive for whether a melanin-binding will take place in vivo. Toxic effects on the eye and epilation are symptoms of thallium intoxication which may be related to its melanin-binding. The fate of /sup 201/Tl/sup +/ in some other tissues is also described and discussed.
Energy Technology Data Exchange (ETDEWEB)
Sugihara, Hiroki; Umamoto, Ikuo; Harada, Yoshiaki (Kyoto Prefectural Univ. of Medicine (Japan)) (and others)
1992-03-01
In 22 patients with hypertrophic cardiomyopathy not associated with coronary stenosis, findings of exercise Tl-201 myocardial scintigraphy were reviewed in relation to coronary blood flow velocity. Blood flow velocity of the left antero-inferior segment was recorded by using a Doppler catheter. From time velocity integration in systolic and diastolic phases, both % systolic fraction (%SF) and %diastolic 1st third fraction (%d1F) were obtained. A decreased perfusion was visually assessed on exercise Tl-201 myocardial images. In addition, transient dilation of the left ventricular cavity was quantitatively assessed by expressing it as a transient dilation index (TDI) for subendocardial ischemia. Coronary blood flow velocity was characterized by a decrease in both %SF and %d1F and negative systolic flow. Both %SF and %d1F were inversely correlated with TDI. Coronary negative systolic flow was frequently associated with a decreased perfusion. These results suggest factors such as left ventricular relaxation impairment, other than coronary small vessel lesions, may also be involved in the occurrence of myocardial ischemia in hypertrophic cardiomyopathy. (N.K.).
Te Lintel Hekkert, Maaike; Dubé, Gregory P; Regar, Evelyn; de Boer, Martine; Vranckx, Pascal; van der Giessen, Wim J; Serruys, Patrick W; Duncker, Dirk J
2010-03-01
Because of their ability to perfuse remote regions and deliver oxygen, hemoglobin-based oxygen carriers (HBOCs) may be considered in the treatment of several ischemic conditions such as acute coronary syndromes or high-risk percutaneous intervention. Here we studied the effects of intracoronary infusion of ex vivo preoxygenated HBOC-201 during brief total coronary artery occlusion (CAOs) on myocardial oxygenation and left ventricular (LV) function in a large animal model and investigated the influence of HBOC-201 temperature and infusion rate on these effects. Thirteen open-chest anesthetized swine were instrumented for measurement of global and regional LV function and metabolism. CAOs were induced by inflating an intracoronary balloon catheter; preoxygenated HBOC-201 (12 g/dL) was infused distally through the central lumen of the balloon catheter. Animals underwent consecutive 3-min CAOs interspersed by 30 min of reperfusion, accompanied by different HBOC-201 infusion rates (0, 15, 23, 30, 40, and 50 ml/min) and/or two infusion temperatures (18 degrees C or 37 degrees C) in random order. CAO elicited immediate loss of systolic shortening (SS) in the ischemic region (19 +/- 1% at baseline vs. -3 +/- 2% at end of CAO), resulting in decreases in maximum rate of rise in LV pressure (15 +/- 5%) and stroke volume (12 +/- 4%; all P < 0.05). Balloon deflation resulted in marked coronary reactive hyperemia (to 472 +/- 74% of baseline), increases in coronary venous concentrations of adenosine + inosine (to 218 +/- 26% of baseline; both P < 0.05) and rapid restoration of SS toward baseline. HBOC-201 ameliorated the CAO-induced changes in SS, stroke volume, reactive hyperemia, and coronary venous adenosine + inosine. The effects were temperature and flow dependent with full preservation of SS at 50 ml/min HBOC-201 of 37 degrees C. In conclusion, intracoronary preoxygenated HBOC-201 preserved myocardial oxygenation and LV function in swine during CAO in a dose- and
2010-07-01
... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false How are my authorized en route travel days and per diem determined for relocation travel? 302-4.201 Section 302-4.201 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES PERMANENT CHANGE OF STATION (PCS) ALLOWANCES FOR SUBSISTENC...
2010-07-01
... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false What is the mileage allowance when you transport a mobile home overland by a POV? 302-10.201 Section 302-10.201 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES TRANSPORTATION AND...
Directory of Open Access Journals (Sweden)
Varun V Prabhu
Full Text Available Cancer stem cells (CSCs correlate with recurrence, metastasis and poor survival in clinical studies. Encouraging results from clinical trials of CSC inhibitors have further validated CSCs as therapeutic targets. ONC201 is a first-in-class small molecule imipridone in Phase I/II clinical trials for advanced cancer. We have previously shown that ONC201 targets self-renewing, chemotherapy-resistant colorectal CSCs via Akt/ERK inhibition and DR5/TRAIL induction. In this study, we demonstrate that the anti-CSC effects of ONC201 involve early changes in stem cell-related gene expression prior to tumor cell death induction. A targeted network analysis of gene expression profiles in colorectal cancer cells revealed that ONC201 downregulates stem cell pathways such as Wnt signaling and modulates genes (ID1, ID2, ID3 and ALDH7A1 known to regulate self-renewal in colorectal, prostate cancer and glioblastoma. ONC201-mediated changes in CSC-related gene expression were validated at the RNA and protein level for each tumor type. Accordingly, we observed inhibition of self-renewal and CSC markers in prostate cancer cell lines and patient-derived glioblastoma cells upon ONC201 treatment. Interestingly, ONC201-mediated CSC depletion does not occur in colorectal cancer cells with acquired resistance to ONC201. Finally, we observed that basal expression of CSC-related genes (ID1, CD44, HES7 and TCF3 significantly correlate with ONC201 efficacy in >1000 cancer cell lines and combining the expression of multiple genes leads to a stronger overall prediction. These proof-of-concept studies provide a rationale for testing CSC expression at the RNA and protein level as a predictive and pharmacodynamic biomarker of ONC201 response in ongoing clinical studies.
2010-01-01
...), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Market Agency, Dealer and Packer Bonds § 201.33 Persons damaged may maintain suit; filing and notification of claims; time limitations; legal expenses. Each bond and each bond equivalent filed pursuant to the regulations in this part shall...
Ackaoui, A; Nadeau, R; Sestier, F; Savard, P; Primeau, R; Lemieux, R; Descary, M C
1985-01-01
In 35 subjects with typical or atypical angina and/or documented myocardial infarction (MI), body surface potential maps (BSPMs), ECG, VCG and rest Thallium-201 (T1-201) have been compared to left ventriculography (LVG). BSPMs were recorded with 26 ECGs, and BSPM abnormalities for MI cases were considered to be areas of normally positive potentials that have become negative. Subjects with MI were classified according to the segmental localization and degree of asynergy on LVG. Moderate anterolateral and apical asynergy were found to correlate with BSPM diagnosis of anterolateral MI and ischemia, severe anterolateral and apical asynergy with BSPM diagnosis of anterolateral MI and ischemia, and moderate diaphragmatic and/or posterobasal asynergy with BSPM diagnosis of posterior MI. Simultaneous anterior and posterior asynergy were found for BSPM diagnosis of anterior with posterior MI. Subjects with no LVG asynergy had normal BSPMs. BSPM diagnosis had the highest correlation coefficient with the LVG diagnosis (r = 0.88). ECG and VCG showed similar results with r = 0.65 and 0.71 respectively, while T1-201 had r = 0.55. The examination of our BSPMs, as well as the ECG, VCG and T1-201, did not permit to detect apical damage in presence of anterior MI, and posterobasal damage in the presence of inferoposterior MI. It is concluded that BSPMs are slightly superior to ECG and VCG for diagnosis of MI.
2010-01-01
... GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Accounts and Records § 201.49 Requirements... weighed by or on behalf of a stockyard owner, market agency, dealer, packer, or live poultry dealer where...
2010-01-01
... GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Trade Practices § 201.55 Purchases, sales... livestock grower or poultry grower by a stockyard owner, market agency, dealer, packer, or live poultry...
2010-01-01
... Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION (PACKERS AND STOCKYARDS PROGRAMS), DEPARTMENT OF AGRICULTURE REGULATIONS UNDER THE PACKERS AND STOCKYARDS ACT Trade Practices § 201.53 Persons... contractor, live poultry dealer, stockyard owner, market agency, or dealer shall knowingly make, issue, or...
26 CFR 31.3121(b)(20)-1 - Service performed on a boat engaged in catching fish.
2010-04-01
... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Service performed on a boat engaged in catching... Revenue Code of 1954) General Provisions § 31.3121(b)(20)-1 Service performed on a boat engaged in... boat engaged in catching fish or other forms of aquatic animal life (hereinafter “fish”) are excepted...
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Control activity employees formerly associated... ADMINISTRATION SUPPLEMENT Miscellaneous Provisions § 73a.735-201 Control activity employees formerly associated... appointment to the Food and Drug Division, Office of the General Counsel, a control activity employee who was...
Energy Technology Data Exchange (ETDEWEB)
Danziger, R.N.; Caples, P.W.; Huning, J.R.
1980-09-15
An analysis is made of the rules implementing Sections 201 and 210 of the Public Utility Regulatory Policies Act of 1978 (PURPA). The act provides that utilities must purchase power from qualifying producers of electricity at nondiscriminatory rates, and it exempts private generators from virtually all state and Federal utility regulations. Most of the analysis presented is taken from the perspective of photovoltaics (PV) and solar thermal electric point-focusing distributed receivers (pfdr). It is felt, however, that the analysis is applicable both to cogeneration and other emerging technologies. Chapters presented are: The FERC Response to Oral Comments on the Proposed Rules Implementing Sections 201 and 210 of PURPA; Additional Changes Made or Not Made That Were Addressed in Other Than Oral Testimony; View on the Proposed Rules Implementing Sections 201 and 210 of PURPA; Response to Comments on the Proposed 201 and 210 Rules; and Summary Analysis of the Environmental Assessment of the Rules. Pertinent reference material is provided in the Appendices, including the text of the rules. (MCW)
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Notice of intention to obtain... AND PROCEDURES GENERAL PROVISIONS § 201.18 Notice of intention to obtain a compulsory license for... Intention” is a Notice identified in section 115(b) of title 17 of the United States Code, and required by...
Directory of Open Access Journals (Sweden)
Reas S. Khan
2017-01-01
Full Text Available The ability of novel mitochondrial uncoupler prodrug of 2,4-dinitrophenol (DNP, MP201, to prevent neuronal damage and preserve visual function in an experimental autoimmune encephalomyelitis (EAE model of optic neuritis was evaluated. Optic nerve inflammation, demyelination, and axonal loss are prominent features of optic neuritis, an inflammatory optic neuropathy often associated with the central nervous system demyelinating disease multiple sclerosis. Currently, optic neuritis is frequently treated with high-dose corticosteroids, but treatment fails to prevent permanent neuronal damage and associated vision changes that occur as optic neuritis resolves, thus suggesting that additional therapies are required. MP201 administered orally, once per day, attenuated visual dysfunction, preserved retinal ganglion cells (RGCs, and reduced RGC axonal loss and demyelination in the optic nerves of EAE mice, with limited effects on inflammation. The prominent mild mitochondrial uncoupling properties of MP201, with slow elimination of DNP, may contribute to the neuroprotective effect by modulating the entire mitochondria’s physiology directly. Results suggest that MP201 is a potential novel treatment for optic neuritis.
2010-07-01
... VOCATIONAL AND ADULT EDUCATION, DEPARTMENT OF EDUCATION STATE VOCATIONAL AND APPLIED TECHNOLOGY EDUCATION... Technology Education Program? § 403.201 What are the State's responsibilities for developing and implementing... differing types of standards and measures including— (1) The advantages and disadvantages of each type of...
2010-10-01
... Land Modes § 1572.201 Transportation of hazardous materials via commercial motor vehicle from Canada or... vehicle drivers licensed by Canada and Mexico. (b) Terms used in this section. The terms used in 49 CFR... toxin in 42 CFR part 73. (c) Background check required. A commercial motor vehicle driver who is...
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Water-soluble gums, hydrophilic gums, and... Specific Labeling Requirements for Specific Drug Products § 201.319 Water-soluble gums, hydrophilic gums... been associated with the ingestion of water-soluble gums, hydrophilic gums, and hydrophilic mucilloids...
Lin, J D; Kao, P F; Weng, H F; Lu, W T; Huang, M J
1998-07-01
Radioactive iodine (131I) has been found to be more sensitive and more specific than thallium-201 for the detection of distant metastases and thyroid remnants in the neck in cases of well-differentiated thyroid carcinoma. 201Tl has been deemed particularly useful in localizing metastases or recurrence in patients with a negative 131I scan and abnormal levels of serum thyroglobulin (Tg). This study aimed to: (1) determine the value of 201Tl imaging in localizing metastases or recurrence in patients with well-differentiated thyroid carcinoma, and (2) evaluate the false-positive and false-negative results of 131I and 201Tl scintigraphy. Sixty-two thyroid remnant ablated patients who underwent simultaneous postoperative 201Tl and 131I scans and and serum Tg determinations were evaluated. Fifty patients had papillary thyroid carcinomas and 12 had follicular thyroid carcinomas. 201Tl imaging was performed before the 131I studies. Of the 62 patients who underwent 201Tl imaging studies, 24 were found to have positive results, with local recurrence or distant metastases. Patients with positive results in the 201Tl imaging studies tended to be older, were mor often male, had higher Tg levels and had a higher recurrence rate. Of these 24 patients, ten had negative diagnostic or therapeutic 131I scans. Concurrently, serum Tg levels were less than 5 ng/ml in five of these ten patients. Three patients were deemed false positive by 201Tl scans; one had a parotid tumour, one a periodontal abscess and one lung metastasis. Among the 38 patients with negative 201Tl scans, 11 had positive findings on 131I scans. Three had distant metastases: two with lung metastases and one with bone metastases. Patients with false-positive results on 131I scans included those with biliary tract stones, ovarian cysts, and breast secretion. Of the 27 patients with negative 201Tl and 131I scans, 15 had elevated serum Tg levels. Among these, local recurrence followed by lung metastases was manifested in
Energy Technology Data Exchange (ETDEWEB)
Lin Jen-Der; Weng Hsiao-Fen; Lu Wen-Tsoung [Division of Endocrinology and Metabolism, Chang Gung Memorial Hospital (Taiwan, Province of China); Kao Pan-Fu; Huang Miau-Ju [Department of Nuclear Medicine, Chang Gung Memorial Hospital, Taiwan (Taiwan, Province of China)
1998-07-01
Radioactive iodine ({sup 131}I) has been found to be more sensitive and more specific than thallium-201 for the detection of distant metastases and thyroid remnants in the neck in cases of well-differentiated thyroid carcinoma. {sup 201}Tl has been deemed particularly useful in localizing metastases or recurrence in patients with a negative {sup 131}I scan and abnormal levels of serum thyroglobulin (Tg). This study aimed to: (1) determine the value of {sup 201}Tl imaging in localizing metastases or recurrence in patients with well-differentiated thyroid carcinoma, and (2) evaluate the false-positive and false-negative results of {sup 131}I and {sup 201}Tl scintigraphy. Sixty-two thyroid remnant ablated patients who underwent simultaneous postoperative {sup 201}Tl and {sup 131}I scans and and serum Tg determinations were evaluated. Fifty patients had papillary thyroid carcinomas and 12 had follicular thyroid carcinomas. {sup 201}Tl imaging was performed before the {sup 131}I studies. Of the 62 patients who underwent {sup 201}Tl imaging studies, 24 were found to have positive results, with local recurrence or distant metastases. Patients with positive results in the {sup 201}Tl imaging studies tended to be older, were mor often male, had higher Tg levels and had a higher recurrence rate. Of these 24 patients, ten had negative diagnostic or therapeutic {sup 131}I scans. Concurrently, serum Tg levels were less than 5 ng/ml in five of these ten patients. Three patients were deemed false positive by {sup 201}Tl scans; one had a parotid tumour, one a periodontal abscess and one lung metastasis. Among the 38 patients with negative {sup 201}Tl scans, 11 had positive findings on {sup 131}I scans. Three had distant metastases: two with lung metastases and one with bone metastases. Patients with false-positive results on {sup 131}I scans included those with biliary tract stones, ovarian cysts, and breast secretion. Of the 27 patients with negative {sup 201}Tl and {sup 131}I
Tensile properties of CLAM steel irradiated up to 20.1 dpa in STIP-V
Ge, Hongen; Peng, Lei; Dai, Yong; Huang, Qunying; Ye, Minyou
2016-01-01
Specimens of China low activation martensitic steel (CLAM) were irradiated in the fifth experiment of SINQ Target Irradiation Program (STIP-V) up to 20.1 dpa/1499 appm He/440 °C. Tensile tests were performed at room temperature (R.T) and irradiation temperatures (Tirr) in the range of 25-450 °C. The tensile results demonstrated strong effect of irradiation dose and irradiation temperature on hardening and embrittlement. With Tirr below ˜314 °C, CLAM steel specimens tested at R.T and Tirr showed similar evolution trend with irradiation dose, compared to other reduced activation ferritic/martensitic (RAFM) steels in similar irradiation conditions. At higher Tirr above ˜314 °C, it is interesting that the hardening effect decreases and the ductility seems to recover, probably due to a strong effect of high irradiation temperature.
Sequential dual-isotope SPECT imaging with thallium-201 and technetium-99m-sestamibi.
Heo, J; Wolmer, I; Kegel, J; Iskandrian, A S
1994-04-01
This study examined the results of sequential SPECT dual-isotope imaging with 201Tl and 99mTc-sestamibi in 148 patients, 114 of whom also had coronary angiography and 34 had exercise testing or adenosine infusion at a rate of 140 micrograms/kg/min for 6 min. The study was completed within 2 hr. The stress and rest images were normal in 11 of 17 patients (65%) with no CAD by angiography and in 33 of 34 patients with a low pretest probability of CAD (normalcy rate = 97%). The images were abnormal in 75 patients with CAD (77%). The perfusion pattern was compared to wall motion in 485 segments (97 patients) assessed by contrast ventriculography. There were no or reversible perfusion defects in 357 of 386 segments (92%) with no wall motion abnormality. Sequential dual-isotope imaging is feasible and can be completed in a short period of time and may therefore enhance laboratory throughput and patient convenience.
Marciano, David C; Pennington, Jeanine M; Wang, Xiaohu; Wang, Jian; Chen, Yu; Thomas, Veena L; Shoichet, Brian K; Palzkill, Timothy
2008-12-05
TEM-1 beta-lactamase confers bacterial resistance to penicillin antibiotics and has acquired mutations that permit the enzyme to hydrolyze extended-spectrum cephalosporins or to avoid inactivation by beta-lactamase inhibitors. However, many of these substitutions have been shown to reduce activity against penicillin antibiotics and/or result in loss of stability for the enzyme. In order to gain more information concerning the tradeoffs associated with active site substitutions, a genetic selection was used to find second site mutations that partially restore ampicillin resistance levels conferred by an R244A active site TEM-1 beta-lactamase mutant. An L201P substitution distant from the active site that enhanced ampicillin resistance levels and increased protein expression levels of the R244A TEM-1 mutant was identified. The L201P substitution also increases the ampicillin resistance levels and restores expression levels of a poorly expressed TEM-1 mutant with a core-disrupting substitution. In vitro thermal denaturation of purified protein indicated that the L201P mutation increases the T(m) value of the TEM-1 enzyme. The X-ray structure of the L201P TEM-1 mutant was determined to gain insight into the increase in enzyme stability. The proline substitution occurs at the N-terminus of an alpha-helix and may stabilize the enzyme by reducing the helix dipole, as well as by lowering the conformational entropy cost of folding due to the reduced number of conformations available in the unfolded state. Collectively, the data suggest that L201P promotes tolerance of some deleterious TEM-1 mutations by enhancing the protein stability of these mutants.
Energy Technology Data Exchange (ETDEWEB)
Niess, G.S.; Logic, J.R.; Russell, R.O. Jr.; Rackley, C.E.; Rogers, W.J.
1979-05-01
Thirty-two patients were evaluated at a mean of 7 +- 2 months after infarction with a 12-lead ECG, resting /sup 201/Tl myocardial scintigram, biplane left ventriculogram, and coronary angiograms. From the left ventriculogram, asynergy was quantified as percent abnormally contracting segment (% ACS), the percent of end-diastolic circumference which was either akinetic or dyskinetic. Using a computerized planimetry system, we expressed /sup 201/Tl perfusion defects as a percentage of total potential thallium uptake. Of 21 patients with ECG evidence of prior transmural infarction, a /sup 201/Tl defect was present in 20, and angiographic asynergy was present in all 21. The site of prior infarction by ECG agreed with the /sup 201/T1 defect location in 24 of 32 patients and with site of angiographic asynergy in 23 of 32 patients. Scintigraphic defects were present in only four of 10 patients with ACS less than or equal to 6%, but scintigraphic defects were found in 20 of 22 patients with ACS > 6%. Thallium defect size correlated marginally with angiographic left ventricular ejection fraction but correlated closely with angiographic % ACS. Thallium defect size was similar among patients with one-, two-, or three-vessel coronary artery disease (greater than or equal to 70% stenosis), but thallium defect size was larger in patients with electrocardiographic evidence of transmural infarction or pulmonary capillary wedge pressure > 12 mm Hg. Thus, resting /sup 201/T1 myocardial scintigraphy is useful in localizing and quantifying the extent of prior myocardial infarction, but is insensitive to small infarcts (ACS < 6%).
Cardiac ryanodine receptor in metabolic syndrome: is JTV519 (K201 future therapy?
Directory of Open Access Journals (Sweden)
Dincer UD
2012-04-01
Full Text Available U Deniz DincerDepartment of Pharmacology, Ufuk University School of Medicine. Mevlana Bulvari, Balgat, Ankara, TurkeyAbstract: Metabolic syndrome is characterized by a combination of obesity, hypertension, insulin resistance, dyslipidemia, and impaired glucose tolerance. This multifaceted syndrome is often accompanied by a hyperdynamic circulatory state characterized by increased blood pressure, total blood volume, cardiac output, and metabolic tissue demand. Experimental, epidemiological, and clinical studies have demonstrated that patients with metabolic syndrome have significantly elevated cardiovascular morbidity and mortality rates. One of the main and frequent complications seen in metabolic syndrome is cardiovascular disease. The primary endpoints of cardiometabolic risk are coronary and peripheral arterial disease, myocardial infarction, congestive heart failure, arrhythmia, and stroke. Alterations in expression and/or functioning of several key proteins involved in regulating and maintaining ionic homeostasis can cause cardiac disturbances. One such group of proteins is known as ryanodine receptors (intracellular calcium release channels, which are the major channels through which Ca2+ ions leave the sarcoplasmic reticulum, leading to cardiac muscle contraction. The economic cost of metabolic syndrome and its associated complications has a significant effect on health care budgets. Improvements in body weight, blood lipid profile, and hyperglycemia can reduce cardiometabolic risk. However, constant hyperadrenergic stimulation still contributes to the burden of disease. Normalization of the hyperdynamic circulatory state with conventional therapies is the most reasonable therapeutic strategy to date. JTV519 (K201 is a newly developed 1,4-benzothiazepine drug with antiarrhythmic and cardioprotective properties. It appears to be very effective in not only preventing but also in reversing the characteristic myocardial changes and preventing
Energy Technology Data Exchange (ETDEWEB)
Yamano, Shigeru (Nara Medical Univ., Kashihara (Japan))
1992-08-01
This study was performed to evaluate myocardial lesions in patients with collagen diseases by rest and exercise thallium-201 myocardial scintigraphies. A total of 76 patients without ischemic ECG changes, consisting of 27 cases of systemic lupus erythematosus (SLE), 17 cases of polymyositis or dermatomyositis (PM[center dot]DM), 11 cases of progressive systemic sclerosis (PSS), and 21 cases of Sjoegren's syndrome (SjS), were enrolled in this study. Reversible exercise-induced defects suggesting myocardial ischemia were noted in 12 cases of SLE, 5 cases of PM[center dot]DM, 3 cases of PSS, and 3 cases of SjS. Of the 23 patients who had exercise-induced defects, 9 patients showed normal coronary angiograms by cardiac catheterization. Fixed hypoperfusion areas were observed in 5 cases of SLE, 6 cases of PM[center dot]DM, 4 cases of PSS and 3 cases of SjS. Rest thallium-201 myocardial scintigraphy disclosed hypoperfusion areas, which were not induced by exercise, in 1 case of SLE, 4 cases of PM[center dot]DM, 1 case of PSS and 5 cases of SjS. Endomyocardial biopsy was performed on 20 patients. Myocardial lesions in PM[center dot]DM and PSS were more severe and wide spread than in SLE. Ejection fraction and fractional shortening evaluated by echocardiography had no significant differences between each disease group and the healthy control group. These findings suggest that patients with collagen diseases show the presence of abnormalities of coronary circulation at the level of the intramyocardial vasculature in the stage before impairment of cardiac function, myocardial fibrosis and functional abnormalities of the cell membrane level that were not dependent on myocardial ischemia. (author).
Energy Technology Data Exchange (ETDEWEB)
Morota, Motoi; Kobayashi, Yasuhiko [Tokyo Medical Coll. (Japan)
1999-02-01
We investigated retrospectively the clinical significance of large perfusion defect on {sup 201}Thallium myocardial scintigraphy from the records of 833 patients during the past 3 years from 1991 to 1994. The patients were divided into 3 groups according to the extent of perfusion defect; cases with normal perfusion (n=561), with small perfusion defect (n=211) and with large perfusion defect (n=61). We found that the proportions of cases with large perfusion defect was significantly larger than that of cases with small perfusion defect in myocardial disease (MD; hypertrophic cardiomyopathy, dilated cardiomyopathy, and post myocarditis combined) (P<0.001). Analyzing patients with ischemic heart disease (IHD; angina pectoris and myocardial infarction) according to the severity of coronary artery lesion, the proportion of cases with large perfusion defect was significantly larger than that of cases with small perfusion defect in 3 vessel disease (P<0.001). Incidence of diabetes mellitus was significantly higher in patients with IHD than in those with MD in large perfusion defect group (P<0.01). As for symptoms in large perfusion defect group, the incidences of chest pain, chest oppression, and chest discomfort were significantly higher in patients with IHD than in those with MD (P<0.001), whereas the incidences of palpitation and shortness of breath were significantly higher in patients with MD (P<0.001). These results suggest that IHD with multiple artery lesions and MD underlie large perfusion defect on {sup 201}Thallium myocardial scintigraphy and that complication of diabetes mellitus and clinical symptoms may be useful in differentiating IHD from MD. (author)
An expert protocol for immunofluorescent detection of calcium channels in tsA-201 cells.
Koch, Peter; Herzig, Stefan; Matthes, Jan
Pore-forming subunits of voltage gated calcium channels (VGCC) are large membrane proteins (260kDa) containing 24 transmembrane domains. Despite transfection with viral promoter driven vectors, biochemical analysis of VGCC is often hampered by rather low expression levels in heterologous systems rendering VGCC challenging targets. Especially in immunofluorescent detection, calcium channels are demanding proteins. We provide an expert step-by-step protocol with adapted conditions for handling procedures (tsA-201 cell culture, transient transfection, incubation time and temperature at 28°C or 37°C and immunostaining) to address the L-type calcium-channel pore Cav1.2 in an immunofluorescent approach. We performed immunocytochemical analysis of Cav1.2 expression at single-cell level in combination with detection of different markers for cellular organelles. We show confluency levels and shapes of tsA-201 cells at different time points during an experiment. Our experiments reveal sufficient levels of Cav1.2 protein and a correct Cav1.2 expression pattern in polygonal shaped cells already 12h after transfection. A sequence of elaborated protocol modifications allows subcellular localization analysis of Cav1.2 in an immunocytochemical approach. We provide a protocol that may be used to achieve insights into physiological and pathophysiological processes involving voltage gated calcium channels. Our protocol may be used for expression analysis of other challenging proteins and efficient overexpression may be exploited in related biochemical techniques requiring immunolabels. Copyright © 2016 Elsevier Inc. All rights reserved.
ACCUMULATION OF POLYHYDROXYALKANOIC ACIDS BY AZOTOBACTER CHROOCOCCUM MAL-201 FROM ORGANIC WASTE
Directory of Open Access Journals (Sweden)
Soma Pal Saha
2013-08-01
Full Text Available Azotobacter chroococcum MAL-201 (MTCC 3853, a free-living nitrogen-fixing bacterium accumulated intracellular poly(3-hydroxybutyric acid [P(3HB] accounting 69% of cell dry weight (CDW when grown in nitrogrn-free Stockdale medium containing 2% (w/v glucose. It also produced copolymer of poly(3-hydroxybutyrate co-3-hydroxyvalerate [P(3HB-co-3HV] using glucose as primary carbon source and valerate cas cosubstrate. To make the polymer production cost effective four types of waste material of different origin were tested for growth and polymer production. Stockdale medium supplemented with 1% (w/v waste materials failed to yield good growth and polymer accumulation. Two–step cultivation was adopted for better growth and enhanced polymer accumulation. The candy factory waste was most suitable for synthesis of P(3HB accounting 17.8 and 40.58% using single and two-step cultivation conditions respectively. Wastes of domestic and poultry origin produced P(3HB-co-3HV with 3HV content 28.8 and 21.5 mol% respectively in two-step cultivation. Increase concentration of these wastes resulted in further upliftment of 3HV content of polymer with reduced growth and polymer accumulation. However, at optimum incubation the strain MAL-201 cells accumulated P(3HB 48.5% of CDW (at 40h from candy factory waste and P(3HB-co-3HV 24.75 % of CDW with 3HV 34.65 mol % from domestic waste. Intrinsic viscosity, molecular weight and thermal degradation of the polymers accumulated in the cells grown in glucose, glucose with valerate and glucose with waste were compared.
Wu, Yen-Wen; Huang, Por-Jau; Lee, Chii-Ming; Ho, Yi-Lwun; Lin, Lung-Chun; Wang, Tzung-Dau; Wang, Shoei-Shen; Chen, Tony Hsiu-Hsi; Yen, Ruoh-Fang
2005-01-01
This study compared technetium 99m sestamibi/fluorine 18 fluorodeoxyglucose dual-isotope simultaneous acquisition (DISA) with stress-reinjection thallium 201 single photon emission computed tomography (SPECT) with regard to their ability to detect myocardial viability. The study cohort consisted of 42 angiographically significant coronary artery disease patients with symptomatic congestive heart failure or regional wall motion abnormalities. In total, 398 dysfunctional segments in 40 patients were analyzed (2 patients were excluded because of poor-quality F-18 fluorodeoxyglucose images). Of the segments, 217 were diagnosed as viable and 144 as nonviable by both DISA and Tl-201, 33 were viable by DISA but nonviable by Tl-201, and 4 were viable by Tl-201 but nonviable by DISA. Most discrepancies were in the inferior wall. Of the 40 patients, 16 underwent revascularization. From the follow-up results for the 105 dysfunctional segments in these 16 patients, DISA viability appears to be a significant predicting factor (P = .014) for functional recovery after revascularization statistically whereas Tl-201 viability does not (P = .09). Our study suggests that DISA viability provides more accurate prediction of postrevascularization functional recovery than Tl-201 viability. Given the small number of patients who underwent revascularization, the superiority of DISA over Tl-201 in detecting myocardial viability may be firmly established by further study on a large scale for patients with profound left ventricular dysfunction.
Directory of Open Access Journals (Sweden)
Ming-Che Wu
2015-11-01
Full Text Available We analyzed the left-ventricular functional data obtained by cardiac-gated single-photon emission computed tomography myocardial perfusion imaging (MPI with thallium-201 (Tl-201 and technetium-99m-sestamibi (MIBI protocols in different groups of patients, and compared the data between Tl-201 and MIBI. Two hundred and seventy-two patients undergoing dipyridamole stress/redistribution Tl-201 MPI and 563 patients undergoing 1-day rest/dipyridamole stress MIBI MPI were included. Higher mean stress ejection fraction (EF, rest EF, and change in EF (ΔEF were noticed in the normal MPI groups by both Tl-201 and MIBI protocols. Higher mean EF was observed in the females with normal MPI results despite their higher mean age. Comparisons between the Tl-201 and MIBI groups suggested a significant difference in all functional parameters, except for the rest end diastolic volume/end systolic volume and ΔEF between groups with negative MPI results. For the positive MPI groups, there was no significant difference in all parameters, except for the change in end diastolic volume and change in end systolic volume after stress between both protocols. The Tl-201 provides comparable left-ventricular functional data to MIBI cardiac-gated single-photon emission computed tomography in patients with positive MPI results, and may therefore be undertaken routinely for incremental functional information that is especially valuable to this patient group.
Energy Technology Data Exchange (ETDEWEB)
Lee, Jae Tae; Kim, Eun Ji; Ahn, Byeong Cheol; Son, Kang Kyun; Lee, Kyu Bo [Kyungpook National University School of Medicine, Taegu (Korea, Republic of); Ha, Jeoung Hee [Youngnam University Medical School, Taegu (Korea, Republic of); Kim, Chun Ki [Mt. Sinai School of Medicine, New York (United States)
1996-10-15
Potassium channel opener (K-opener) opens ATP-sensitive K{sup +}-channel located at membrane and induces potassium efflux from cytosol, resulting in intracellular hyperpolarization. Newly synthesized K-opener is currently examined for pharmacologic potency by means of rubidium release test from smooth muscle strip preincubated with Rb-86. Since in-vive behavior of thallium is similar to that of rubidium, we hypothesized that K-opener can alter T1-201 kinetics in vivo. This study was prepared to investigate the effects of pinacidil (one of potent K-openers) on the T1-201 uptake and clearance in cultured myocyte, and in-vivo biodistribution in mice. Spontaneous contracting myocytes were prepared to imitate in-vivo condition from 20 hearts of 3-5 days old Sprague-Dawley rat and cultured for 3-5 days before use (5 X 105 cells/ml). Pinacidil was dissolved in 10% DMSO solution at a final concentration of 100nM or 10uM and was co-incubated with T1-201 in HBSS buffer for 20-min to evaluate its effect on cellular T1-uptake, or challenged to cell preparation pre-incubated with T1-201 for washout study. Two, 40 or 100 mg of pinacidil was injected intravenously into ICR mice at 10 min after 5 muCi T1-201 injection, and organ uptake and whole body retention rate were measured at different time points. Co-incubation of pinacidil with T1-201 resulted in a decrease in T1-201 uptake into cultured myocyte by 1.6 to 2.5 times, depending on pinacidil concentration and activity of T1-201 used. Pinacidil enhanced T1-201 washout by 1.6-3.1 times from myocyte preparations pre-incubated with T1-201. Pinacidil treatment appears to be resulted in mild decreases in blood and liver activity in normal mice, in contrast, renal and cardiac uptake were mildly decreased in a dose dependent manner. Whole body retention ratios of T1-201 were lower at 24 hour after injection with 100 mg of pinacidil than control. These results suggest that treatment with K-opener may affect the interpretation of T1-201
Energy Technology Data Exchange (ETDEWEB)
Satake, Osamichi [Kanazawa Medical Univ. (Japan)
1999-03-01
Syndrome X is a microvascular disease. However, the relationship between microvascular ischemia and histopathological findings remains unknown. The present study was performed to evaluate the myocardial perfusion and metabolism of patients with Syndrome X using {sup 201}Tl-SPECT and {sup 18}FDG-PET, and to clarify the morphological characteristics with a ventricular myocardial biopsy. We examined 24 patients with Syndrome X and 5 patients with myocarditis as a control group. In the study using {sup 201}Tl-SPECT and {sup 18}FDG-PET, we evaluated the presence or absence of myocardial ischemia. We calculated the Standardized Uptake Value (SUV) (%dose/ml) of {sup 18}FDG, and analyzed quantitatively the degree of ischemia. For histopathologic study on coronary microcirculation, we performed a right ventricular myocardial biopsy. The biopsies were examined light and electron microscopically. The semithin sections, stained with toluidine blue, were projected onto a screen. Microvessels were counted and the ratio of microvascular luminal narrowing and the number of microvessels per unit area were determined. The study using {sup 201}Tl-SPECT and {sup 18}FDG-PET showed that hypoperfusion of {sup 201}Tl was found in 17 of 24 (71%) patients during {sup 201}Tl-loaded myocardial scanning together with redistribution of {sup 201}Tl at the same regions; {sup 18}FDG-uptake were found in all 24 patients during {sup 18}FDG-PET performed under resting and fasting conditions; the SUV of {sup 18}FDG in the Syndrome X group (0.025{+-}0.039 %dose/ml) was significantly different from that of the control group (0.003{+-}0.002 %dose/ml) (p<0.01). Histopathological observations under the both light and electron microscope showed that an increment in number of the endothelial cells with swelling, a marked luminal narrowing due to the hypertrophy of the arteriolar media and the capillary walls, and a compression of the capillaries were shown in all the patients; the ratio of luminal narrowing
Optimisation of the solution heat treatment of Rheo-processed Al-Cu-Mg-(Ag) Alloys A206 and A201
CSIR Research Space (South Africa)
Masuku, EP
2009-06-01
Full Text Available The traditional solution treatment cycles that are currently applied to rheo-processed A201 are mostly those that are used for conventional castings. These solution treatments are not necessarily the optimum solution treatments for rheo...
Energy Technology Data Exchange (ETDEWEB)
Pichard, A.D.; Wiener, I.; Martinez, E.; Horowitz, S.; Patterson, R.; Meller, J.; Goldsmith, S.J.; Gorlin, R.; Herman, M.V.
1981-07-01
The use of myocardial perfusion imaging (MPI) to identify obstructive coronary disease of the left anterior descending coronary artery proximal to the first septal perforator (prox LAD) was studied in 60 patients. Perfusion of the septum and anteroapical areas with thallium-201 injected during exercise was compared to results of coronary arteriography. Septal MPI defect was found in 92.3% of patients with obstruction of the proximal LAD, 27.7% of patients with obstruction of LAD distal to first septal perforator, 0% in patients with obstructions involving right or circumflex arteries, and in 10.5% of patients without coronary disease. Anteroapical MPI defects were found with similar frequency in the three groups with obstructive coronary disease. Septal MPI defect had a sensitivity of 92.3% and specificity of 85.4% in the diagnosis of proximal LAD disease. Normal septal perfusion with thallium-201 virtually excluded proximal LAD disease.
Energy Technology Data Exchange (ETDEWEB)
Thomas, B.L.; Evans, J.C.; Pool, K.H.; Olsen, K.B.; Fruchter, J.S.; Silvers, K.L.
1997-01-01
This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-C-201 (Tank C-201) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, on sample volumes provided by WHC. A summary, of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in a table. Detailed descriptions of the analytical results appear in the appendices.
Energy Technology Data Exchange (ETDEWEB)
Tawarahara, Kei; Kurata, Chinori; Taguchi, Takahisa; Aoshima, Shigeyuki; Okayama, Kenichi; Kobayashi, Akira; Yamazaki, Noboru; Kaneko, Masao (Hamamatsu Univ. School of Medicine, Shizuoka (Japan))
1994-02-01
To assess the clinical value of simultaneous dual myocardial imaging with iodine-123-[beta]-methyl-iodophenyl-pentadecanoic acid ([sup 123]I-BMIPP) and thallium-201 ([sup 201]TL), myocardial imaging was performed at rest and during execise in seven patients with coronary heart disease. When [sup 123]I-BMIPP and [sup 201]Tl images were compared, the initial exercise and resting images agreed 87% and 64%, respectively. In the initial resting images, the regional uptake of [sup 123]I-BMIPP was frequently less than that of [sup 201]Tl. The incidence of exercise-induced reversible defects by [sup 201]Tl in the Tl>BMIPP regions was significantly higher than that in the Tl=BMIPP regions (57% vs 4%, p<0.01) and the incidence of coronary narrowing of more than 90% in the Tl>BMIPP regions was also significantly higher than that in the Tl=BMIPP regions (91% vs 38%, p<0.01). In addition, this disparity (Tl>BMIPP) was found more frequently in regions with abnormal wall motion than in regions with normal wall motion (hypokinetic regions; 68%, severe hypokinetic or akinetic regions; 50%, vs normokinetic regions; 4%, p<0.01). In contrast, the uptake of [sup 123]I-BMIPP correlated closely with that of [sup 201]Tl in normal myocardium and the uptake of both [sup 123]I-BMIPP and [sup 201]Tl was severely reduced in myocardium with severe ischemia during exercise and prior infarction. These results indicate that dual myocardial imaging with [sup 123]I-BMIPP and [sup 201]Tl may provide a unique means of identifying patients with metabolically disturbed myocardium, such as hibernating and stunned myocardium. (author).
Starick, Lisa; Riano, Felipe; Karunakaran, Mohindar M; Kunzmann, Volker; Li, Jianqiang; Kreiss, Matthias; Amslinger, Sabine; Scotet, Emmanuel; Olive, Daniel; De Libero, Gennaro; Herrmann, Thomas
2017-06-01
Phosphoantigens (PAgs)-like HMBPP ((E)-4-hydroxy-3-methyl-but-2-enyl diphosphate) and butyrophilin 3 (BTN3A, CD277)-specific monoclonal antibody 20.1 induce TCR-mediated activation of Vγ9Vδ2 T cells. Here, we compared murine reporter cells transduced with Vγ9Vδ2 TCRs G115, D1C55, and MOP for the activation in culture with human RAJI cells and PAgs or mAb 20.1 and its single-chain (sc) derivative. All transductants responded readily to PAg but only TCR MOP γ-chain-expressing cells responded to mAb/sc 20.1. Furthermore, both antagonist and agonist mAb and sc of the agonist mAb inhibited the PAg response of TCR-transduced murine reporter cells. These findings suggest that, in contrast to stimulation by physiological stimulators (PAg), the responsiveness to mAb 20.1 depends strongly on CDR3 sequences of the TCR, and that mAb 20.1 can interfere with the PAg-response. Mouse or human origin of reporter cells might affect the mAb 20.1 response since all three TCR-mediated mAb 20.1-induced activation of TCR-transduced Jurkat cells. The pronounced differences between PAg and mAb 20.1-induced activation observed here help to understand the often contradictory published data. This study provides novel perspectives on the physiological mechanism of Vγ9Vδ2 T-cell activation, and highlights the complex mode of action of BTN3A-specific antibodies as agents in cancer immunotherapy. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Souza Filho, I.R. [Escola de Engenharia de Lorena, University of Sao Paulo, 12602-810 Lorena (Brazil); Sandim, M.J.R., E-mail: msandim@demar.eel.usp.br [Escola de Engenharia de Lorena, University of Sao Paulo, 12602-810 Lorena (Brazil); Cohen, R.; Nagamine, L.C.C.M. [Instituto de Física, University of Sao Paulo, 05314-970 Sao Paulo (Brazil); Hoffmann, J. [Karlsruher Institut für Technologie, D-72061 Karlsruhe (Germany); Bolmaro, R.E. [Instituto de Física Rosario, CONICET-UNR, 2000 Rosario (Argentina); Sandim, H.R.Z. [Escola de Engenharia de Lorena, University of Sao Paulo, 12602-810 Lorena (Brazil)
2016-12-01
Strain-induced martensite (SIM) and its reversion in a cold-rolled AISI 201 austenitic stainless steel was studied by means of magnetic properties, light optical (LOM) and scanning electron (SEM) microscopy, electron backscatter diffraction (EBSD), texture measurements, and Vickers microhardness testing. According to Thermo-calc© predictions, the BCC phase (residual δ-ferrite and SIM) is expected to be stable until 600 °C. The current material was cold rolled up to 60% thickness reduction and submitted to both isothermal and stepwise annealing up to 800 °C. Magnetic measurements were taken during annealing (in situ) of the samples and also for their post mortem conditions. The Curie temperatures (T{sub c}) of residual δ-ferrite and SIM have similar values between 550 and 600 °C. Besides T{sub c}, the focused magnetic parameters were saturation magnetization (M{sub s}), remanent magnetization (M{sub R}), and coercive field (H{sub c}). SIM reversion was found to occur in the range of 600–700 °C in good agreement with Thermo-calc© predictions. The microstructures of the material, annealed at 600 and 700 °C for 1 h, were investigated via EBSD. Microtexture measurements for these samples revealed that the texture components were mainly those found for the 60% cold rolled material. This is an evidence that the SIM reversion occurred by an athermal mechanism. - Highlights: • H{sub c} and M{sub R}/M{sub S} ratio give information about distribution of strain-induced martensite. • According to Thermo-calc©, the BCC phase in AISI 201 steel is stable until 600 °C. • Thermo-calc predictions agrees with magnetic properties of AISI 201 steel. • Possible magnetic anisotropy induced by rolling in AISI 201 steel is investigated.
A Bahrami-Ahmadi; AH Fatemi; M. GOLESTAN
2008-01-01
Introduction: Hyperbilirubinemia is a common benign problem in neonates. Nonetheless, if untreated, severe hyperbilirubinemia is potentially neurotoxic. The standard method for diagnosis of hyperbilirubinemia is determination of serum bilirubin levels in the laboratory that requires a blood sample which is both painful and stressful for neonates and entails cost and time. The objective of this study was to study the correlation between transcutaneous bilirubin levels (JH 20-1 bilirobinometer)...
Energy Technology Data Exchange (ETDEWEB)
Sueda, Shozo; Mineoi, Kazuaki; Kondou, Tadashi [Takanoko Hospital, Matsuyama, Ehime (Japan)] [and others
1998-04-01
The usefulness of thallium-201 ({sup 201}Tl) myocardial scintigraphy was studied in 109 patients with vasospastic angina who had nearly normal coronary arteries (degree of stenosis <50%). Coronary spasm was confirmed by pharmacologic agents in all 109 patients from January 1991 to June 1996. The appearance rate of visual redistribution on {sup 201}Tl myocardial scintigraphy was compared between four groups, 34 patients performing graded bicycle ergometer exercise starting at a work load of 50 W with increments of 25 W every 3 min (Ergo(3) group), 14 patients performing hyperventilation for 5 min (HV(5) group), 31 patients performing bicycle ergometer exercise with increments of 25 W every 1 min after 5 min hyperventilation (HV(5)+Ergo(1) group), and 30 patients at rest (Rest group). The value of the visual redistribution rate on {sup 201}Tl myocardial scintigrams in the HV(5)+Ergo(l) group (65%) was higher than that in the patients of other groups (Ergo(3) 41%, HV(5) 43%, Rest 33%). However, there were no significant differences between the four groups. Stress {sup 201}Tl imaging after hyperventilation and accelerated exercise is useful to disclose ischemic evidence in about two thirds of patients with vasospastic angina and nearly normal coronary arteries, whereas about 40% of patients had visual redistribution on {sup 201}Tl myocardial scintigrams by performing standard procedures. (author)
Zhang, Qingwen; Wang, Qiong; Tian, Guang; Qi, Zhizhen; Zhang, Xuecan; Wu, Xiaohong; Qiu, Yefeng; Bi, Yujing; Yang, Xiaoyan; Xin, Youquan; He, Jian; Zhou, Jiyuan; Zeng, Lin; Yang, Ruifu; Wang, Xiaoyi
2014-01-01
Yersinia pestis biovar Microtus is considered to be a virulent to larger mammals, including guinea pigs, rabbits and humans. It may be used as live attenuated plague vaccine candidates in terms of its low virulence. However, the Microtus strain's protection against plague has yet to be demonstrated in larger mammals. In this study, we evaluated the protective efficacy of the Microtus strain 201 as a live attenuated plague vaccine candidate. Our results show that this strain is highly attenuated by subcutaneous route, elicits an F1-specific antibody titer similar to the EV and provides a protective efficacy similar to the EV against bubonic plague in Chinese-origin rhesus macaques. The Microtus strain 201 could induce elevated secretion of both Th1-associated cytokines (IFN-γ, IL-2 and TNF-α) and Th2-associated cytokines (IL-4, IL-5, and IL-6), as well as chemokines MCP-1 and IL-8. However, the protected animals developed skin ulcer at challenge site with different severity in most of the immunized and some of the EV-immunized monkeys. Generally, the Microtus strain 201 represented a good plague vaccine candidate based on its ability to generate strong humoral and cell-mediated immune responses as well as its good protection against high dose of subcutaneous virulent Y. pestis challenge.
Energy Technology Data Exchange (ETDEWEB)
Taniguchi, Yoko; Sugihara, Hiroki; Ootsuki, Katsuichi (Kyoto Prefectural Univ. of Medicine (Japan)) (and others)
1993-01-01
Effect of verapamil on myocardial ischemia in patients with hypertrophic cardiomyopathy (HCM) was evaluated by exercise stress myocardial [sup 201]Tl SPECT (EX-Tl). EX-Tl was performed before and after 8.8 weeks of oral verapamil (240 mg/day) in 12 patients with HCM who showed transient [sup 201]Tl perfusion defects under control conditions. [sup 201]Tl perfusion defect was visually scored and judged for 4 grades as normal (0), mild defect (1), moderate defect (2), and severe defect (3). Transient dilation index (TDI) was calculated as an index of subendocardial ischemia. Improvements of defect score were demonstrated in 10 patients after administration of verapamil. Two patients showed no change of defect score. Mean defect score decreased significantly from 5.50 to 3.03 (p<0.001). Although 11 of 12 patients showed abnormal TDI under control conditions, 10 of these revealed improvements of TDI and 7 of the 10 disclosed normal TDI after verapamil. Mean TDI decreased from 1.263 to 1.090 significantly (p<0.01). In conclusion, verapamil may improve myocardial ischemia in patients with HCM. (author).
Directory of Open Access Journals (Sweden)
Arundhati Pal
2013-01-01
Full Text Available Extracellular polymeric substances (EPS are complex biopolymers produced by a wide array of microorganisms for protection against dessication, aggregation, adhesion, and expression of virulence. Growth associated production of EPS by Ni-resistant Cupriavidus pauculus KPS 201 was determined in batch culture using sodium gluconate as the sole carbon source. The optimum pH and temperature for EPS production were 6.5 and 25°C, respectively. Optimal EPS yield (118 μg/mL was attained at 0.35% Na-gluconate after 72 h of growth. Cupriavidus KPS 201 cells also utilized glutamate, acetate, pyruvate, fumarate, malate, malonate, formate, citrate, and succinate for EPS production. Although EPS production was positively influenced by the increase of nitrogen and phosphate in the growth medium, it was negatively influenced by nickel ions. Compositional analysis of the purified EPS showed that it is a homopolymer of rhamnose containing uronic acid, protein, and nucleic acid. Presence of lipids was also detected with spectroscopy. Non-destructive EPS mediated biofilm formation of KPS 201 was also visualized by epifluorescence microscopy.
Localization of post-infarction myocardial ischemia by /sup 201/Tl emission computed tomography
Energy Technology Data Exchange (ETDEWEB)
Spielmann, R.P.; Heinemann, H.; Montz, R.; Nienaber, C.A.
1985-12-01
In 41 patients with a history of a single myocardial infarction, the location of myocardial ischemia was studied by /sup 201/Tl emission computed tomography immediately and 3 h after intravenous dipyridamole. Peri-infarctional ischemia without distant ischemia was observed in 15 patients. The occurrence of distant ischemia was found to be dependent on the severity of stenosis in non-infarct coronary vessels. Twelve (86%) of 14 patients with non-infarct stenosis of 75% or greater had distant ischemia, but only 1 (4%) of 27 patients with non-infarct stenosis of less than 75%. In the presence of distant ischemia, peri-infarctional ischemia was in 11 patients (85%) associated with collaterals supplying the infarct zone, whereas in 13 (87%) of the patients with peri-infarctional ischemia only, incomplete obstruction of the infarct vessel was observed. It is concluded that, by the distinction between peri-infarctional and distant ischemia, the presence of significant stenosis in non-infarct vessels can be non-invasively predicted from tomographic thallium scintigraphy with dipyridamole.
Effect of acetic acid on corrosion behavior of AISI 201, 304 and 430 stainless steels
Energy Technology Data Exchange (ETDEWEB)
Vashishtha, Himanshu; Taiwade, Ravindra V.; Sharma, Sumitra [Visvesvaraya National Institute of Technology (VNIT), Nagpur (India). Dept. of Metallurgical and Materials Engineering
2017-05-15
Austenitic stainless steels are often used to handle organic acids such as acetic acid (CH{sub 3}COOH), which are extensively used in food contact applications and chemical industries for manufacturing medicines, nutrition and various chemical amalgams. In the present investigation an attempt has been made to compare the corrosion behavior of Cr-Ni (AISI type 304), Cr-Mn-Ni (type 201) and Cr (type 430) stainless steel for economical replacement of higher cost Cr-Ni grade. Immersion testing was performed at room temperature and boiling temperature in acetic acid. Atomic absorption spectroscopy was carried out to evaluate metal ion concentration in the immersion solution. The surface morphology of pit formation was characterized using scanning electron microscopy coupled with energy dispersive X-ray spectroscopy. The effect of elemental leaching on electrical conductivity of the immersion solution was evaluated and correlated with pH measurements. A new mechanism has been proposed for the pit formation due to manganese sulfide inclusions. The replacement compatibility was further confirmed with anodic polarization testing and a successful replacement was established for room temperature applications.
Follow-up Thallium-201 scintigraphy after mantle field radiotherapy for Hodgkin's disease
Energy Technology Data Exchange (ETDEWEB)
Pierga, J.Y.; Girinski, T.; Henry-Amar, M. (Institut Gustave Roussy, Villejuif (France)); Maunoury, C.; Valette, H.; Tchernia, G.; Desgrez, A. (Centre Hospitalier de Bicetre, Le Kremlin-Bicetre (France)); Socie, G. (Institut Gustave Roussy, Villejuif (France) Hopital St Louis, Paris (France)); Cosset, J.M. (Institut Gustave Roussy, Villejuif (France) Institut Curie, Paris (France))
1993-04-02
Assessment of the long-term cardiac effects of mediastinal radiotherapy for Hodgkin's disease, by Thallium scintigraphy. 32 patients (14 males and 18 females) who underwent mantle field radiotherapy for Hodgkin's disease were included in this study. Twenty patients received 4 fractions of 2.5 Gy per week and 12, five fraction of 2 Gy per week, delivered on alternate days. All the patients, except three, performed exercise testing electrocardiogram and Thallium-201 tomoscintigraphy. The average time interval from completion of treatment to the study was 7 years (range 3--13 years). No patients had clinical symptoms of cardiac disease. Mean age at the time of the study was 35 years (range 23--48 years). Two electrocardiograms revealed left bundle branch block and the patients were excluded from the study. Only one out of 27 exercise electrocardiograms was abnormal in a patient with mitral valve prolapse, who was also excluded from the study. Twenty-six scintigraphies were evaluable. Twenty-two (85%) were clearly abnormal with partial or complete redistribution on delayed images. The anterior region was affected in 19 of these cases (86%). Four explorations were undoubtedly normal. Coronary angiography was not performed for ethical reasons in these asymptomatic patients. Despite possible false positive tests, the high rate of abnormality (85%) in this small series is striking. These preliminary data justify larger studies and a close long-term follow-up of these patients. 24 refs., 1 fig., 2 tabs.
Digas, Georgios; Thanner, Jonas; Nivbrant, Bo; Röhrl, Stephan; Ström, Håkan; Kärrholm, Johan
2003-10-01
We evaluated polyethylene wear by measuring femoral head penetration in 201 THA (median age 62 (31-81) years, 117 women) extracted from 5 randomized studies aimed to assess various fixation principles. There were 30 cemented all-polyethylene Lubinus cups sterilized by gamma irradiation in a reduced oxygen environment, 65 porous-coated Trilogy cups with liners gamma-sterilized in inert gas. Moreover, 37 cemented cups were sterilized with ethylene oxide (Reflection all-poly) and 69 porous-coated cups had liners sterilized in ethylene oxide (Reflection). 28 mm femoral heads were used in all cups. The patients were followed with repeated radiostereometric measurements (RSA) up to 2 years. The activity level of the patients was evaluated by a questionnaire. After 2 years, cups with polyethylene sterilized in EtO had almost twice the proximal and 3D penetration rates, as compared with gamma-sterilized polyethylene. The penetration did not differ between the gamma-irradiated designs. Using stepwise linear regression analysis, we found that the type of sterilization, age and weight were the most important predictors and that they determined the direction of the proximal penetration rate. Activity score, male gender and proximal migration of the cup had little effect. The accelerated wear observed with the EtO-sterilized polyethylene causes concerns about long-term problems and especially in younger patients.
Evaluation of myocardial damage in Duchenne's muscular dystrophy with thallium-201 myocardial SPECT
Energy Technology Data Exchange (ETDEWEB)
Tamura, Takuhisa; Shibuya, Noritoshi (Kawatana National Hospital, Nagasaki (Japan)); Hashiba, Kunitake; Oku, Yasuhiko; Mori, Hideki; Yano, Katsusuke
1993-01-01
Myocardial damage and cardiopulmonary functions in patients with Duchenne's muscular dystrophy (DMD) were assessed using thallium-201 myocardial single-photon emission computed tomography (SPECT) and technetium-99m multigated radionuclide angiography. Twenty-five patients with DMD were divided into 4 groups according to percent of perfusion defect (%PD) calculated by the bull's-eye method and age. PD was detected in 24 (96.0%) of 25 patients with DMD, and it spread from the left ventricular lateral wall to the anterior wall and/or interventricular septum. PD was detected even in a 6-year-old DMD boy. Patients in Group I (%PD[>=]10% and age<15 years old) were shown to have a higher risk of left-sided heart failure without respiratory failure. Patients in Group II (%PD[>=]10 and age[>=]15) showed decreased pulmonary function and worsened arterial blood gas values as compared with Group IV (%PD<10 and age[>=]15). There was no significant difference in cardiac function among the 4 groups. It is postulated that myocardial damage in Group II patients is dependent primarily on a deficiency of dystrophin and on chronic respiratory failure, and that some of them are at risk of cardiopulmonary failure. It is concluded that myocardial SPECT is useful for the early diagnosis of myocardial damage and evaluation of cardiopulmonary function in DMD patients. (author).
Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott
2012-12-12
Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.
Production of Astatine-211 at the Duke University Medical Center for its regional distribution
Energy Technology Data Exchange (ETDEWEB)
Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)
2016-01-01
Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.
Wagner, Jessica; Leah Kline, C.; Zhou, Lanlan; Khazak, Vladimir; El-Deiry, Wafik
2018-01-01
Analysis of regorafenib and ONC201 mechanism in combination. A) HUVEC representative images of sprouting from HUVECs grown on Matrigel. B) Quantitation of HUVEC sprouting and branching after 12 hours. C) HCT116 cells from live cell imaging using CHOP-800 and Actin-700 on LiCor Odyssey. Cells treated for 48 hours. ONC201: 5 μM. HUVECS N=4, ONC201 treatment 5 μM, Regorafenib 1 mg/ml. (PPTX 623 kb)
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Declaration of presence of FD&C Yellow No. 5 and/or FD&C Yellow No. 6 in certain drugs for human use. 201.20 Section 201.20 Food and Drugs FOOD AND... General Labeling Provisions § 201.20 Declaration of presence of FD&C Yellow No. 5 and/or FD&C Yellow No. 6...
Acupuncture for soft tissue shoulder disorders: a series of 201 cases.
Guerra, Juan; Bassas, Elena; Andres, Maria; Verdugo, Francisco; Gonzalez, Maria
2003-06-01
A retrospective observational study was performed on shoulder pain cases seen in a community general practice. Two hundred and one patients were treated with acupuncture (on distant points plus local shoulder points), moxibustion and auriculotherapy. Data was retrieved from records over a three-year period to assess the effect of acupuncture and moxibustion on pain, mobility and disability, and to compare perceived efficacy rates with published reports from Chinese acupuncturists. Using a four-point outcome scale in this series of 201 patients the study found: one patient (0.5%) reported no improvement, 12 (6%) simple improvement, 68 (33.8%) remarkable improvement, and 120 (59.7%) clinical resolution. Only two patients left the programme. In conclusion, treatment of soft tissue shoulder disorders with acupuncture and moxibustion in this series seems to have good clinical results in diminishing symptoms, shortening disease duration time and improving functional ability, even in long-lasting disease (up to 10 years). A combination of distant points plus local points, moxibustion and auriculotherapy seems to increase effectiveness, reduce the number of sessions per patient, and increase the time between sessions, suiting the needs of patients and those of a busy National Health Service clinic. The authors report results similar to those reported by Chinese acupuncturists when using similar diagnostic procedures, techniques, outcome measures and patients. This case series is the first step towards conducting a randomised controlled trial (RCT) of acupuncture efficacy in shoulder pain. Such trials are needed to confirm the perceived efficacy of acupuncture from observational studies.
{sup 201}Thallium SPECT, accuracy in astrocytoma diagnosis and treatment evaluation
Energy Technology Data Exchange (ETDEWEB)
Kaellen, K
1999-10-01
The aims of the studies included in this thesis were: - to investigate the reliability of {sup 201}Thallium single photon emission computed tomography. Tl SPECT for preoperative diagnosis and histological staging of malignant astrocytomas in comparison with CT; - to develop a method for quantification of cerebral thallium uptake, and to evaluate the quantitative measurement in comparison with CT, for astrocytoma treatment follow-up purposes; - to compare quantitative Tl SPECT and proton magnetic resonance spectroscopy (H-MRS) with conventional MR imagingfor astrocytoma monitoring, and to evaluate associations between change of morphological tumour characteristics during treatment and changes of cerebral thallium uptake and metabolic ratios. Results and conclusions: - High TI-index, calculated as a ratio comparing tumour uptake to uptake in the contralateral hemisphere, is an indicator of highly malignant astrocytoma. Differentiation between the high-grade astrocytomas, the low-grade astrocytomas, and infectious lesions is only partial, with an overlap of Tl-indexes between these groups. High-grade astrocytomas that do not show contrast enhancement on CT, and astrocytomas with central necrosis and moderate ring-enhancement, tend to be underestimated when evaluated by Tl-index calculation. Tl SPECT is not a reliable method for non-invasive tumour staging among the group of highly malignant astrocytomas. - Quantification of cerebral TI-uptake, defining the volume of viable tumour tissue, is a new method for astrocytoma chemotherapy monitoring. Results suggest that the method provides prognostic information, and information of treatment efficacy, at an earlier stage than CT. - We did not find a higher accuracy of quantitative Tl SPECT than of MR for monitoring purposes and our results indicated that treatment induced MR changes were interrelated with TI-uptake variations. - Multi-voxel H-MRS was difficult to apply for astrocytoma treatment monitoring, due to the
Usefulness of thallium-201 SPECT in the evaluation of tumor natures in intracranial meningiomas
Energy Technology Data Exchange (ETDEWEB)
Takeda, Tetsuji; Nakano, Takahiro; Asano, Kenichiroh; Shimamura, Norihito; Ohkuma, Hiroki [Hirosaki University Graduate School of Medicine, Department of Neurosurgery, Hirosaki (Japan)
2011-11-15
Although intracranial meningiomas are regarded as benign tumors, some of them behave clinically as malignant tumors. Past reports suggest that MIB 1 and vascular endothelial growth factor (VEGF) in postoperative tumor specimens correlate with the aggressive nature of tumors, but preoperative prediction of such a nature is more useful for therapeutic planning for the tumor. The purpose of this study was to assess the usefulness of preoperative thallium-201 chloride single-photon emission computed tomography (Tl SPECT) to evaluate biological behavior in intracranial meningiomas. Tl SPECT was performed on 39 patients with intracranial meningioma and Tl uptake indices were calculated. The difference in the Tl uptake index between atypical meningiomas and other pathological types of meningioma was evaluated. Moreover, correlation of Tl uptake indices with the MIB1 labeling index was estimated. Tl uptake indices were also compared between VEGF strongly positive and weakly positive meningiomas. The delayed index of atypical meningioma was significantly higher than that of the other pathological types (p = 0.036). Significant correlation was found between the Tl uptake index in the delayed image and MIB1 labeling index (p < 0.0001, R{sup 2} = 0.36). Moreover, VEGF strongly positive meningiomas exhibited a significantly higher Tl uptake index compared to VEGF weakly positive meningiomas in both the early image and the delayed image (p = 0.029, 0.023, respectively). Tl uptake index may be a possible preoperative surrogate marker of MIB1 and VEGF that is useful in detecting aggressive natures in intracranial meningiomas. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Knesaurek, Karin; Machac, Josef [Division of Nuclear Medicine, The Mount Sinai Medical Center, New York (United States)
2000-11-01
We compared two correction methods for simultaneous {sup 201}Tl/{sup 99m}Tc dual-isotope single-photon emission computed tomography (SPECT). Both approaches use the information from the third energy window placed between the photopeak windows of the {sup 201}Tl and {sup 99m}Tc. The first approach, described by Moore et al, corrects only for the contribution of the {sup 99m}Tc to the {sup 201}Tl primary 70 keV window. We developed the three-window transformation dual-isotope correction method, which is a simultaneous cross-talk correction. The two correction methods were compared in a simultaneous {sup 201}Tl/{sup 99m}Tc sestamibi cardiac dog study. Three separate acquisitions were performed in this dog study: two single-isotope and one dual-isotope acquisition. The {sup 201}Tl single-isotope images were used as references. The total number of counts, and the contrast between the left ventricular cavity (LVC) and the myocardium, were used in 70 keV short-axis slices as parameters for evaluating the results of the dual-isotope correction methods. Three consecutive short-axis slices were used to calculate averaged contrast and the averaged total number of counts. The total number of the counts was 667 000 {+-} 500 and 414 500 {+-} 400 counts for the dual-isotope ({sup 201}Tl + {sup 99m}Tc) and single-isotope ({sup 201}Tl-only) 70 keV images, respectively. The corrected dual-isotope images had 514 700 {+-} 700 and 368 000 {+-} 600 counts for Moore's correction and our approach, respectively. Moore's method improved contrast in the dual-isotope 70 keV image to 0.14 {+-} 0.03 from 0.11 {+-} 0.02, which was the value in the 70 keV non-corrected dual-isotope image. Our method improved the same contrast to 0.22 {+-} 0.03. The contrast in the {sup 201}Tl single-isotope 70 keV image was 0.28 {+-} 0.02. Both methods improved the 70 keV dual-isotope images. However, our approach provided slightly better images than Moore's correction when compared with {sup 201
Energy Technology Data Exchange (ETDEWEB)
Johg, Shiang-Bin; Wu, Chung-Chieng; Chen, Ming-Feng; Wu, Sheng-Nan (Kaohsiung Medical Coll., Taiwan (China))
1992-09-01
Subcutaneous (SC) injection of [sup 99m]Tc pertechnetate ([sup 99m]Tc) at acupuncture points K-3 is a new method of lower-limb radionuclide venography. To investigate the mechanism of absorption of [sup 99m]Tc from SC injected sites into vascular system, various radioisotopes such as [sup 201]Tl chloride ([sup 201]Tl) and [sup 67]Ga citrate ([sup 67]Ga) were SC injected at K-3 points in animal and human-beings experiments. It was found that [sup 99m]Tc and [sup 201]Tl were absorbed rapidly from K-3 points through venous system and into whole body soft tissue. However, [sup 67]Ga with a larger effective ionic radius than [sup 201]Tl was not absorbed throughout the observation of 5 minutes. Furthermore, intravenous administration of digitalis, a Na[sup +]-K[sup +] pump blocker, did not inhibit the absorption of [sup 99m]Tc and [sup 201]Tl after SC injection at K-3 points. These results suggest that absorption of radionuclides on SC injection at K-3 points is mainly through the passive pathway of diffusion rather than the active transport, and the effective ionic radius may be a major factor influencing the absorption rate of the radionuclides. (author).
Directory of Open Access Journals (Sweden)
Brian B. Gowen
2014-03-01
Full Text Available Rift Valley fever virus (RVFV causes severe disease in humans and ungulates. The virus can be transmitted by mosquitoes, direct contact with infected tissues or fluids, or aerosol, making it a significant biological threat for which there is no approved vaccine or therapeutic. Herein we describe the evaluation of DEF201, an adenovirus-vectored interferon alpha which addresses the limitations of recombinant interferon alpha protein (cost, short half-life, as a pre- and post-exposure treatment in a lethal hamster RVFV challenge model. DEF201 was delivered intranasally to stimulate mucosal immunity and effectively bypass any pre-existing immunity to the vector. Complete protection against RVFV infection was observed from a single dose of DEF201 administered one or seven days prior to challenge while all control animals succumbed within three days of infection. Efficacy of treatment administered two weeks prior to challenge was limited. Post‑exposure, DEF201 was able to confer significant protection when dosed at 30 min or 6 h, but not at 24 h post-RVFV challenge. Protection was associated with reductions in serum and tissue viral loads. Our findings suggest that DEF201 may be a useful countermeasure against RVFV infection and further demonstrates its broad-spectrum capacity to stimulate single dose protective immunity.
Energy Technology Data Exchange (ETDEWEB)
Nishimura, Toru; Yanagisawa, Atsuo; Sakata, Konomi; Shimoyama, Katsuya; Yoshino, Hideaki; Ishikawa, Kyozo [Kyorin Univ., Mitaka, Tokyo (Japan). School of Medicine; Sakata, Hitomi; Ishihara, Tadayuki
2001-02-01
The pathomorphologic mechanism responsible for abnormal perfusion imaging during thallium-201 myocardial single photon emission computed tomography ({sup 201}Tl-SPECT) in patients with Duchenne's progressive muscular dystrophy (DMD) was investigated. Hearts from 7 patients with DMD were evaluated histopathologically at autopsy and the results correlated with findings on initial and delayed resting {sup 201}Tl-SPECT images. The location of segments with perfusion defects correlated with the histopathologically abnormal segments in the hearts. Both the extent and degree of myocardial fibrosis were severe, especially in the posterolateral segment of the left ventricle. Severe transmural fibrosis and severe fatty infiltration were common in segments with perfusion defects. In areas of redistribution, the degree of fibrosis appeared to be greater than in areas of normal perfusion; and intermuscular edema was prominent. Thus, the degree and extent of perfusion defects detected by {sup 201}Tl-SPECT were compatible with the histopathology. The presence of the redistribution phenomenon may indicate ongoing fibrosis. Initial and delayed resting {sup 201}Tl-SPECT images can predict the site and progress of myocardial degeneration in patients with DMD. (author)
Energy Technology Data Exchange (ETDEWEB)
Kuzumoto, Masayuki [Nara Medical Univ. (Japan)
1997-08-01
Myocardial damage in patients with systemic lupus erythematosus (SLE) was evaluated using exercise thallium-201 myocardial scintigraphy, and the relationship between myocardial damage and disease activity of SLE was examined. Twenty-seven patients (26 women and 1 man, mean age 43 years), in whom extramural coronary artery lesions were excluded by coronary angiogram or presumed to be excluded by exercise electrocardiogram, were enrolled in this study. The mean duration of disease and the mean duration of corticosteroid therapy in these patients were 94 and 77 months, respectively. Exercise thallium-201 scintigraphy was performed twice (mean interval, 30 months) to evaluate the progression of myocardial damage. Myocardial ischemia as an index of myocardial damage was evaluated by visual analysis and ischemic score (IS). The changes in myocardial ischemia were categorized into 3 groups: improved, unchanged or worsened. The disease activity of SLE was determined by the SLE Disease Activity Index (SLEDAI), and the changes in this index were classified into the same three categories, as evaluated every six months between the two scintigraphic examinations. Disease activity was significantly correlated with myocardial ischemia (p<0.05), and with myocardial ischemia as diagnosed by {Delta}IS (difference in ischemic score between the first and second thallium-201 scintigrams: p<0.005). But neither the duration of disease nor the duration of corticosteroid therapy was correlated with IS at the first scintigraphy. These results indicate that control of SLE disease activity may be critical in the treatment of myocardial damage resulting from vascular lesions, especially intramyocardial small-artery disease, in patients with SLE. (author)
Directory of Open Access Journals (Sweden)
Maarten Walmagh
Full Text Available Peptidoglycan lytic enzymes (endolysins induce bacterial host cell lysis in the late phase of the lytic bacteriophage replication cycle. Endolysins OBPgp279 (from Pseudomonas fluorescens phage OBP, PVP-SE1gp146 (Salmonella enterica serovar Enteritidis phage PVP-SE1 and 201φ2-1gp229 (Pseudomonas chlororaphis phage 201φ2-1 all possess a modular structure with an N-terminal cell wall binding domain and a C-terminal catalytic domain, a unique property for endolysins with a Gram-negative background. All three modular endolysins showed strong muralytic activity on the peptidoglycan of a broad range of Gram-negative bacteria, partly due to the presence of the cell wall binding domain. In the case of PVP-SE1gp146, this domain shows a binding affinity for Salmonella peptidoglycan that falls within the range of typical cell adhesion molecules (K(aff = 1.26 × 10(6 M(-1. Remarkably, PVP-SE1gp146 turns out to be thermoresistant up to temperatures of 90 °C, making it a potential candidate as antibacterial component in hurdle technology for food preservation. OBPgp279, on the other hand, is suggested to intrinsically destabilize the outer membrane of Pseudomonas species, thereby gaining access to their peptidoglycan and exerts an antibacterial activity of 1 logarithmic unit reduction. Addition of 0.5 mM EDTA significantly increases the antibacterial activity of the three modular endolysins up to 2-3 logarithmic units reduction. This research work offers perspectives towards elucidation of the structural differences explaining the unique biochemical and antibacterial properties of OBPgp279, PVP-SE1gp146 and 201φ2-1gp229. Furthermore, these endolysins extensively enlarge the pool of potential antibacterial compounds used against multi-drug resistant Gram-negative bacterial infections.
Directory of Open Access Journals (Sweden)
Stephan Watkins
Full Text Available T cell receptors (TCR containing Vβ20-1 have been implicated in a wide range of T cell mediated disease and allergic reactions, making it a target for understanding these. Mechanics of T cell receptors are largely unexplained by static structures available from x-ray crystallographic studies. A small number of molecular dynamic simulations have been conducted on TCR, however are currently lacking either portions of the receptor or explanations for differences between binding and non-binding TCR recognition of respective peptide-HLA. We performed molecular dynamic simulations of a TCR containing variable domain Vβ20-1, sequenced from drug responsive T cells. These were initially from a patient showing maculopapular eruptions in response to the sulfanilamide-antibiotic sulfamethoxazole (SMX. The CDR2β domain of this TCR was found to dock SMX with high affinity. Using this compound as a perturbation, overall mechanisms involved in responses mediated by this receptor were explored, showing a chemical action on the TCR free from HLA or peptide interaction. Our simulations show two completely separate modes of binding cognate peptide-HLA complexes, with an increased affinity induced by SMX bound to the Vβ20-1. Overall binding of the TCR is mediated through a primary recognition by either the variable β or α domain, and a switch in recognition within these across TCR loops contacting the peptide and HLA occurs when SMX is present in the CDR2β loop. Large binding affinity differences are induced by summed small amino acid changes primarily by SMX modifying only three critical CDR2β loop amino acid positions. These residues, TYRβ57, ASPβ64, and LYSβ65 initially hold hydrogen bonds from the CDR2β to adjacent CDR loops. Effects from SMX binding are amplified and traverse longer distances through internal TCR hydrogen bonding networks, controlling the overall TCR conformation. Thus, the CDR2β of Vβ20-1 acts as a ligand controlled switch
TU-AB-201-10: Novel Conformal Skin Brachytherapy Device
Energy Technology Data Exchange (ETDEWEB)
Ferreira, C; Johnson, D; Ahmad, S [University of Oklahoma Health Science Center, Oklahoma City, OK (United States); Rasmussen, K; Jung, J [East Carolina Univ, Greenville, NC (United States)
2015-06-15
Purpose: A novel conformal skin brachytherapy (CSBT) device was developed to provide patient specific treatment for small inoperable lesions and irregular surfaces that are not good candidates for electron external beam, e.g. eyelids, nose, lips, ears, etc. Methods: A prototype was built and tested using radioactive seeds spaced by 1.5 mm attached to a 3D printed template. Seeds were allowed to move independently at treatment surface to conform to target geometry. Beta-emitter Praseodymium-142 (half-life: 19.12 h, average beta energy: 809 keV) and Iodine-125 Model 6711 (half-life: 59.4 days, average gamma energy: 28 keV) seeds were used to test the feasibility of the device in solid water phantom for different prescription depths and surface areas. Percent depth doses and dose profiles were analyzed. MCNPX2.6 Monte Carlo Simulation and Gafchromic EBT3 film measurements were performed for a single Pr-142 seed. Treatment with nineteen I-125 seeds was planned in BrachyVision and measured experimentally for a total dose of 500 cGy at 5.0 mm depth. Results: For a single Pr-142 seed, dose was 500.0 cGy at surface and 17.4 cGy at 5.00 mm. BrachyVision planned and film doses for I-125 seed matrix were 500 cGy and 473.5 cGy at 5 mm depth and 171.0 cGy and 201.0 cGy at 10 mm depth. Total covered surface area for Pr-142 and I-125 were 2.35 mm{sup 2} and 88.24 mm{sup 2} respectively. Profile dose fall-off showed to be very conformal to contact area with 50% of the total surface dose from a single Pr-142 and array of I-125 seeds being deposited at 0.72 mm and 0.65 mm respectively from the central axis. Conclusion: CSBT device provides a high conformal dose to small surfaces. BrachyVision can be used to predict clinical dose distributions for multiple seeds matrix. Different radioactive seeds can be used to suit prescription depth and treatment area.
Energy Technology Data Exchange (ETDEWEB)
Kiat, H.; Berman, D.S. [Cedars-Sinai Medical Centre, Los Angeles, California, LA (United States)
1998-02-01
Full text: Arbutamine (ARB), a new pharmacologic stress agent with enhanced chronotropic property compared to dobutamine, was compared with treadmill (TM) exercise testing (Ex) in a multicenter study using thallium-201 (Tl) SPECT. Of the total of 184 patients who underwent ARB, 69 also had TM stress and quantitative coronary angiography. Fifty-eight patients with a low pretest likelihood of CAD also underwent ARB study for evaluation of test specificity (normalcy rate). Tl scans were scored by a central laboratory using a 20 segment (seg)/scan visual analysis (5 point system: 0=normal, 4-absent uptake). Maximum heart rate (HR) by ARB and Ex was 122 vs 141 bpm (p<0.05). Mean %HR change from baseline was similar (79% vs 82%, respectively, p=ns). Maximum systolic BP for ARB and Ex was 173 vs 175 mmHg, and mean % change from baseline was 24% vs 28% (p=ns). Sensitivity for detecting CAD (270% stenosis) by ARB Tl was 94% and 97% by Ex Tl (p=ns). Stress Tl SPECT segmental agreement for presence of defect between ARB and Ex was 92% (kappa=0.8, p<0.001). Exact segmental stress Tl score (0-4 grading) agreement was 83 % (kappa=0.7, p<0.001). Among 346 segs with stress defects by both ARB and Ex defect reversibility agreement was 86% (kappa=0.7, p<0.001). The normalcy rate for ARB TI-SPECT among patients with a low likelihood of CAD was 90%. Adverse events were mostly mild (tremor: 23%, flushing: 10%, headache: 10%, paraesthesia: 8%, dizziness: 8%, hot flushes: 4%). Arrhythimia of clinical concern occurred in 8% (10/122) of ARB patients who had cardiac catheterisation and in 1.4% (1/69) of patients who had stress Tl. Of all 184 patients with ARB stress, ARB was discontinued due to arrhythmia in 7(5%) and 1 patient had IV Metoprolol for frequent ventricular couplets. Sustained arrhythmias were not observed
Directory of Open Access Journals (Sweden)
Samuel L. Yingst
2013-01-01
Full Text Available CD8+ T cells have been reported to play an important role in defense against B. abortus infection in mouse models. In the present report, we use CD8 knockout mice to further elucidate the role of these cells in protection from B. melitensis infection. Mice were immunized orally by administration of B. melitensis WR201, a purine auxotrophic attenuated vaccine strain, then challenged intranasally with B. melitensis 16M. In some experiments, persistence of WR201 in the spleens of CD8 knockout mice was slightly longer than that in the spleens of normal mice. However, development of anti-LPS serum antibody, antigen-induced production of γ-interferon (IFN-γ by immune splenic lymphocytes, protection against intranasal challenge, and recovery of nonimmunized animals from intranasal challenge were similar between normal and knockout animals. Further, primary Brucella infection was not exacerbated in perforin knockout and Fas-deficient mice and these animals’ anti-Brucella immune responses were indistinguishable from those of normal mice. These results indicate that CD8+ T cells do not play an essential role as either cytotoxic cells or IFN-γ producers, yet they do participate in a specific immune response to immunization and challenge in this murine model of B. melitensis infection.
The micro-arc oxidation (MAO) behaviors of in-situ TiB2/A201 composite
Zhang, Hongbin; Geng, Jiwei; Li, Xianfeng; Chen, Zhe; Wang, Mingliang; Ma, Naiheng; Wang, Haowei
2017-11-01
The Micro-arc oxidation (MAO) treatment on the in-situ TiB2/A201 composites was performed using the aluminate-based electrolyte, and the corresponding MAO behavior was discussed in this work. In connection with the film thickness-time curve, the voltage-time for the MAO process on the TiB2/A201 composite can be divided into two periods, namely the initial period (Stage I and II) and linear growth period (Stage III and IV). The phase and morphologies evolutions of the composite experienced these stages have been characterized by X-Ray diffraction, scanning electron microscopy and Micro-Raman spectroscopy. It is found the TiB2 particles have played a dual role in the MAO process. Firstly, the external current can leak through conductive TiB2 particles in the initial period. However, this leaking way has been quickly cut off by the oxidation of TiB2 to TiO2. Secondly, the TiB2 particles beneath the metal-oxide interface can impede MAO film from growing inward. Nevertheless, these TiB2 particles should be oxidized and then melted gradually, and finally dissolved into the oxide film.
Energy Technology Data Exchange (ETDEWEB)
Indo, Shunju (Okayama Univ. (Japan). School of Medicine)
1992-12-01
This study was performed to clarify whether the extent-score (Ex-Score) calculated by Tl-201 myocardial scintigraphy is a reliable indicator of the severity of myocardial damage and cardiac residual capacity in valvular heart diseases. The subjects consisted of 38 patients (10 with aortic regurgitation (AR), 4 with aortic stenosis (AS), 13 with mitral regurgitation (MR) and 11 with mitral stenosis (MS)). Ex-Scores were significantly correlated with the severity of myocardial damage found in biopsied specimens obtained intraoperatively (correlation efficiency to Ex-Score with cell diameter in AR, % fibrosis in AR, cell diameter in AS, electron microscopic score in MR and % fibrosis in MS was 0.873, 0.734, 0.970, 0.913 and 0.659, respectively). Ex-Scores were also correlated with cardiac residual capacity determined by radioisotope angiography (correlation efficiency to Ex-Score with %[Delta] ejection fraction in AR, %[Delta] end-systolic volume in MR, %[Delta] end-diastolic volume in MS was -0.764, 0.790 and -0.763, respectively). These results suggest that the severity of myocardial damage and cardiac residual capacity can be estimated by Tl-201 myocardial scintigraphy (Ex-Score) in valvular heart diseases. (author).
Energy Technology Data Exchange (ETDEWEB)
Brown, K.A.; Slinker, B.K. (Univ. of Vermont College of Medicine, Burlington (USA))
1990-06-01
Dipyridamole-thallium-201 imaging is often performed in patients unable to exercise because of peripheral vascular disease. Many of these patients are taking pentoxifylline (Trental), a methylxanthine derivative which may improve intermittent claudication. Whether pentoxifylline inhibits dipyridamole-induced coronary hyperemia like other methylxanthines such as theophylline and should be stopped prior to dipyridamole-thallium-201 imaging is unknown. Therefore, we studied the hyperemic response to dipyridamole in seven open-chest anesthetized dogs after pretreatment with either pentoxifylline (0, 7.5, or 15 mg/kg i.v.) or theophylline (3 mg/kg i.v.). Baseline circumflex coronary blood flows did not differ significantly among treatment groups. Dipyridamole significantly increased coronary blood flow before and after 7.5 or 15 mm/kg i.v. pentoxifylline (p less than 0.002). Neither dose of pentoxifylline significantly decreased the dipyridamole-induced hyperemia, while peak coronary blood flow was significantly lower after theophylline (p less than 0.01). We conclude that pentoxyifylline does not inhibit dipyridamole-induced coronary hyperemia even at high doses.
Energy Technology Data Exchange (ETDEWEB)
Hausdorf, G.; Nienaber, C.A.; Spielman, R.P.
1988-02-01
The mucocutaneous lymph node syndrome (Kawasaki disease) is of increasing importance for the pediatric cardiologist, for coronary aneurysms with the potential of thrombosis and subsequent stenosis can develop in the course of the disease. The authors report a 2 1/2-year-old female child in whom, fourteen months after the acute phase of Kawasaki disease, myocardial infarction occurred. Biphasic thallium 201 SPECT-imaging using dipyridamole depicted anterior wall ischemia and inferolateral infarction. This case demonstrates that noninvasive vasodilation-redistribution thallium 201 SPECT-imaging has the potential to predict reversible myocardial perfusion defects and myocardial necrosis, even in small infants with Kawasaki disease.
Directory of Open Access Journals (Sweden)
Donald F Smee
Full Text Available An adenovirus 5 vector encoding for mouse interferon alpha, subtype 5 (mDEF201 was evaluated for efficacy against lethal cowpox (Brighton strain and vaccinia (WR strain virus respiratory and systemic infections in mice. Two routes of mDEF201 administration were used, nasal sinus (5-µl and pulmonary (50-µl, to compare differences in efficacy, since the preferred treatment of humans would be in a relatively small volume delivered intranasally. Lower respiratory infections (LRI, upper respiratory infections (URI, and systemic infections were induced by 50-µl intranasal, 10-µl intranasal, and 100-µl intraperitoneal virus challenges, respectively. mDEF201 treatments were given prophylactically either 24 h (short term or 56d (long-term prior to virus challenge. Single nasal sinus treatments of 10(6 and 10(7 PFU/mouse of mDEF201 protected all mice from vaccinia-induced LRI mortality (comparable to published studies with pulmonary delivered mDEF201. Systemic vaccinia infections responded significantly better to nasal sinus delivered mDEF201 than to pulmonary treatments. Cowpox LRI infections responded to 10(7 mDEF201 treatments, but a 10(6 dose was only weakly protective. Cowpox URI infections were equally treatable by nasal sinus and pulmonary delivered mDEF201 at 10(7 PFU/mouse. Dose-responsive prophylaxis with mDEF201, given one time only 56 d prior to initiating a vaccinia virus LRI infection, was 100% protective from 10(5 to 10(7 PFU/mouse. Improvements in lung hemorrhage score and lung weight were evident, as were decreases in liver, lung, and spleen virus titers. Thus, mDEF201 was able to treat different vaccinia and cowpox virus infections using both nasal sinus and pulmonary treatment regimens, supporting its development for humans.
Gregor, R. T.; Valdés-Olmos, R.; Koops, W.; Balm, A. J.; Hilgers, F. J.; Hoefnagel, C. A.
1996-01-01
To test the feasibility of single-photon emission computed tomography (SPECT) scanning with the use of thallous chloride T1 201 in patients with head and neck cancer and to decide its possible applications to improve the diagnosis and staging of head and neck cancer. Findings from SPECT with the use
2011-05-03
...-201, -202, -203, - 223, and -243 Airplanes, A330-300 Series Airplanes, A340-200 Series Airplanes, and A340-300 Series Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of... some rudders fitted on A330 and A340-200/-300 aeroplanes. An extended de-bonding, if not detected and...
Rappaport, A I; Karakochuk, C D; Whitfield, K C; Kheang, K M; Green, T J
2017-02-01
Hemoglobin (Hb) concentration is often measured in global health and nutrition surveys to determine anemia prevalence using a portable hemoglobinometer such as the Hemocue® Hb 201+. More recently, a newer model was released (Hemocue Hb 301) utilizing slightly different methods to measure Hb as compared to the older model. The objective was to measure bias and concordance between Hb concentrations using the Hemocue Hb 301 and Hb 201+ models in a rural field setting. Hemoglobin (Hb) concentration was measured using one finger prick of blood (approximately 10 μL) from 175 Cambodian women (18-49 years) using three Hemocue Hb 201+ and three Hb 301 machines. Bias and concordance were measured and plotted. Overall, mean ± SD Hb concentration was 116 ± 13 g/L using the Hb 201+ and 118 ± 12 g/L using the Hb 301; and anemia prevalence (Hb < 120 g/L) was 58% (n = 102) and 58% (n = 101), respectively. Overall bias ± SD was 2.0 ± 10.5 g/L and concordance (95% CI) was 0.63 (0.54, 0.72). Despite the 2 g/L bias detected between models, anemia prevalence was very similar in both models. The two models measured anemia prevalence comparably in this population of women in rural Cambodia. © 2016 John Wiley & Sons Ltd.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false What problems always cause a drug test to be... Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Drug Tests § 40.201 What problems always cause a drug test to be cancelled...
Zimmermann, R; Rauch, B; Kapp, M; Bubeck, B; Neumann, F J; Seitz, F; Stokstad, P; Mall, G; Tillmanns, H; Kübler, W
1992-01-01
To characterise the clinical usefulness of serial myocardial scintigraphy with iodine-123 phenylpentadecanoic acid (IPPA) in comparison with thallium-201, dual-isotope investigations were performed in 41 patients with angiographically documented coronary artery disease. Both tracers were administered simultaneously during symptom-limited ergometry. Planar scintigrams were acquired immediately after stress, and delayed imaging was performed after 1 h for IPPA and 4 h for 201Tl. Scintigrams were evaluated both qualitatively and quantitatively using a newly developed algorithm for automated image superposition. Initial myocardial uptake of both tracers was closely correlated (r = 0.75, p or = 75% (IP-PA: 70.0%, 201Tl: 66.3%, P = NS) with identical specificity (69.8%). The number of persistent defects, however, was significantly higher with IPPA (P = 0.021), suggesting that visual analysis of serial IPPA scintigrams may overestimate the presence of myocardial scar tissue. On the other hand, previous Q wave myocardial infarction was associated with a decreased regional IPPA clearance (29% +/- 11% vs 44% +/- 11% in normal myocardium, P IPPA is essentially as sensitive as scintigraphy with 201Tl for the detection of stress-induced perfusion abnormalities. Quantitative analysis of myocardial IPPA kinetics, however, is required for the evaluation of tissue viability.
Energy Technology Data Exchange (ETDEWEB)
Zimmermann, R.; Rauch, B.; Kapp, M.; Neumann, F.J.; Seitz, F.; Kuebler, W. (Heidelberg Univ. (Germany). Dept. of Cardiology); Bubeck, B. (Heidelberg Univ. (Germany). Dept. of Nuclear Medicine); Mall, G. (Heidelberg Univ. (Germany). Dept. of Pathology); Tillmanns, H. (Giessen Univ. (Germany). Dept. of Cardiology); Stokstad, P.
1992-11-01
To characterise the clinical usefulness of serial myocardial scintigraphy with iodine-123 phenylpentadecanoic acid (IPPA) in comparison with thallium-201, dual-isotope investigations were performed in 41 patients with angiographically documented coronary artery disease. Both tracers were adminstered simultaneously during symptom-limited ergometry. Planar scintigrams were acquired immediately after stress, and delayed imaging was performed after 1 h for IPPA and 4 h for {sup 201}Tl. Scintigrams were evaluated both qualitatively and quantitatively using a newly developed algorithm for automated image superposition. Initial myocardial uptake of both tracers was closely correlated (r=0.75, p<0.001). Both tracers also revealed a similar sensitivity for the identification of individual coronary artery stenoses {>=}75% (IPPA: 70%, {sup 201}Tl: 66.3%, P=NS) with identical specificity (69.8%). The number of persistent defects, however, was significantly higher with IPPA (P=0.021), suggesting that visual analysis of serial IPPA scintigrams may overestimate the presence of myocardial scar tissue. On the other hand, previous Q wave myocardial infarction was associated with a decreased regional IPPA clearance (29%{+-}11% vs 44%{+-}11% in normal myocardium, P<0.05). The data indicate that serial myocardial scintigraphy with IPPA is essentially as sensitive as scintigraphy with {sup 201}Tl for the detection of stress-induced perfusion abnormalities. Quantitative analysis of myocardial IPPA kinetics, however, is required for the evaluation of tissue viability. (orig.).
2010-10-01
...; CONSUMER PROTECTION REGULATIONS Before Offering Services to My Customers Liability Considerations § 375.201... of household goods and all related services identified on your lawful bill of lading. (b) Full Value Protection Obligation—In general, your liability is for the household goods that are lost, damaged, destroyed...
Energy Technology Data Exchange (ETDEWEB)
Yamada, Takehiko; Matsumori, Akira; Nohara, Ryuji; Konishi, Junji; Sasayama, Shigetake [Kyoto Univ. (Japan). Faculty of Medicine; Tamaki, Nagara
1997-10-01
Indium-111 antimyosin antibody imaging (a tracer of myocardial necrosis) and thallium-201 imaging (a tracer of myocardial perfusion) were compared in patients with myocarditis and dilated cardiomyopathy. The distribution of each tracer and antimyosin/thallium-201 overlapping were evaluated with single-photon emission computed tomography (SPECT). Scintigraphic data were classified into 5 patterns according to the distribution of both images and were compared with histologic findings of endomyocardial biopsy: AM-D, intense and diffuse antimyosin uptake and no perfusion abnormality (active myocarditis); AM-L, localized antimyosin uptake and no perfusion abnormality (active myocarditis); HM, no antimyosin uptake with or without perfusion abnormality (healed myocarditis); DCM-NH, diffuse antimyosin uptake and inhomogeneous thallium-201 uptake (dilated cardiomyopathy); DCM-PD, diffuse or localized antimyosin uptake and myocardial perfusion defect(s) (dilated cardiomyopathy). Patients with dilated-phase hypertrophic cardiomyopathy were frequently found in the DCM-PD group. Taken together, comparative antimyosin/thallium-201 SPECT images are useful for evaluating the activity of myocarditis and ongoing myocardial damage even in areas with no perfusion in patients with dilated cardiomyopathy. (author)
Energy Technology Data Exchange (ETDEWEB)
Loesse, B.; Kuhn, H.; Rafflenbeul, D.; Kroenert, H.; Hort, W.; Feinendegen, L.E.; Loogen, F.
1980-01-01
36 consecutive patients with chest pain and/or severe ventricular dysrhythmias, but normal coronary arteries and normal left ventriculogram, underwent thallium-201 myocardial imaging at rest and during exercise. The myocardial scintigram was abnormal in 27 patients (group A) and normal in only 9 patients (group B).
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Lot number or other lot identification of vegetable... Vegetable Seeds § 201.30b Lot number or other lot identification of vegetable seed in containers of more than 1 pound. The lot number or other lot identification of vegetable seed in containers of more than 1...
2010-07-01
... meter (100 feet) distance of the noise from locomotive and rail car operations and locomotive load cell... Measurement Criteria § 201.24 Procedures for measurement at a 30 meter (100 feet) distance of the noise from... of paragraphs (b), (c) and (d) of this section, and shall be positioned 1.2 meters (4 feet) above the...
Energy Technology Data Exchange (ETDEWEB)
Mit Basol; John F. Kielb; John F. MuHooly; Kobus Smit
2007-05-02
On September 29, 2005, ASME Standards Technology, LLC (ASME ST-LLC) executed a multi-year, cooperative agreement with the United States DOE for the Generation IV Reactor Materials project. The project's objective is to update and expand appropriate materials, construction, and design codes for application in future Generation IV nuclear reactor systems that operate at elevated temperatures. Task 4 was embarked upon in recognition of the large quantity of ongoing reactor designs utilizing high temperature technology. Since Code Case N-201 had not seen a significant revision (except for a minor revision in September, 2006 to change the SA-336 forging reference for 304SS and 316SS to SA-965 in Tables 1.2(a) and 1.2(b), and some minor editorial changes) since December 1994, identifying recommended updates to support the current high temperature Core Support Structure (CSS) designs and potential new designs was important. As anticipated, the Task 4 effort identified a number of Code Case N-201 issues. Items requiring further consideration range from addressing apparent inconsistencies in definitions and certain material properties between CC-N-201 and Subsection NH, to inclusion of additional materials to provide the designer more flexibility of design. Task 4 developed a design parameter survey that requested input from the CSS designers of ongoing high temperature gas cooled reactor metallic core support designs. The responses to the survey provided Task 4 valuable input to identify the design operating parameters and future needs of the CSS designers. Types of materials, metal temperature, time of exposure, design pressure, design life, and fluence levels were included in the Task 4 survey responses. The results of the survey are included in this report. This research proves that additional work must be done to update Code Case N-201. Task 4 activities provide the framework for the Code Case N-201 update and future work to provide input on materials. Candidate
Udayan, Aswathy; Arumugam, Muthu
2017-10-01
The present study aims to evaluate the effect of different concentration of natural auxin, Indole-3 acetic acid (IAA) on growth, lipid yield, PUFA and EPA accumulation in Nannochloropsis oceanica CASA CC201. It was observed that the, treatment with 10ppm concentration of IAA resulted in high cell number 579.5×106cells/ml than the control (215.5×106cells/ml). Treatment with IAA at a concentration of 40ppm gives the highest cellular lipid accumulation of 60.9% DCW than the control 31.05% DCW). Lipid yield is also found to be increased by the addition of 40ppm IAA (319.5mg/L) compared with the control (121.5mg/L). EPA percentage is increased to 10.76% by the addition of 40ppm IAA compared to the control (1.87%). Copyright © 2017 Elsevier Ltd. All rights reserved.
Arnaud, Françoise; Hammett, Michael; Philbin, Nora; Scultetus, Anke; McCarron, Richard; Freilich, Daniel
2008-10-01
The combination of traumatic injury, hemorrhage, and fluid resuscitation results in consumption and dilution of coagulation factors, adversely impacting hematology outcome in trauma patients. The hemostatic effects of escalating doses of recombinant factor VIIa added to hemoglobin-based oxygen carrier-201 were assessed as prehospital fluid resuscitation in swine with severe uncontrolled hemorrhage. Swine underwent liver injury causing severe uncontrolled hemorrhage and shock. During a 4-h prehospital phase, either hypotensive or tachycardic, or both, animals were resuscitated with hemoglobin-based oxygen carrier-201 without (0x) or with escalating doses of recombinant factor VIIa [90 microg/kg (1x), 180 microg/kg (2x), or 360 microg/kg (4x)]. The animals received one initial full dose of 10 ml/kg at 15 min and up to four doses of 5 ml/kg thereafter. From 4 to 72 h (hospital phase), animals received either transfusions or isotonic saline or both as needed. Hematology profile (complete blood count), thromboelastography, in-vitro bleeding (platelet function analyzer), and coagulation (prothrombin time) were measured and the results were compared using mixed statistical models. In all groups, dilutional coagulopathy was evidenced by reduced hematocrit, platelets, and thromboelastography-maximum amplitude, and increased platelet function analyzer closure time and thromboelastography-reaction time. During the prehospital phase, hemoglobin-based oxygen carrier-201 restored hemoglobin in all groups. Recombinant factor VIIa decreased prothrombin time in recombinant factor VIIa groups compared with the hemoglobin-based oxygen carrier-201 group (P 0.05). Compared with hemoglobin-based oxygen carrier, 1x recombinant factor VIIa tended to decrease blood loss, lactate and thromboelastography-reaction time at 24 h but the 4x group increased these parameters. Platelets and thromboelastography-maximum amplitude decreased (P hemoglobin-based oxygen carrier-201 did not change
Energy Technology Data Exchange (ETDEWEB)
Iida, Hidehiro; Kim, Kyeong-Min; Nakazawa, Mayumi; Sohlberg, Antti; Zeniya, Tsutomu; Hayashi, Takuya; Watabe, Hiroshi [National Cardiovascular Center Research Institute, Department of Investigative Radiology, Suita City, Osaka (Japan); Eberl, Stefan [National Cardiovascular Center Research Institute, Department of Investigative Radiology, Suita City, Osaka (Japan); Royal Prince Alfred Hospital, PET and Nuclear Medicine Department, Camperdown, NSW (Australia); Tamura, Yoshikazu [Akita Kumiai General Hospital, Department of Cardiology, Akita City (Japan); Ono, Yukihiko [Akita Research Institute of Brain, Akita City (Japan)
2008-05-15
{sup 201}Tl has been extensively used for myocardial perfusion and viability assessment. Unlike {sup 99m}Tc-labelled agents, such as {sup 99m}Tc-sestamibi and {sup 99m}Tc-tetrofosmine, the regional concentration of {sup 201}Tl varies with time. This study is intended to validate a kinetic modelling approach for in vivo quantitative estimation of regional myocardial blood flow (MBF) and volume of distribution of {sup 201}Tl using dynamic SPECT. Dynamic SPECT was carried out on 20 normal canines after the intravenous administration of {sup 201}Tl using a commercial SPECT system. Seven animals were studied at rest, nine during adenosine infusion, and four after beta-blocker administration. Quantitative images were reconstructed with a previously validated technique, employing OS-EM with attenuation-correction, and transmission-dependent convolution subtraction scatter correction. Measured regional time-activity curves in myocardial segments were fitted to two- and three-compartment models. Regional MBF was defined as the influx rate constant (K{sub 1}) with corrections for the partial volume effect, haematocrit and limited first-pass extraction fraction, and was compared with that determined from radio-labelled microspheres experiments. Regional time-activity curves responded well to pharmacological stress. Quantitative MBF values were higher with adenosine and decreased after beta-blocker compared to a resting condition. MBFs obtained with SPECT (MBF{sub SPECT}) correlated well with the MBF values obtained by the radio-labelled microspheres (MBF{sub MS}) (MBF{sub SPECT} = -0.067 + 1.042 x MBF{sub MS}, p < 0.001). The three-compartment model provided better fit than the two-compartment model, but the difference in MBF values between the two methods was small and could be accounted for with a simple linear regression. Absolute quantitation of regional MBF, for a wide physiological flow range, appears to be feasible using {sup 201}Tl and dynamic SPECT. (orig.)
Knapp, W H; Vyska, K; Machulla, H J; Notohamiprodjo, G; Schmidt, U; Knust, E J; Gleichmann, U
1988-06-01
Metabolic impairment and perfusion abnormalities are known to occur in hypertensive heart disease (HHD) and in cardiomyopathies. Free fatty acid (FFA) extraction is severely inhibited in a number of pathobiochemical reactions. This parameter was assessed using the radiolabeled FFA analogue 123I-(p-iodo-phenyl-)-pentadecanoic acid (IPPA) and 201Tl as perfusion marker, both of them injected at maximal physical workload. The regional extraction fraction of IPPA (IPPA-EF) was estimated by relating the regional IPPA and 201Tl uptake to each other. In HHD (normal coronary arteries) with posterior wall thickness less than or equal to 12 mm IPPA-EF was 77 +/- 18% (SD) in septum and 92 +/- 17% in the posterolateral wall (N = 13), with thickness of greater than 12 mm 60 +/- 23% in septum and 61 +/- 20% in the posterolateral wall (N = 8) when compared with IPPA-EF in normal subjects (= 100%, N = 9). In hypertrophic cardiomyopathy (HCM) IPPA-EF averaged 51 +/- 20% in septum and 87 +/- 10% in the posterolateral wall (N = 11). In these patient groups no systematic regional changes in 201TI uptake were observed. In dilated cardiomyopathy (DCM) both IPPA-EF and 201Tl uptake showed distinct regional variations and a great interindividual variability with a mean IPPA-EF reduction of 12% (N = 9). Thus, IPPA uptake in primarily non-ischemic myocardial disease may already be compromised when 201Tl uptake is unchanged. The double-nuclide method for IPPA-EF determination allows to eliminate the influence of flow in FFA imaging and enhances the potential of scintigraphy in the differential diagnosis of HHD versus coronary artery disease.
Energy Technology Data Exchange (ETDEWEB)
Akutsu, Yasushi; Kaneko, Kyouichi; Kodama, Yusuke; Li, Hui-Ling; Nishimura, Hideki; Hamazaki, Yuji; Kobayashi, Youichi [Showa University School of Medicine, Division of Cardiology, Department of Medicine, Tokyo (Japan); Suyama, Jumpei; Shinozuka, Akira; Gokan, Takehiko [Showa University School of Medicine, Department of Radiology, Tokyo (Japan)
2009-02-15
Microcirculatory failure after reperfusion is clinically indicated to cause reperfusion injury whereas excessive intracellular calcium ion overload is experimentally proved as a key mechanism of reperfusion injury. We hypothesized that technetium-99m ({sup 99m}Tc) pyrophosphate (Tc-PYP) uptake in injured but viable infarct-related myocardium with preserved myocardial perfusion after reperfusion estimated by thallium-201 ({sup 201}Tl) uptake would be associated with final functional recovery. Dual-isotope Tc-PYP/{sup 201}Tl single-photon emission computed tomography (SPECT) was performed 2 days after successful reperfusion therapy in patients with first acute myocardial infarction, and 50 patients (63 {+-} 13 years old, female 22%) with preserved {sup 201}Tl uptakes of {>=}50% in reperfused myocardium was followed for 1 month. Tc-PYP uptake was assessed as the heart-to-sternum (H/S) ratio. Two-dimensional echocardiography was also performed 2 days and 1 month after reperfusion to evaluate functional recovery. High Tc-PYP uptake, defined as the H/S ratio {>=}0.81, was predictive of chronic phase no functional recovery (73.7% in 14 of 19 patients with high uptake vs 16.1% in five of 31 patients without those, p < 0.0001). After adjustment for potential confounding variables, including electrocardiographic persistent ST segment elevation at 1 h after reperfusion, high Tc-PYP uptake remained independently predictive of no functional recovery with odds ratio of 8.7 (95% confidential interval = 2 to 38.7; p = 0.005). High Tc-PYP uptake in reperfused but viable infarct-related myocardium was a powerful predictor of no functional recovery, which may reflect excessive intracellular calcium ion overload caused by reperfusion injury. Tc-PYP/{sup 201}Tl dual-isotope SPECT imaging can provide prognostic information after reperfusion. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Nagamachi, Shigeki; Jinnouchi, Seishi; Kurose, Takeshi; Ohnishi, Takashi; Flores, L.G. II; Nakahara, Hiroshi; Futami, Shigemi; Tamura, Shozo; Matsukura, Shigeru (Miyazaki Medical Coll., Kiyotake (Japan))
1998-12-01
The purpose of this paper is to investigate the influence of diabetic myocardial damage (suspected myocardial damage; SMD) diagnosed by [sup 201]Tl-SPECT and diabetic cardiac autonomic neuropathy (AN) on myocardial MIBG uptake in patients with NIDDM. Eighty-seven diabetic patients divided into four subgroups: 23 with SMD (+) AN (+); 19 with SMD (+) AN (-); 27 with SMD (-) AN (+); 18 with SMD (-) AN (-), and 10 controls were studied. Both planar and SPECT images were taken at 30 minutes (early) and 3 hours (delayed) after [sup 123]I-MIBG injection. The heart to mediastinum uptake ratio (H/M) and washout ratio of [sup 123]I-MIBG (WR) were obtained from both planar images. Similarly, the difference between the [sup 201]Tl image and the [sup 123]I-MIBG image in the total uptake score (TUS) was taken as the difference in the total uptake score ([Delta]TUS) representing cardiac sympathetic denervation without SMD. On both early and delayed planar images, the mean H/M value in the subgroups of diabetic patients was significantly lower in the SMD (+) AN (+) group than in the control group, but among those subgroups, there was statistically significant difference between the SMD (+) AN (+) and SMD (-) AN (-) groups only on the delayed images. Regarding the WR value, there was no statistically significant difference among subjects. On SPECT image analysis, the diabetic subgroup with AN or SMD had statistically significant lower values for TUS than those of the control group. Among diabetics, there was a statistically significant differences between SMD [+] AN [+] and SMD [-] AN [-] on both early and delayed images. Similarly, the SMD [+] AN [-] group also had significantly lower values than those of SMD [-] AN [-] on early images. Regarding [Delta]TUS, there was a statistically significant differences between AN [+] subgroups and controls. Similarly, the mean value for [Delta]TUS was much higher in AN [+] subgroups than in AN [-] subgroups with or without SMD in diabetes
Energy Technology Data Exchange (ETDEWEB)
Nagamachi, Shigeki; Jinnouchi, Seishi; Kurose, Takeshi; Ohnishi, Takashi; Flores, L.G. II; Nakahara, Hiroshi; Futami, Shigemi; Tamura, Shozo; Matsukura, Shigeru [Miyazaki Medical Coll., Kiyotake (Japan)
1998-12-01
The purpose of this paper is to investigate the influence of diabetic myocardial damage (suspected myocardial damage; SMD) diagnosed by {sup 201}Tl-SPECT and diabetic cardiac autonomic neuropathy (AN) on myocardial MIBG uptake in patients with NIDDM. Eighty-seven diabetic patients divided into four subgroups: 23 with SMD (+) AN (+); 19 with SMD (+) AN (-); 27 with SMD (-) AN (+); 18 with SMD (-) AN (-), and 10 controls were studied. Both planar and SPECT images were taken at 30 minutes (early) and 3 hours (delayed) after {sup 123}I-MIBG injection. The heart to mediastinum uptake ratio (H/M) and washout ratio of {sup 123}I-MIBG (WR) were obtained from both planar images. Similarly, the difference between the {sup 201}Tl image and the {sup 123}I-MIBG image in the total uptake score (TUS) was taken as the difference in the total uptake score ({Delta}TUS) representing cardiac sympathetic denervation without SMD. On both early and delayed planar images, the mean H/M value in the subgroups of diabetic patients was significantly lower in the SMD (+) AN (+) group than in the control group, but among those subgroups, there was statistically significant difference between the SMD (+) AN (+) and SMD (-) AN (-) groups only on the delayed images. Regarding the WR value, there was no statistically significant difference among subjects. On SPECT image analysis, the diabetic subgroup with AN or SMD had statistically significant lower values for TUS than those of the control group. Among diabetics, there was a statistically significant differences between SMD [+] AN [+] and SMD [-] AN [-] on both early and delayed images. Similarly, the SMD [+] AN [-] group also had significantly lower values than those of SMD [-] AN [-] on early images. Regarding {Delta}TUS, there was a statistically significant differences between AN [+] subgroups and controls. Similarly, the mean value for {Delta}TUS was much higher in AN [+] subgroups than in AN [-] subgroups with or without SMD in diabetes
Harel, F; Génin, R; Daou, D; Lebtahi, R; Delahaye, N; Helal, B O; Le Guludec, D; Faraggi, M
2001-10-01
A lack of specificity for myocardial perfusion imaging has been widely reported, mostly related to false-positive defects on the inferior wall. The application of depth-dependent resolution recovery (RR), attenuation correction (AC) using external source devices, and scatter correction has been proposed to resolve this pitfall. We studied the clinical benefit of depth-dependent RR, nonuniform AC using a scanning line source, and scatter correction (photon energy recovery [PER]) compared with filtered backprojection alone. Eighty-two patients were included: 40 healthy volunteers with a low likelihood of coronary artery disease (control group) and 42 patients with proven right or circumflex coronary artery disease but without involvement of the left anterior descending artery. Among these 82 patients, the images of 33 were also processed with PER. RR did not alter the performance of filtered backprojection alone. AC + RR greatly improved specificity and the rate of normal (201)Tl SPECT findings in the control population (from 56% to 95% and from 53% to 100%, respectively) but significantly decreased sensitivity (from 92% to 54%). AC + RR generated a false anteroapical defect in 21% of patients and reverse redistribution of the apex in 23%. AC + RR significantly decreased the extent of the stress defect (from 4.09 to 3.21 segments, P anteroapical false-positives or the number of apical reverse distribution cases. AC + RR improved the specificity and normalcy rate of (201)Tl SPECT myocardial perfusion imaging but generated overcorrection on the inferior wall, leading to low sensitivity and to false evaluation of myocardial viability in 73% of the patients with inferior infarction. AC + RR also generated anteroapical artifacts. The addition of scatter correction did not significantly reduce these drawbacks.
Energy Technology Data Exchange (ETDEWEB)
Miyakoda, Hiroyuki; Endo, Akihiro; Kato, Masahiko; Kato, Tatsuo; Omodani, Hiroki; Osaki, Shuichi; Kinugawa, Toru; Hoshio, Akira [Tottori Univ., Yonago (Japan). School of Medicine; Mashiba, Hiroto
1996-09-01
We studied the relation between exercise-induced U-wave changes and the site of a reversible defect in tomographic {sup 201}Tl myocardial imaging. Coronary artery disease and control groups consisted of 116 and 42 patients, respectively. In the anteroapical-ischemia group (n=37), the sensitivity of U-wave inversion in the anterior precordial leads for ischemia was 62% (23/37) and that of prominent U-waves without an increase in the height of the T-wave in the inferior limb leads was 57% (21/37). In this group, 18 patients (49%) met both criteria (18 =78%= of 23 patients with the former; 18 =86%= of 21 patients with the latter). In the posterior-ischemia group (n=59), the sensitivity of prominent U-waves with a decrease in the height of the T-wave in the anterior precordial leads for ischemia was 63% (37/59) and that of U-wave inversion in the inferior limb leads was 20% (12/59). In this group, 12 patients (20%) met both criteria (12 =32%= of 37 patients with the former; all 12 patients with the latter). The specificity of U-wave criteria was 100%. In the anteroapical and posterior-ischemia group (n=20), the sensitivity of U-wave criteria for anteroapical and posterior ischemia was 85% (17/20) and 40% (8/20), respectively. In conclusion, U-wave criteria are not only specific but also sensitive for myocardial ischemia determined by {sup 201}Tl imaging. (author)
Wang, Chun-Hsiung; Hsu, Chi-Hsin; Wu, Yi-Min; Luo, Yu-Chun; Tu, Mei-Hui; Chang, Wei-hau; Cheng, R. Holland
2010-01-01
The virus-like particle (VLP) assembled from capsid subunits of the dragon grouper nervous necrosis virus (DGNNV) is very similar to its native T = 3 virion. In order to investigate the effects of four cysteine residues in the capsid polypeptide on the assembly/dissociation pathways of DGNNV virions, we recombinantly cloned mutant VLPs by mutating each cysteine to destroy the specific disulfide linkage as compared with thiol reduction to destroy all S–S bonds. The mutant VLPs of C187A and C331A mutations were similar to wild-type VLPs (WT-VLPs); hence, the effects of Cys187 and Cys331 on the particle formation and thermostability were presumably negligible. Electron microscopy showed that either C115A or C201A mutation disrupted de novo VLP formation significantly. As shown in micrographs and thermal decay curves, β-mercaptoethanol-treated WT-VLPs remained intact, merely resulting in lower tolerance to thermal disruption than native WT-VLPs. This thiol reduction broke disulfide linkages inside the pre-fabricated VLPs, but it did not disrupt the appearance of icosahedrons. Small dissociated capsomers from EGTA-treated VLPs were able to reassemble back to icosahedrons in the presence of calcium ions, but additional treatment with β-mercaptoethanol during EGTA dissociation resulted in inability of the capsomers to reassemble into the icosahedral form. These results indicated that Cys115 and Cys201 were essential for capsid formation of DGNNV icosahedron structure in de novo assembly and reassembly pathways, as well as for the thermal stability of pre-fabricated particles. PMID:20446029
Mekkaoui, Choukri; Jadbabaie, Farid; Dione, Donald P; Meoli, David F; Purushothaman, Kailasnath; Belardinelli, Luiz; Sinusas, Albert J
2009-10-01
The purpose of this study was to compare a selective A(2A) adenosine receptor agonist (regadenoson) with adenosine in clinically relevant canine models with regard to effects on hemodynamics and thallium-201 ((201)Tl) and technetium-99m ((99m)Tc)-sestaMIBI biodistribution and kinetics. The clinical application of vasodilator stress for perfusion imaging requires consideration of the effects of these vasodilating agents on systemic hemodynamics, coronary flow, and radiotracer uptake and clearance kinetics. Sequential imaging and arterial blood sampling was performed on control, anesthetized closed-chest canines (n = 7) to evaluate radiotracer biodistribution and kinetics after either a bolus administration of regadenoson (2.5 microg/kg) or 4.5-min infusion of adenosine (280 microg/kg). The effects of regadenoson on coronary flow and myocardial radiotracer uptake were then evaluated in an open-chest canine model of a critical stenosis (n = 7). Results from ex vivo single-photon emission computed tomography were compared with tissue well-counting. The use of regadenoson compared favorably with adenosine in regard to the duration and magnitude of the hemodynamic effects and the effect on (201)Tl and (99m)Tc-sestaMIBI biodistribution and kinetics. The arterial blood clearance half-time was significantly faster for (99m)Tc-sestaMIBI (regadenoson: 1.4 +/- 0.03 min; adenosine: 1.5 +/- 0.08 min) than for (201)Tl (regadenoson: 2.5 +/- 0.16 min, p adenosine: 2.7 +/- 0.04 min, p regadenoson stress was significantly greater than the relative perfusion defect with (99m)Tc-sestaMIBI (0.69 +/- 0.03%, p regadenoson produced a hyperemic response comparable to a standard infusion of adenosine. The biodistribution and clearance of both (201)Tl and (99m)Tc-sestaMIBI during regadenoson were similar to adenosine vasodilation. Ex vivo perfusion images under the most ideal conditions permitted detection of a critical stenosis, although (201)Tl offered significant advantages over (99m
Energy Technology Data Exchange (ETDEWEB)
Mueller, K.D.; Rohmann, S.; Bahavar, H.; Grebe, S.F.; Schaper, W.; Schlepper, M. (Kerckhoff-Klinik, Bad Nauheim (Germany))
1991-08-01
To assess the accuracy of two myocardial perfusion markers in quantifying defect size, the left anterior descending coronary artery (LAD) was occluded in 13 porcine hearts. Fourty minutes later 55 MBq {sup 201}TI and 370 MBq {sup 99m}Tc-MIBI were simultaneously injected i.v. in 10 animals. After injection and in vivo double nuclide SPECT acquisition, the risk area was demarcated with fluorescein (FI) dye in 5 animals. The in vitro defect area determined by {sup 201}TI was significant larger (15.8 {+-} 27%) than those of {sup 99m}Tc-MIBI, while FI compared to Tc showed no statistical difference. Thus, in a pig model Tc-MIBI was more accurate with ex vivo imaging. With SPECT thallium imaging defect size was overestimated. In vivo there was a distinct trend with Tc-MIBI studies to underestimate the defect size up to 16%. (orig.).
2010-04-01
... legislative branch of Government, including government corporations. (b) Certification means a written... elsewhere in this section, the following definitions shall apply to this subpart. (a) Agency means a.... (c) Chairman means the Chairman of the Commission. (d) Compromise means the settlement or forgiveness...
Energy Technology Data Exchange (ETDEWEB)
Rodriguez N, C. E. [Instituto Tecnologico de Toluca, Av. Tecnologico s/n, Fraccionamiento La Virgen, 52149 Metepec, Estado de Mexico (Mexico); Monroy G, F.; Fernandez R, E.; Anguiano A, J., E-mail: estefany_rodriguezn@hotmail.com [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)
2012-10-15
The safety is very important in facilities where radioactive wastes are stored. One of the necessary characteristics of the site where these wastes will be disposed is the soil permeability, since a waterproof terrain avoids the diffusion and radionuclide transport in the leakages case. The objective of this work is to study the adsorption kinetics of {sup 201}Tl and the migration of {sup 99m}Tc in natural soil samples. The adsorption kinetics was determined starting from the obtaining of the retention coefficient of the thallium (static method) at different contact times. The technetium diffusion was studied by means of the dynamic method with different soil particles sizes. The results showed that the thallium is totally adsorbed starting from 20 h of contact among this and the mean. On the other hand, the technetium is very mobile in the soil, since it was possible to extract the majority of the tracer with little solvent. Also, it was found that for each soil gram the double water will be needed to leach the technetium almost in its entirety. Moreover, influence exists of the particle size in the migration velocity from the radiotracer to the most mobile being in major sizes than 2 mm that in minor size. (Author)
Energy Technology Data Exchange (ETDEWEB)
Sakamoto, Hiroki; Kondo, Makoto; Motohiro, Masayuki; Usami, Satoru [Shimada Municipal Hospital, Shizuoka (Japan)
2001-12-01
The usefulness of glucose-insulin-thallium-201 (GI-Tl) infusion single photon emission computed tomography (SPECT) in predicting reversible dysfunction has not been evaluated, so the present study recruited 20 patients with regional ischemic dysfunction for investigation. All patients underwent GI-Tl SPECT, post-stress Tl reinjection imaging and low dose dobutamine echocardiography. The diagnostic accuracy of these 3 techniques in predicting functional recovery was evaluated by receiver operating characteristic (ROC) analysis. In segments with functional recovery, regional Tl activities of GI-Tl SPECT were significantly higher than those of reinjection imaging (p<0.05), although there were no significant differences in segments without recovery. The area under the ROC curve for GI-Tl SPECT (0.75{+-}0.06) was greater than that for reinjection imaging (0.68{+-}0.07). The optimal cutoff values to identify viable myocardium were considered to be 55% of peak activity for GI-Tl SPECT and 50% for reinjection imaging. At this cutoff point, the sensitivity and specificity for detection of functional recovery were, respectively, 85% and 61% for GI-Tl SPECT, and 73% and 61% for reinjection imaging. Dobutamine echocardiography had the same sensitivity (85%), but lower specificity (48%) than GI-Tl SPECT. Continuous infusion of GI-Tl solution enhances regional Tl uptake compared with conventional post-stress reinjection imaging. This study suggests that GI-Tl SPECT is superior to reinjection imaging and dobutamine echocardiography in predicting functional recovery after ischemic left ventricular dysfunction. (author)
Energy Technology Data Exchange (ETDEWEB)
Fang, Y [National Cheng Kung University, Tainan, Taiwan (China); Huang, H [Chang Gung University, Taoyuan, Taiwan (China); Su, T [Chang Gung Memorial Hospital, Taoyuan, Taiwan (China)
2015-06-15
Purpose: Texture-based quantification of image heterogeneity has been a popular topic for imaging studies in recent years. As previous studies mainly focus on oncological applications, we report our recent efforts of applying such techniques on cardiac perfusion imaging. A fully automated procedure has been developed to perform texture analysis for measuring the image heterogeneity. Clinical data were used to evaluate the preliminary performance of such methods. Methods: Myocardial perfusion images of Thallium-201 scans were collected from 293 patients with suspected coronary artery disease. Each subject underwent a Tl-201 scan and a percutaneous coronary intervention (PCI) within three months. The PCI Result was used as the gold standard of coronary ischemia of more than 70% stenosis. Each Tl-201 scan was spatially normalized to an image template for fully automatic segmentation of the LV. The segmented voxel intensities were then carried into the texture analysis with our open-source software Chang Gung Image Texture Analysis toolbox (CGITA). To evaluate the clinical performance of the image heterogeneity for detecting the coronary stenosis, receiver operating characteristic (ROC) analysis was used to compute the overall accuracy, sensitivity and specificity as well as the area under curve (AUC). Those indices were compared to those obtained from the commercially available semi-automatic software QPS. Results: With the fully automatic procedure to quantify heterogeneity from Tl-201 scans, we were able to achieve a good discrimination with good accuracy (74%), sensitivity (73%), specificity (77%) and AUC of 0.82. Such performance is similar to those obtained from the semi-automatic QPS software that gives a sensitivity of 71% and specificity of 77%. Conclusion: Based on fully automatic procedures of data processing, our preliminary data indicate that the image heterogeneity of myocardial perfusion imaging can provide useful information for automatic determination
Richter, W S; Beckmann, S; Cordes, M; Schuppenhauer, T; Schartl, M; Munz, D L
2000-12-01
Considerable derangements of energy metabolism are to be expected during ischemia and reperfusion. In ischemic myocardium, the oxidative degradation of carbohydrates is shifted toward the anaerobic production of lactate and the oxidation of fatty acids is suppressed. The aim of this study was to examine the uptake and metabolism of iodine-123 (123I) iodophenylpentadecanoic acid (IPPA) in stunned myocardium. In 15 patients, SPECT with 201Tl and 123I IPPA as well as echocardiography with low-dose dobutamine stimulation were performed 12 +/- 5 days after myocardial infarction with reperfusion. Follow-up echocardiography was carried out 24 +/- 8 days later for documentation of functional improvement. Uptake of 201Tl and 123I IPPA were obtained in five left ventricular segments, and dynamic SPECT imaging was used for calculation of the fast and the slow components of the biexponential myocardial 123I IPPA clearance. Wall motion improved in 14 of 26 dysfunctional segments (54%). Stunned segments were characterized by a reduced 123I IPPA extraction, a shorter half-life of the fast, and a longer half-life of the slow clearance component. All parameters of the combined 201Tl/123I IPPA study predicted functional recovery with similar accuracies (area under the receiver operator characteristic curves between 0.68 and 0.76; p = NS). Analysis of 201Tl uptake alone could not predict functional recovery in this study. Stunned myocardium is characterized by a disturbance of fatty acid metabolism. For prediction of functional improvement, 123I IPPA imaging added significant diagnostic information.
Energy Technology Data Exchange (ETDEWEB)
Koskinas, Marina F.; Almeida, Jamille da Silveira; Moreira, Denise Simões; Semmler, Renato; Dias, Mauro da Silva, E-mail: koskinas@ipen.br, E-mail: jamillealmeida@gmail.com, E-mail: denise.moreira@ipen.br, E-mail: rsemmler@ipen.br, E-mail: msdias@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2017-11-01
This work aims to present the radioactive impurities gamma rays emitters detected in some radiopharmaceuticals widely applied to diagnosis and therapy purposes, supplied to nuclear medicine services in Brazil by the Radiopharmaceutical Center(CR) of Nuclear and Energy Research Institute, IPEN, in São Paulo. The analysis was undertaken by means of an HPGe gamma spectrometer. The radiopharmaceuticals analyzed were: {sup 111}In, {sup 201}Tl, {sup 177}Lu and {sup 99m}Tc. (author)
Energy Technology Data Exchange (ETDEWEB)
Yano, Hiroshi
1988-01-01
The utility of precordial 36-leads ECG mapping (ST-MAP and QRS-MAP) together with the 12-leads ECG (12-ECG, V/sub 1-6/) in 24 patients with anterior myocardial infarction was compared with the findings from the /sup 201/Tl myocardial scintigram (Tl-201) and the left ventriculogram (LVG). Electrocardiograms were recorded from 36 precordial sites, a 6 x 6 matrix and analyzed using an IBM-Bonner program, the mapping program of which was developed in our clinic. There were significant correlations between the parameters of ST-MAP and Tl-index (numbers of the area of perfusion defect: Tl-index), and or /sup 201/Tl-perfusion defect (% of circumferential length of the perfusion defect to total circumferential length of the left ventricle: %Tl-PD) in the early stage of the acute phase of anterior myocardial infarction (13 patients). Among the indices of QRS-MAP, only ..sigma..R (1w)(r = -0.563, P < 0.05), and NQ (3w)(r = 0.567, P < 0.05) had statistically significant correlations with Tl-PD. As for LVG, the parameters of degree of abnormal wall motion, %ACS (abnormally contracting segment), number of Grade 2 + 3 abnormality (akinetic + dyskinetic regions similar to %ACS), and LVEF (left ventricular ejection fraction), were compared with indices of ST-MAP, particularly ..sigma..ST. There was a significant correlation between %ACS, and or LVEF and indices of ST maps. The usefulness of ST parameters of the standard 12-ECG was also evaluated with Tl-201 or LVG. The tendency was similar to that seen with MAP in the acute phase of MI, but was less like the QRS parameters during the chronic phase. (J.P.N.).
Energy Technology Data Exchange (ETDEWEB)
Yamagishi, Hiroyuki; Akioka, Kaname; Shirai, Naoya; Yoshiyama, Minoru; Teragaki, Masakazu; Takeuchi, Kazuhide; Yoshikawa, Junichi; Ochi, Hironobu [Osaka City Univ. (Japan). Graduate School of Medicine
2001-09-01
Many reports have demonstrated that smokers who have suffered an acute myocardial infarction (AMI) have a better prognosis than nonsmokers. The present study investigated the effects of current smoking on myocardial injury with resting {sup 123}I-15-iodophenyl 3-methyl pentadecanoic acid (BMIPP)/{sup 201}Tl myocardial single photon emission computed tomography in 103 patients with conservatively treated AMI. The left ventricular myocardium was divided into 9 segments and BMIPP and {sup 201}Tl defects were scored using a 5-point grading system (0=normal and 4=no uptake). The sum of the defect scores was defined as the total defect score. There was no significant difference in either the baseline severity of the coronary artery discase or the total defect scores for BMIPP and {sup 201}Tl between the current smoker and nonsmoker groups. The difference between the total defect scores for BMIPP and {sup 201}Tl tended to be larger in the current smoker group than in the nonsmoker group (2.0{+-}1.9 vs 1.3{+-}1.6, p=0.056). Forty-one (53%) of 77 patients in the current smoker group exhibited a BMIPP/{sup 201}Tl mismatch, whereas only 8 (31%) of 26 patients in the nonsmoker group did (p=0.047). In conclusion, current smokers had more likelihood of salvageable myocardium in areas at risk, as demonstrated by BMIPP/{sup 201}Tl mismatch, in AMI than nonsmokers. (author)