WorldWideScience

Sample records for assurance program fcap

  1. Performance assurance program plan

    Energy Technology Data Exchange (ETDEWEB)

    Rogers, B.H.

    1997-11-06

    B and W Protec, Inc. (BWP) is responsible for implementing the Performance Assurance Program for the Project Hanford Management Contract (PHMC) in accordance with DOE Order 470.1, Safeguards and Security Program (DOE 1995a). The Performance Assurance Program applies to safeguards and security (SAS) systems and their essential components (equipment, hardware, administrative procedures, Protective Force personnel, and other personnel) in direct support of Category I and H special nuclear material (SNM) protection. Performance assurance includes several Hanford Site activities that conduct performance, acceptance, operability, effectiveness, and validation tests. These activities encompass areas of training, exercises, quality assurance, conduct of operations, total quality management, self assessment, classified matter protection and control, emergency preparedness, and corrective actions tracking and trending. The objective of the Performance Assurance Program is to capture the critical data of the tests, training, etc., in a cost-effective, manageable program that reflects the overall effectiveness of the program while minimizing operational impacts. To aid in achieving this objective, BWP will coordinate the Performance Assurance Program for Fluor Daniel Hanford, Inc. (FDH) and serve as the central point for data collection.

  2. Quality assurance program

    International Nuclear Information System (INIS)

    This topical report describes the Gibbs and Hill Quality Assurance Program and sets forth the methods to be followed in controlling quality-related activities performed by Gibbs and Hill and its contractors. The program is based on company experience in nuclear power and related work, and defines a system found effective in providing independent control of quality-related functions and documentation. The scope of the report covers activities involving nuclear safety-related structures, systems, and components covered by Gibbs and Hill' contractual obligation to the Utility Owner for each project

  3. Quality-Assurance Program Plan

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) is provided to describe the Quality Assurance Program which is applied to the waste management activities conducted by AESD-Nevada Operations at the E-MAD Facility located in Area 25 of the Nevada Test Site. The AESD-Nevada Operations QAPP provides the necessary systematic and administrative controls to assure activities that affect quality, safety, reliability, and maintainability during design, procurement, fabrication, inspection, shipments, tests, and storage are conducted in accordance with established requirements

  4. Quality assurance program

    International Nuclear Information System (INIS)

    The concept of levels of quality assurance as applied to CANDU-type nuclear power plant components, i.e. maintaining an appropriate cost/benefit ratio, is introduced. The design process itself has quality assurance features by virtue of multi-level review. (E.C.B.)

  5. Characteristics quality system assurance of university programs

    OpenAIRE

    Lucian Ion Medar

    2011-01-01

    Quality assurance program of study requires time, dedication, effort, innovative thinking and creativity. Competitive research programs monitored by quality assurance system to create the desired results on the relationship between learning and teaching methods and assessment.

  6. Dicty_cDB: FC-AP01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP01 (Link to dictyBase) - - - Contig-U15092-1 FC-AP01Z (Li...nk to Original site) - - FC-AP01Z 591 - - - - Show FC-AP01 Library FC (Link to library) Clone ID FC-AP01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP01Q.Seq.d/ Representative seq. ID FC-AP...01Z (Link to Original site) Representative DNA sequence >FC-AP01 (FC-AP01Q) /CSM/FC/FC-AP/FC-AP01Q.Seq....EELNISGPLSRNKLKWADFLNLTMNTNHARG HRHGRSPSKIFWRAVRGMLPHKTPRGQAALDNMKVFEGVPAPYDKVKRVVVPSALRVVKL NTTRKYTVLSRLSQE

  7. Dicty_cDB: FC-AP10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP10 (Link to dictyBase) - - - Contig-U15819-1 FC-AP10Z (Li...nk to Original site) - - FC-AP10Z 497 - - - - Show FC-AP10 Library FC (Link to library) Clone ID FC-AP10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP10Q.Seq.d/ Representative seq. ID FC-AP...10Z (Link to Original site) Representative DNA sequence >FC-AP10 (FC-AP10Q) /CSM/FC/FC-AP/FC-AP10Q.Seq....SGDWWDAELKGRRGKVPSNYLQLIKNAAPPRAGGPPVPTGNRA PTTTTTSGGSTRGGFNNGPSTAPSGRGAAPPSSRGGMAPRGGSVAPPSSRGGIAPRGGIA PRGGMAPRGGMAP

  8. Dicty_cDB: FC-AP07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP07 (Link to dictyBase) - - - Contig-U15932-1 FC-AP07P (Li...nk to Original site) FC-AP07F 546 FC-AP07Z 446 FC-AP07P 992 - - Show FC-AP07 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP07Q.Seq.d/ Representative seq. ID FC-AP...07P (Link to Original site) Representative DNA sequence >FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP...ificant alignments: (bits) Value FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP07Q.Seq.d/ 1148 0.0 SSM404 (SSM404Q)

  9. Dicty_cDB: FC-AP08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP08 (Link to dictyBase) - - - Contig-U16116-1 FC-AP08P (Li...nk to Original site) FC-AP08F 125 FC-AP08Z 352 FC-AP08P 477 - - Show FC-AP08 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP08Q.Seq.d/ Representative seq. ID FC-AP...08P (Link to Original site) Representative DNA sequence >FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP... (VSA612Q) /CSM/VS/VSA6-A/VSA612Q.Seq.d/ 624 e-178 FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP

  10. Dicty_cDB: FC-AP24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP24 (Link to dictyBase) - - - Contig-U16528-1 FC-AP24F (Li...nk to Original site) FC-AP24F 525 - - - - - - Show FC-AP24 Library FC (Link to library) Clone ID FC-AP24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP24Q.Seq.d/ Representative seq. ID FC-AP...24F (Link to Original site) Representative DNA sequence >FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq....C-BE24Q.Seq.d/ 1041 0.0 FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq.d/ 1041 0.0

  11. Dicty_cDB: FC-AP13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP13 (Link to dictyBase) - - - Contig-U15374-1 FC-AP13P (Li...nk to Original site) FC-AP13F 550 FC-AP13Z 184 FC-AP13P 734 - - Show FC-AP13 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP13Q.Seq.d/ Representative seq. ID FC-AP...13P (Link to Original site) Representative DNA sequence >FC-AP13 (FC-AP13Q) /CSM/FC/FC-AP/FC-AP...KKRKLNILIIII*fnnhqvmekkikkkiknkkn f*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP

  12. Dicty_cDB: FC-AP21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP21 (Link to dictyBase) - - - Contig-U15099-1 FC-AP21Z (Li...nk to Original site) - - FC-AP21Z 511 - - - - Show FC-AP21 Library FC (Link to library) Clone ID FC-AP21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP21Q.Seq.d/ Representative seq. ID FC-AP...21Z (Link to Original site) Representative DNA sequence >FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP21Q.Seq....14Q.Seq.d/ 1013 0.0 SLE553 (SLE553Q) /CSM/SL/SLE5-C/SLE553Q.Seq.d/ 1013 0.0 FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP

  13. Dicty_cDB: FC-AP22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP22 (Link to dictyBase) - G24045 DDB0232387 Contig-U15141-1 FC-AP...22F (Link to Original site) FC-AP22F 317 - - - - - - Show FC-AP22 Library FC (Link to library) Clone ID FC-AP...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP22Q.Se...q.d/ Representative seq. ID FC-AP22F (Link to Original site) Representative DNA sequence >FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP...KKKKKKK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP

  14. Quality Assurance Program and Brain Drain

    Science.gov (United States)

    Lien, Donald

    2008-01-01

    The number of colleges and universities in most developing countries has increased drastically over the past decades. The quality variation of these institutions is an alarming concern. Quality assurance programs are proposed and implemented. This paper evaluates the effects of quality assurance on the demand for college education, study abroad,…

  15. Tritium systems test assembly quality assurance program

    International Nuclear Information System (INIS)

    A quality assurance program should establish the planned and systematic actions necessary to provide adequate confidence that fusion facilities and their subsystems will perform satisfactorily in service. The Tritium Systems Test Assembly (TSTA) Quality Assurance Program has been designed to assure that the designs, tests, data, and interpretive reports developed at TSTA are valid, accurate, and consistent with formally specified procedures and reviews. The quality consideration in all TSTA activities is directed toward the early detection of quality problems, coupled with timely and positive disposition and corrective action

  16. Good manufacturing practice - quality assurance programs

    International Nuclear Information System (INIS)

    The concept of good manufacturing practice (GMP) in the medical device industry requires the use of controlled methods and equipment in performing each step in the device manufacturing process. Quality assurance programs are used to maintain compliance with GMP requirements by prescribing the operating and control procedures to be used. The specific elements of a quality assurance program for the radiation sterilization of medical devices are described. (author)

  17. Dicty_cDB: FC-AP23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP23 (Link to dictyBase) - G03230 DDB0190153 Contig-U16094-1 FC-AP...23P (Link to Original site) FC-AP23F 515 FC-AP23Z 472 FC-AP23P 987 - - Show FC-AP23 Library FC (Link ...ontig Contig-U16094-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...23Q.Seq.d/ Representative seq. ID FC-AP23P (Link to Original site) Representative DNA sequence >FC-AP23 (FC-AP...23Q) /CSM/FC/FC-AP/FC-AP23Q.Seq.d/ CAAATACATAATCTCTTTTTTGAAAATGTCCGAAAATAACGAAATTGAAATGGAACTCC

  18. Dicty_cDB: FC-AP12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP12 (Link to dictyBase) - G01739 DDB0232214 Contig-U15924-1 FC-AP...12P (Link to Original site) FC-AP12F 323 FC-AP12Z 613 FC-AP12P 936 - - Show FC-AP12 Library FC (Link ...ontig Contig-U15924-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...12Q.Seq.d/ Representative seq. ID FC-AP12P (Link to Original site) Representative DNA sequence >FC-AP12 (FC-AP...12Q) /CSM/FC/FC-AP/FC-AP12Q.Seq.d/ CATATTATTTTAAATTTCAGATGTTCCCAAAATAACACATTAATTTGCTTTTTTTGTTG

  19. National Program of Quality Assurance in Radiotherapy in Cuba

    International Nuclear Information System (INIS)

    It tries on the establishment of a Quality Assurance Nacional System, a Quality Assurance Committee implemented in Cuba, and a Quality Auditory National Program implemented in Cuba to control and assure radiotherapy quality

  20. Dicty_cDB: FC-AP17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 SJMBIB09 SJM Schistosoma japonicum cDNA, mRNA sequence. 80 8e-20 2 BE859184 |BE859184.1 SsS0499 Suaeda salsa ZAP...FC (Link to library) FC-AP17 (Link to dictyBase) - - - Contig-U16254-1 FC-AP17Z (Li...nk to Original site) - - FC-AP17Z 546 - - - - Show FC-AP17 Library FC (Link to library) Clone ID FC-AP17 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP17Q.Seq.d/ Representative seq. ID FC-AP...17Z (Link to Original site) Representative DNA sequence >FC-AP17 (FC-AP17Q) /CSM/FC/FC-AP/FC-AP17Q.Seq.

  1. Dicty_cDB: FC-AP11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone IMAGE:4920557 5', mRNA sequence. 56 1e-04 2 BF345929 |BF345929.1 602017931F1 NCI_CGAP_Brn67 Homo sap...FC (Link to library) FC-AP11 (Link to dictyBase) - - - Contig-U16101-1 FC-AP11F (Li...nk to Original site) FC-AP11F 394 - - - - - - Show FC-AP11 Library FC (Link to library) Clone ID FC-AP11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP11Q.Seq.d/ Representative seq. ID FC-AP...11F (Link to Original site) Representative DNA sequence >FC-AP11 (FC-AP11Q) /CSM/FC/FC-AP/FC-AP11Q.Seq.

  2. Dicty_cDB: FC-AP18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP18 (Link to dictyBase) - - - Contig-U16455-1 FC-AP18Z (Li...nk to Original site) - - FC-AP18Z 367 - - - - Show FC-AP18 Library FC (Link to library) Clone ID FC-AP18 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP18Q.Seq.d/ Representative seq. ID FC-AP...18Z (Link to Original site) Representative DNA sequence >FC-AP18 (FC-AP18Q) /CSM/FC/FC-AP/FC-AP18Q.Seq....XELTPSRPMCVESFNEYPP LGRFAVRDMGQTVAVGVIKSTVKKAPGKAGDKKGAXAPSKKK*innis**iafynnfkkk kkkkk Translated Amino Acid

  3. Dicty_cDB: FC-AP16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP16 (Link to dictyBase) - - - Contig-U16269-1 FC-AP16Z (Li...nk to Original site) - - FC-AP16Z 552 - - - - Show FC-AP16 Library FC (Link to library) Clone ID FC-AP16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP16Q.Seq.d/ Representative seq. ID FC-AP...16Z (Link to Original site) Representative DNA sequence >FC-AP16 (FC-AP16Q) /CSM/FC/FC-AP/FC-AP16Q.Seq....7. 3.28 Translated Amino Acid sequence ---RNRRYKVRKGPLVVVSGKTTVSQALRNIPGVEVANVSRLNLLKLAPGGHLGRFIIWT KSAFEQLD

  4. Dicty_cDB: FC-AP15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP15 (Link to dictyBase) - - - Contig-U15444-1 FC-AP15Z (Li...nk to Original site) - - FC-AP15Z 594 - - - - Show FC-AP15 Library FC (Link to library) Clone ID FC-AP15 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP15Q.Seq.d/ Representative seq. ID FC-AP...15Z (Link to Original site) Representative DNA sequence >FC-AP15 (FC-AP15Q) /CSM/FC/FC-AP/FC-AP15Q.Seq....AAAAAAAAAAAAAAAAAA AAAA sequence update 1997. 3.25 Translated Amino Acid sequence ---RLLKIAEARAATPKGQAAPKAEK

  5. Dicty_cDB: FC-AP05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP05 (Link to dictyBase) - - - Contig-U16521-1 FC-AP05Z (Li...nk to Original site) - - FC-AP05Z 532 - - - - Show FC-AP05 Library FC (Link to library) Clone ID FC-AP05 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP05Q.Seq.d/ Representative seq. ID FC-AP...05Z (Link to Original site) Representative DNA sequence >FC-AP05 (FC-AP05Q) /CSM/FC/FC-AP/FC-AP05Q.Seq....GAGA TCCGTCAAAGTTTCAAGCAAAAAAGTTGTTGCCAAGTAAATAAATAATACTTTTTTCCCT AT sequence update 1997. 3.25 Translated Amino Acid sequence ---AP

  6. The quality assurance program at K & S

    Energy Technology Data Exchange (ETDEWEB)

    Slowey, T.W. [AAPM Accredited Dosimetry Calibration Laboratory, Nashville, TN (United States)

    1993-12-31

    K & S operates the largest and one of the most comprehensive Accredited Dosimetry Calibration Laboratories (ADCLs) in the American Association of Physicists in Medicine (AAPM) secondary laboratory system. It offers calibrations covering energies from Grenz-Ray (0.03-mm Al) to cesium-137 and cobalt-60, brachytherapy source and well chamber calibrations for low-activity sources, and, recently, high-dose-rate iridium-192. The present Quality Assurance (QA) program at K & S began with the AAPM Guidelines for Accreditation (Task Group No. 22 and No. 3, 1989) and grew over the past 10 years to include all aspects of providing a private, self-supporting calibration service from a free-standing independent facility. Some aspects of the QA program were prompted by the requirements of the nuclear power industry while other parts were from national consensus standards or the experiences of staff. Redundancy and teamwork are the most important characteristics of this QA program. K & S has participated in a National Institute of Standards and Technology (NIST) measurement quality assurance (MQA) program since 1982, and, in recent years, an ADCL intralaboratory intercomparison was conducted by Task Group 3 of the Radiation Therapy Committee of the AAPM. One measure of the credibility of a QA program is consistent performance on the MQA program and the ADCL intercomparisons over the past 10 years. An equally important measure of the ability of a program to assure quality results is the frequency of reported errors.

  7. An operational health physics quality assurance program

    International Nuclear Information System (INIS)

    DOE Order 5700.6C, Quality Assurance, stipulates QA requirements for all DOE activities. This order is now codified as 10CFR830.120, Nuclear Safety Management, Quality Assurance Requirements, which is applicable to DOE nuclear facilities. A Quality Assurance Management Plan (QAMP) was developed by the Health Physics Operations Group (ESH-1) at Los Alamos National Laboratory (LANL). The goal of the ESH-1 QAMP is to ensure that operational radiation protection activities meet the criteria outlined in DOE Order 5700.6C, DOE-ER-STD-6001-92 and 10CFR830.120. The ten required elements are QA Program, Personal Training and Qualifications, Quality Improvement, Documents and Records, Work Processes, Design, Procurement, Inspection and Acceptance Testing, Management Assessment and Independent Assessment. The QAMP has been useful for the development of QAMPs at nuclear facilities and has helped ensure uniformity of institutional requirements where Health Physics services are deployed to facilities. To implement a subset of QAMP requirements, a Quality Assurance Self-Evaluation Program (QASE) was established. This program provides a novel self-audit mechanism for the formal identification and correction of non-conforming items related to Operational Health Physics. Additionally, the QASE is a useful management tool for Radiological Control Technician Supervisors and staff and provides a tracking mechanism for ongoing problem areas. Data have been Collected for two calendar years on a number of concerns that fall into four general categories: radiological posting and labeling, instrumentation, monitoring requirements, and radiological documents/records

  8. Nuclear medicine quality assurance program in Argentina

    International Nuclear Information System (INIS)

    A two steps program has been implemented: the first one is the quality control of the equipment and the second one the development of standard procedures for clinical studies of patients. A training program for doctors and technicians of the nuclear medicine laboratories was carried out. Workshops on instrumentation and quality assurance in nuclear medicine have been organized in several parts of the country. A joint program of the CNEA and the University of Buenos Aires has trained medical physicists. A method has been established to evaluate the capability of the laboratories to produce high quality images and to follow up the implementation of the quality control program

  9. Operating and Assurance Program Plan. Revision 4

    Energy Technology Data Exchange (ETDEWEB)

    1994-07-01

    The LBL Operating and Assurance Program (OAP) is a management system and a set of requirements designed to maintain the level of performance necessary to achieve LBL`s programmatic and administrative objectives effectively and safely through the application of quality assurance and related conduct of operations and maintenance management principles. Implement an LBL management philosophy that supports and encourages continual improvement in performance and quality at the Laboratory. Provide an integrated approach to compliance with applicable regulatory requirements and DOE orders. The OAP is intended to meet the requirements of DOE Order 5700.6C, Quality Assurance. The Program also contains management system elements of DOE Orders 5480.19, Conduct of Operations Requirements for DOE Facilities; 5480.25, Safety of Accelerator Facilities; and 4330.4A, Maintenance Management Program, and is meant to integrate these elements into the overall LBL approach to Laboratory management. The requirements of this program apply to LBL employees and organizations, and to contractors and facility users as managed by their LBL sponsors. They are also applicable to external vendors and suppliers as specified in procurement documents and contracts.

  10. Development of a training assurance program

    International Nuclear Information System (INIS)

    The nuclear industry has made a significant commitment to improve training through the implementation of accredited performance-based training programs. Senior management expects that human performance will improve as a result of significant resource allocations. How do they know if training is effective in achieving improved human performance? Florida Power and Light Company is developing a Training Assurance Program to track indicators of training performance and future trends. Integrating the company's Quality Improvement Program processes with systematic training processes is resulting in personnel functioning in a proactive mode and increased customer satisfaction with training performance

  11. Quality Assurance Program for Molecular Medicine Laboratories

    OpenAIRE

    F Sabzavi; M Rafiee; Sohrabi, A.; Nafisi, N; Anjarani, S; P Dahim; S Mirab Samiee; Safadel, N; Hajia, M; B Entekhabi

    2013-01-01

    Background: Molecular diagnostic methods have played and continuing to have a critical role in clinical laboratories in recent years. Therefore, standardization is an evolutionary process that needs to be upgrade with increasing scientific knowledge, improvement of the instruments and techniques. The aim of this study was to design a quality assurance program in order to have similar conditions for all medical laboratories engaging with molecular tests.Methods: We had to design a plan for all...

  12. Quality Assurance Program for Molecular Medicine Laboratories

    OpenAIRE

    Hajia, M; Safadel, N; Samiee, S Mirab; P Dahim; Anjarani, S; Nafisi, N; Sohrabi, A.; M Rafiee; F Sabzavi; B Entekhabi

    2013-01-01

    Background: Molecular diagnostic methods have played and continuing to have a critical role in clinical laboratories in recent years. Therefore, standardization is an evolutionary process that needs to be upgrade with increasing scientific knowledge, improvement of the instruments and techniques. The aim of this study was to design a quality assurance program in order to have similar conditions for all medical laboratories engaging with molecular tests. Methods: We had to design a plan for al...

  13. Quality assurance program plan for radionuclide airborne emissions monitoring

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan identifies quality assurance program requirements and addresses the various Westinghouse Hanford Company organizations and their particular responsibilities in regards to sample and data handling of radiological airborne emissions. This Quality Assurance Program Plan is prepared in accordance with and to written requirements

  14. 10 CFR 71.105 - Quality assurance program.

    Science.gov (United States)

    2010-01-01

    ..., and applicant for a CoC shall review the status and adequacy of the quality assurance program at established intervals. Management of other organizations participating in the quality assurance program shall review regularly the status and adequacy of that part of the quality assurance program they are executing....

  15. 10 CFR 72.144 - Quality assurance program.

    Science.gov (United States)

    2010-01-01

    ... review the status and adequacy of the quality assurance program at established intervals. Management of other organizations participating in the quality assurance program must regularly review the status and... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance program. 72.144 Section 72.144...

  16. Assurance management program for the 30 Nova laser fusion project

    International Nuclear Information System (INIS)

    The Nova assurance management program was developed using the quality assurance (QA) approach first implemented at LLNL in early 1978. The LLNL QA program is described as an introduction to the Nova assurance management program. The Nova system is described pictorially through the Nova configuration, subsystems and major components, interjecting the QA techniques which are being pragmatically used to assure the successful completion of the project

  17. Solid Waste Assurance Program Implementation Plan

    International Nuclear Information System (INIS)

    On June 6, 1995, a waiver to Hanford Site Solid Waste Acceptance Criteria, was approved by the US Department of Energy Richland Operations Office (RL) to replace the low-level, mixed, and transuranic (TRU) generator assessment programs with the Solid Waste Assurance Program (SWAP). This is associated with a waiver that was approved on March 16, 1995 to replace the Storage/Disposal Approval Record (SDAR) requirements with the Waste Specification System (WSS). This implementation plan and the SWAP applies to Solid Waste Disposal (SWD) functions, facilities, and personnel who perform waste acceptance, verification, receipt, and management functions of dangerous, radioactive, and mixed waste from on- and off-site generators who ship to or within the Hanford Site for treatment, storage, and/or disposal (TSD) at SWD TSD facilities

  18. 78 FR 7816 - Quality Assurance Program Requirements (Operations)

    Science.gov (United States)

    2013-02-04

    ... ANSI/ANS 3.2-2012, ``Managerial, Administrative, and Quality Assurance Controls for Operational Phase....2/ANSI N18.7-1976, ``Administrative Controls and Quality Assurance for the Operational Phase of... COMMISSION Quality Assurance Program Requirements (Operations) AGENCY: Nuclear Regulatory Commission....

  19. 10 CFR 830.121 - Quality Assurance Program (QAP).

    Science.gov (United States)

    2010-01-01

    ...) Integrate the quality assurance criteria with the Safety Management System, or describe how the quality assurance criteria apply to the Safety Management System. (3) Use voluntary consensus standards in its... 10 Energy 4 2010-01-01 2010-01-01 false Quality Assurance Program (QAP). 830.121 Section...

  20. 75 FR 9142 - Information Assurance Scholarship Program (IASP)

    Science.gov (United States)

    2010-03-01

    ... other forms of information technology. Title: Information Assurance Scholarship Program (IASP). Type of... Excellence in Information Assurance Education (CAE/IAEs) interested in applying for capacity- building grants... Education (CAE/IAE) and a National Center of Academic Excellence in Information Assurance Research...

  1. Quality Assurance Program for Molecular Medicine Laboratories

    Directory of Open Access Journals (Sweden)

    F Sabzavi

    2013-01-01

    Full Text Available Background: Molecular diagnostic methods have played and continuing to have a critical role in clinical laboratories in recent years. Therefore, standardization is an evolutionary process that needs to be upgrade with increasing scientific knowledge, improvement of the instruments and techniques. The aim of this study was to design a quality assurance program in order to have similar conditions for all medical laboratories engaging with molecular tests.Methods: We had to design a plan for all four elements; required space conditions, equipments, training, and basic guidelines. Necessary guidelines was prepared and confirmed by the launched specific committee at the Health Reference Laboratory.Results: Several workshops were also held for medical laboratories directors and staffs, quality control manager of molecular companies, directors and nominees from universities. Accreditation of equipments and molecular material was followed parallel with rest of program. Now we are going to accredit medical laboratories and to evaluate the success of the program.Conclusion: Accreditation of medical laboratory will be succeeding if its basic elements are provided in advance. Professional practice guidelines, holding training and performing accreditation the molecular materials and equipments ensured us that laboratories are aware of best practices, proper interpretation, limitations of techniques, and technical issues. Now, active external auditing can improve the applied laboratory conditions toward the defined standard level.

  2. Implementation plan: Quality assurance requirements: Hazardous Waste Remedial Actions Program

    International Nuclear Information System (INIS)

    This document establishes the Quality Assurance (QA) Program requirements for the Hazards Waste remedial Actions Program (HASWRAP) for ensuring, with a high degree of confidence, that program objectives will be achieved as planned. The QA Program is introduced in Sect. 1. The HAZWRAP Support Contractor Office (SCO) functional organization and QA responsibilities are shown in Sect. 2. QA program requirements are contained in Sect. 3. These requiremens are pased on the American national Standard, American National Standards Institute/American Society of Mechanical Engineers NQA-1 Quality Assurance Program Requirements for Nuclear Facilities. The 18 elements defined in the standard are tailored to HAZWRAP's needs. The QA program requirements are delineated under the major headings: Quality Assurance Program, Organization, and Control of Quality;two additional program requirements, Software Quality Assurance and Problem Prevention, are included. Definitions of QA terms and the list of formal reports published by the HAZWRAP SCO are included as appendixes. 8 refs., 1 fig

  3. Quality Assurance Program Plan for the Environmental Restoration Program

    International Nuclear Information System (INIS)

    The United States Department of Energy (USDOE) has initiated the Environmental Restoration Program (ERP) in an effort to manage, control and remediate existing hazardous, toxic and radioactive wastes generated at the Portsmouth Gaseous Diffusion Plant (PORTS). This ERP Quality Assurance Program Plan (QAPP) is responsive to the PORTS ESH Division QAPP and the ES Environmental Restoration Division (ERD) QAPP. This QAPP establishes the policies, requirements and responsibilities by which an appropriate level of QA shall be implemented within the PORTS-ERP. All PORTS-ERP activities shall be conducted in accordance with the requirements of this document and/or of a project level document which is derivative of this document

  4. Quality Assurance Program Plan for radionuclide airborne emissions monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Vance, L.M.

    1993-07-01

    This Quality Assurance Program Plan (QAPP) describes the quality assurance requirements and responsibilities for radioactive airborne emissions measurements activities from regulated stacks are controlled at the Hanford Site. Detailed monitoring requirements apply to stacks exceeding 1% of the standard of 10 mrem annual effective dose equivalent to the maximally exposed individual from operations of the Hanford Site.

  5. Quality Assurance Program Plan for radionuclide airborne emissions monitoring

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) describes the quality assurance requirements and responsibilities for radioactive airborne emissions measurements activities from regulated stacks are controlled at the Hanford Site. Detailed monitoring requirements apply to stacks exceeding 1% of the standard of 10 mrem annual effective dose equivalent to the maximally exposed individual from operations of the Hanford Site

  6. Building a global information assurance program

    CERN Document Server

    Curts, Raymond J

    2002-01-01

    INTRODUCTION TO INFORMATION ASSURANCE (IA)AuthenticationConfidentialityNon-repudiationBASIC CONCEPTSAttributesInformation AttributesPure Information AttributesAttributes Influenced by the SystemSystem AttributesSecurity AttributesInformation System Support Planning PrinciplesThe Bottom Line, RevisitedInformation Assurance (IA)Commercial CapabilitiesSecurityNetwork ViewsRisk ManagementCognitive HierarchyTypes of LogicSummaryRISK, THREAT AND VULNERABILITYOVERVIEW OF SYSTEMS ENGINEERINGA Systems Engineering Case StudyCase Study BackgroundThe MissionThe GoalAn Approach Toward A SolutionCase Tools:

  7. Fluor Pioneer Inc. Quality Assurance Program. Topical report FPI-1

    International Nuclear Information System (INIS)

    A quality assurance program is presented which applies to those design and procurement activities involving safety-related structures, systems, and components of nuclear power plants within the Fluor Pioneer scope of work

  8. Transuranic Waste Characterization Quality Assurance Program Plan

    International Nuclear Information System (INIS)

    This quality assurance plan identifies the data necessary, and techniques designed to attain the required quality, to meet the specific data quality objectives associated with the DOE Waste Isolation Pilot Plant (WIPP). This report specifies sampling, waste testing, and analytical methods for transuranic wastes

  9. Marshall Island radioassay quality assurance program an overview

    Energy Technology Data Exchange (ETDEWEB)

    Conrado, C.L.; Hamilton, T.F.; Kehl, S.R.; Robison, W.L.; Stoker, A.C.

    1998-09-01

    The Lawrence Livermore National Laboratory has developed an extensive quality assurance program to provide high quality data and assessments in support of the Marshall Islands Dose Assessment and Radioecology Program. Our quality assurance objectives begin with the premise of providing integrated and cost-effective program support (to meet wide-ranging programmatic needs, scientific peer review, litigation defense, and build public confidence) and continue through from design and implementation of large-scale field programs, sampling and sample preparation, radiometric and chemical analyses, documentation of quality assurance/quality control practices, exposure assessments, and dose/risk assessments until publication. The basic structure of our radioassay quality assurance/quality control program can be divided into four essential elements; (1) sample and data integrity control; (2) instrument validation and calibration; (3) method performance testing, validation, development and documentation; and (4) periodic peer review and on-site assessments. While our quality assurance objectives are tailored towards a single research program and the evaluation of major exposure pathways/critical radionuclides pertinent to the Marshall Islands, we have attempted to develop quality assurance practices that are consistent with proposed criteria designed for laboratory accre

  10. Measurement assurance program for FTIR analyses of deuterium oxide samples

    International Nuclear Information System (INIS)

    Analytical chemistry measurements require an installed criterion based assessment program to identify and control sources of error. This program should also gauge the uncertainty about the data. A self- assessment was performed of long established quality control practices against the characteristics of a comprehensive measurement assurance program. Opportunities for improvement were identified. This paper discusses the efforts to transform quality control practices into a complete measurement assurance program. The resulting program heightened the laboratory's confidence in the data it generated, by providing real-time statistical information to control and determine measurement quality

  11. Mixed Waste Integrated Program Quality Assurance requirements plan

    International Nuclear Information System (INIS)

    Mixed Waste Integrated Program (MWIP) is sponsored by the US Department of Energy (DOE), Office of Technology Development, Waste Management Division. The strategic objectives of MWIP are defined in the Mixed Waste Integrated Program Strategic Plan, and expanded upon in the MWIP Program Management Plan. This MWIP Quality Assurance Requirement Plan (QARP) applies to mixed waste treatment technologies involving both hazardous and radioactive constituents. As a DOE organization, MWIP is required to develop, implement, and maintain a written Quality Assurance Program in accordance with DOE Order 4700.1 Project Management System, DOE Order 5700.6C, Quality Assurance, DOE Order 5820.2A Radioactive Waste Management, ASME NQA-1 Quality Assurance Program Requirements for Nuclear Facilities and ANSI/ASQC E4-19xx Specifications and Guidelines for Quality Systems for Environmental Data Collection and Environmental Technology Programs. The purpose of the MWIP QA program is to establish controls which address the requirements in 5700.6C, with the intent to minimize risks and potential environmental impacts; and to maximize environmental protection, health, safety, reliability, and performance in all program activities. QA program controls are established to assure that each participating organization conducts its activities in a manner consistent with risks posed by those activities

  12. Quality assurance program. Braun topical report 21

    International Nuclear Information System (INIS)

    The Quality Assurance (QA) policies and procedures described have been developed specifically for use in commercial nuclear projects. These policies and procedures are intended to provide assurance to Braun Management and the client that the plant will be safe, reliable, and operable, plus meet the requirements of the Nuclear Regulatory Commission, NRC. The Braun QA Manual provides QA procedures for (1) engineering and design, (2) procurement of materials, equipment, and services, and (3) construction and installation. The controls for safety-related systems established in the manual cover all phases of work from project inception to plant completion prior to operation by the owner. The manual standardizes Braun QA control procedures. These procedures are supplemented by Project QA Instructions prepared for each project. (U.S.)

  13. Quality assurance program description: Hanford Waste Vitrification Plant, Part 1

    International Nuclear Information System (INIS)

    This document describes the Department of Energy's Richland Field Office (DOE-RL) quality assurance (QA) program for the processing of high-level waste as well as the Vitrification Project Quality Assurance Program for the design and construction of the Hanford Waste Vitrification Plant (HWVP). It also identifies and describes the planned activities that constitute the required quality assurance program for the HWVP. This program applies to the broad scope of quality-affecting activities associated with the overall HWVP Facility. Quality-affecting activities include designing, purchasing, fabricating, handling, shipping, storing, cleaning, erecting, installing, inspecting, testing, maintaining, repairing, and modifying. Also included are the development, qualification, and production of waste forms which may be safely used to dispose of high-level radioactive waste resulting from national defense activities. The HWVP QA program is made up of many constituent programs that are being implemented by the participating organizations. This Quality Assurance program description is intended to outline and define the scope and application of the major programs that make up the HWVP QA program. It provides a means by which the overall program can be managed and directed to achieve its objectives. Subsequent parts of this description will identify the program's objectives, its scope, application, and structure

  14. The NASA Commercial Crew Program (CCP) Mission Assurance Process

    Science.gov (United States)

    Canfield, Amy

    2016-01-01

    In 2010, NASA established the Commercial Crew Program in order to provide human access to the International Space Station and low earth orbit via the commercial (non-governmental) sector. A particular challenge to NASA has been how to determine the commercial providers transportation system complies with Programmatic safety requirements. The process used in this determination is the Safety Technical Review Board which reviews and approves provider submitted Hazard Reports. One significant product of the review is a set of hazard control verifications. In past NASA programs, 100 percent of these safety critical verifications were typically confirmed by NASA. The traditional Safety and Mission Assurance (SMA) model does not support the nature of the Commercial Crew Program. To that end, NASA SMA is implementing a Risk Based Assurance (RBA) process to determine which hazard control verifications require NASA authentication. Additionally, a Shared Assurance Model is also being developed to efficiently use the available resources to execute the verifications. This paper will describe the evolution of the CCP Mission Assurance process from the beginning of the Program to its current incarnation. Topics to be covered include a short history of the CCP; the development of the Programmatic mission assurance requirements; the current safety review process; a description of the RBA process and its products and ending with a description of the Shared Assurance Model.

  15. Quality assurance and quality control in monitoring programs

    Science.gov (United States)

    Shampine, W.J.

    1993-01-01

    There are three general characteristics of the data to be collected in a monitoring program that should be met in order to maximize the use and value of the data: the data quality should be known the data type and quality should be consistent and comparable, and the data should be available and accessible. Potential problems with each of these characteristics are addressed effectively by quality assurance and quality control. One of the most important aspects of quality assurance in a monitoring program is the development of a quality assurance plan, which should identify clearly the quality of the data needed and describe in detail the planned actions to provide confidence that the program will meet its stated objectives. Quality control data, which allow for the quality and suitability of the environmental data to be evaluated and ascertained, should be collected and utilized as an integral part of the QA effort associated with a monitoring program.

  16. Quality assurance program preparation - review of requirements and plant systems - selection of program levels

    International Nuclear Information System (INIS)

    The establishment and implementation for a practicable quality assurance program for a nuclear power plant demands a detailed background in the field of engineering, manufacturing, organization and quality assurance. It will be demonstrated with examples to define and control the achievement of quality related activities during the phases of design, procurement, manufactoring, commissioning and operation. In general the quality assurance program applies to all items, processes and services important to safety of nuclear power plant. The classification for safety related and non-safety related items and services demonstrate the levels of quality assurance requirements. The lecture gives an introduction of QA Program preparation under the following topics: -Basic criteria and international requirements - Interaction of QA activities - Modular and product oriented QA programs - Structuring of organization for the QA program - Identification of the main quality assurance functions and required actions - Quality Assurance Program documentation - Documentation of planning of activities - Control of program documents - Definitions. (orig./RW)

  17. The assurance management program for the Nova laser fusion project

    International Nuclear Information System (INIS)

    In a well managed project, Quality Assurance is an integral part of the management activities performed on a daily basis. Management assures successful performance within budget and on schedule by using all the good business, scientific, engineering, quality assurance, and safety practices available. Quality assurance and safety practices employed on Nova are put in perspective by integrating them into the overall function of good project management. The Inertial Confinement Fusion (ICF) approach is explained in general terms. The laser ICF and magnetic fusion facilities are significantly different in that the laser system is used solely as a highly reliable energy source for performing plasma physics experiments related to fusion target development; by contrast, magnetic fusion facilities are themselves the experiments. The Nova project consists of a 10-beam, 74 cm aperture neodymium-glass laser experimental facility which is being constructed by the Lawrence Livermore National Laboratory (LLNL) for the U.S. Department of Energy. Nova has a total estimated cost of $176M and will become operational in the Fall of 1984. The Nova laser will be used as the high energy driver for studying the regime of ignition for ICF. The Nova assurance management program was developed using the quality assurance (QA) approach first implemented at LLNL in early 1978. The LLNL QA program is described as an introduction to the Nova assurance management program. The Nova system is described pictorially through the Nova configuration, subsystems and major components, interjecting the QA techniques which are being pragmatically used to assure the successful completion of the project

  18. Development of Ambulatory Quality Assurance Program Using Computerized Medical Records

    OpenAIRE

    Shrader, J.; Wright, C; Mieczkowski, L.; McDonald, S.

    1993-01-01

    As part of the computerization of the ambulatory teaching facility for our residency program, we have successfully utilized a comprehensive computerized medical records system to develop a specific quality assurance program. Our QA program includes allergy audits, health screening audits, drug utilization and recall audits, and nursing care plan audits. With a computerized QA program, specific question about individual patients as well as questions regarding our patient population are quickly...

  19. Quality assurance program plan for SNF characterization support project

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) provides information on how the Quality Assurance Program is implemented for the Spent Nuclear Fuel Characterization Support Project. This QAPP has been developed specifically for the Spent Nuclear Fuel Characterization Support Project, per Letter of Instruction (LOI) from Duke Engineering and Services Company, letter No. DESH-9655870, dated Nov. 22, 1996. It applies to those items and tasks which affect the completion of activities identified in the work breakdown structure of the Project Management Plan (PMP) and LOI. These activities include installation of sectioning equipment and furnace, surface and subsurface examinations, sectioning for metallography, and element drying and conditioning testing, as well as project related operations within the 327 facility as it relates to the specific activities of this project. General facility activities are covered in other appropriate QA-PPS. In addition, this QAPP supports the related quality assurance activities addressed in CM-2-14, Hazardous Material Packaging and Shipping,1261 and HSRCM-1, Hanford Site Radiological Control Manual. The 327 Building is currently transitioning from being a Pacific Northwest National Laboratory (PNNL) managed facility to a Babcock and Wilcox Hanford Company (BVMC) managed facility. During this transition process existing procedures and documents will be utilized until replaced by BVMC procedures and documents. These documents conform to the requirements found in PNL-MA-70, Quality Assurance Manual and PNL-MA-8 1, Hazardous Materials Shipping Manual. The Quality Assurance Program Index (QAPI) contained in Table 1 provides a matrix which shows how project activities relate to IO CFR 830.120 and 5700.6C criteria. Quality Assurance program requirements will be addressed separate from the requirements specified in this document. Other Hanford Site organizations/companies may be utilized in support of this project and the subject organizations are

  20. Overall quality assurance program requirements for nuclear power plants

    International Nuclear Information System (INIS)

    This standard contains the requirements for the owner's overall quality assurance program for a nuclear power plant. This program encompasses all phases of a nuclear power plant life cycle, including site evaluation, design, procurement, manufacturing, construction and installation, commissioning, operation, and decommissioning. It covers the activities associated with specifying, directing, and administering the work to be done during these phases, and the evaluation and integrated of the activities and programs of participants

  1. The Future of Michigan Agriculture Environmental Assurance Program (MAEAP)

    OpenAIRE

    Joshi, Satish; Miller, Steven R.; Abdulkadri, Abdullahi O.; Batie, Sandra S.

    2013-01-01

    This is a decision teaching case study, where the Program Manager, Michigan Agriculture Environmental Assurance Program (MAEAP) is faced with the problem of determining the future direction of the MAEAP going forward from 2010. During the case discussion students should be able to: 1. Identify and model various motivations for participation in voluntary environmental programs. 2. Recognize motivational conflicts among various participants/stakeholders. 3. Appreciate the political economy of s...

  2. The Rockford School of Medicine Undergraduate Quality Assurance Program

    Science.gov (United States)

    Barr, Daniel; And Others

    1976-01-01

    An undergraduate program of ambulatory care quality assurance is described which has been operational at the Rockford School of Medicine for three years. Focus is on involving students in peer review and related audit activities. Results of preliminary evaluation are reported and generalizations offered. (JT)

  3. 78 FR 54510 - New Entrant Safety Assurance Program Operational Test

    Science.gov (United States)

    2013-09-04

    ... Process'' on May 13, 2002 (67 FR 31978), which became effective January 1, 2003. Subpart D of 49 CFR part... determine if the carrier is exercising basic safety management controls. On December 16, 2008 (73 FR 76472... TRANSPORTATION Federal Motor Carrier Safety Administration New Entrant Safety Assurance Program Operational...

  4. The quality assurance program at K ampersand S

    International Nuclear Information System (INIS)

    K ampersand S operates the largest and one of the most comprehensive Accredited Dosimetry Calibration Laboratories (ADCLs) in the American Association of Physicists in Medicine (AAPM) secondary laboratory system. It offers calibrations covering energies from Grenz-Ray (0.03-mm Al) to cesium-137 and cobalt-60, brachytherapy source and well chamber calibrations for low-activity sources, and, recently, high-dose-rate iridium-192. The present Quality Assurance (QA) program at K ampersand S began with the AAPM Guidelines for Accreditation (Task Group No. 22 and No. 3, 1989) and grew over the past 10 years to include all aspects of providing a private, self-supporting calibration service from a free-standing independent facility. Some aspects of the QA program were prompted by the requirements of the nuclear power industry while other parts were from national consensus standards or the experiences of staff. Redundancy and teamwork are the most important characteristics of this QA program. K ampersand S has participated in a National Institute of Standards and Technology (NIST) measurement quality assurance (MQA) program since 1982, and, in recent years, an ADCL intralaboratory intercomparison was conducted by Task Group 3 of the Radiation Therapy Committee of the AAPM. One measure of the credibility of a QA program is consistent performance on the MQA program and the ADCL intercomparisons over the past 10 years. An equally important measure of the ability of a program to assure quality results is the frequency of reported errors

  5. Management assessments of Quality Assurance Program implementation effectiveness

    International Nuclear Information System (INIS)

    This paper describes a method currently being used by UNC Nuclear Industries, Richland, Washington, to help assure the effectiveness of Quality Assurance (QA) Program implementation. Assessments are conducted annually by management in each department, and the results summarized to the president and his staff. The purpose of these assessments is to review the adequacy of the department's implementing procedures, training/instruction on implementing procedures, and procedure implementation effectiveness. The primary purpose is to assess effectiveness and take improvement action where the need is indicated. The QA organization provides only general guidance in conducting the assessments

  6. 200 Area Liquid Effluent Facilities -- Quality assurance program plan

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) describes the quality assurance and management controls used by the 200 Area Liquid Effluent Facilities (LEF) to perform its activities in accordance with DOE Order 5700.6C. The 200 Area LEF consists of the following facilities: Effluent Treatment Facility (ETF); Treated Effluent Disposal Facility (TEDF); Liquid Effluent Retention facility (LERF); and Truck Loading Facility -- (Project W291). The intent is to ensure that all activities such as collection of effluents, treatment, concentration of secondary wastes, verification, sampling and disposal of treated effluents and solids related with the LEF operations, conform to established requirements

  7. ERD UMTRA Project quality assurance program plan, Revision 7

    International Nuclear Information System (INIS)

    This document is the revised Quality Assurance Program Plan (QAPP) dated September, 1995 for the Environmental Restoration Division (ERD) Uranium Mill Tailings Remedial Action Project (UMTRA). Quality Assurance requirements for the ERD UMTRA Project are based on the criteria outlined in DOE Order 5700.6C or applicable sections of 10 CFR 830.120. QA requirements contained in this QAPP shall apply to all personnel, processes, and activities, including planning, scheduling, and cost control, performed by the ERD UMTRA Project and its contractors

  8. Quality assurance program in diagnostic radiology

    International Nuclear Information System (INIS)

    Aiming to elaborate a methodology to optimize the performance of the Radiology Service of the Military Police Hospital, in Rio dee Janeiro, some goals were established: improvement of the attendance to patients; improvement of the qualification of technicians; achievement and maintenance of high degrees of quality in each step of the radiological process; improvement of the image quality; optimization of dose per examination and cost reduction. The procedure used to detect faults in the radiological process was the analysis of causes of film losses. Results show a 70% reduction in the film rejection rate. 74% of total identified faults were due to equipment, 11% to films, 10% to patients and 5% to developing. The reduction in the cost of developed film reached 75%. A training course given to the staff of the radiological service fully reached its goals, contributing, with the staff motivation, mostly to the success of the program. This success indicates that, with a serious persistent work, it is possible to offer to patients services within their expectations, even at a public hospital. Such programs should be supported by health authorities, not only due to their technical and economic needs but, mostly, due to their social implications. (author). 10 refs., 11 figs

  9. The role of the EPA radiation quality assurance program in the measurement quality assurance accreditation program for radioassay laboratories

    International Nuclear Information System (INIS)

    As the nature and extent of radiological contamination becomes better documented and more public, radioanalytical laboratories are faced with a constantly expanding variety of new and difficult analytical requirements. Concurrent with those requirements is the responsibility to provide customers, regulatory officials, or the public with defensible data produced in an environment of verifiable, controlled quality. To meet that need, a quality assurance accreditation program for radioassay laboratories has been proposed by the American National Standards Institute (ANSI). The standard will provide the organizational framework and functional requirements needed to assure the quality of laboratory outputs. Under the proposed program, the U.S. Environmental Protection Agency's (EPA's) Laboratory Intercomparison Program plays a key role as a reference laboratory. The current and proposed roles of the EPA Intercomparison Program are discussed, as are the functional relationships between EPA, the accreditating organization, and the service and monitoring laboratories

  10. The role of the EPA radiation quality assurance program in the measurement quality assurance accreditation program for radioassay laboratories

    Energy Technology Data Exchange (ETDEWEB)

    Grady, T.M. [Environmental Monitoring Systems Laboratory, Las Vegas, NV (United States)

    1993-12-31

    As the nature and extent of radiological contamination becomes better documented and more public, radioanalytical laboratories are faced with a constantly expanding variety of new and difficult analytical requirements. Concurrent with those requirements is the responsibility to provide customers, regulatory officials, or the public with defensible data produced in an environment of verifiable, controlled quality. To meet that need, a quality assurance accreditation program for radioassay laboratories has been proposed by the American National Standards Institute (ANSI). The standard will provide the organizational framework and functional requirements needed to assure the quality of laboratory outputs. Under the proposed program, the U.S. Environmental Protection Agency`s (EPA`s) Laboratory Intercomparison Program plays a key role as a reference laboratory. The current and proposed roles of the EPA Intercomparison Program are discussed, as are the functional relationships between EPA, the accreditating organization, and the service and monitoring laboratories.

  11. Quality Assurance program plan - plutonium stabilization and handling project W-460

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) identifies Project Quality Assurance (QA) program requirements for all parties participating in the design, procurement, demolition, construction, installation, inspection and testing for Project W-460

  12. UMTRA technical assistance contractor quality assurance program plan

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) provides the primary requirements for the integration of quality functions into all Technical Assistance Contractor (TAC) Project organization activities. The QAPP is the written directive authorized by the TAc Program Manager to accomplish this task and to implement procedures that provide the controls and sound management practices needed to ensure TAC contractual obligations are met. The QA program is designed to use monitoring, audit, and surveillance functions as management tools to ensure that all Project organization functions are executed in a manner that will protect public health and safety, promote the success of the Project, and meet or exceed contract requirements

  13. Quality assurance program plan for cesium legacy project

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) provides information on how the Quality Assurance Program is implemented for the Cesium Legacy Project. It applies to those items and tasks which affect the completion of activities identified in the work breakdown structure of the Project Management Plan (PMP). These activities include all aspects of cask transportation, project related operations within the 324 Building, and waste management as it relates to the specific activities of this project. General facility activities (i.e. 324 Building Operations, Central Waste Complex Operations, etc.) are covered in other appropriate QAPPs. The 324 Building is currently transitioning from being a Pacific Northwest National Laboratory (PNNL) managed facility to a B and W Hanford Company (BWHC) managed facility. During this transition process existing PNNL procedures and documents will be utilized until replaced by BWHC procedures and documents

  14. UMTRA Project Office quality assurance program plan. Revision 6

    International Nuclear Information System (INIS)

    The Uranium Mill Tailings Remedial Action (UMTRA) Project was established to accomplish remedial actions at inactive uranium mill tailings sites. The UMTRA Project's mission is to stabilize and control the residual radioactive materials at designated sites in a safe and environmentally sound manner so as to minimize or eliminate radiation health hazards to the public. Because these efforts may involve possible risks to public health and safety, a quality assurance (QA) program that conforms to the applicable criteria has been established to control the quality of the work. This document, the Quality Assurance Program Plan (QAPP), brings into one document the essential criteria to be applied on a selective basis, depending upon the nature of the activity being conducted, and describes how those criteria shall be applied to the UMTRA Project. QA requirements contained in this QAPP shall apply to all personnel, processes, and activities, including planning, scheduling, and cost control, performed by the UMTRA Project Office and its contractors

  15. Participation in Quality Assurance Programs in the Apple Industry

    OpenAIRE

    Bewsell, Denise; Kaine, Geoff

    2006-01-01

    There are several quality assurance (QA) programs operating in Australia for horticulturalists. The documentation of orchard activities and decision making are key features of any QA system. Activities of interest are management of pest and diseases, irrigation, fertiliser management, and fruit production and packing. This documentation provides a means of tracing product flow and is evidence that growers are acting in an environmentally responsible manner to help achieve food safety. QA syst...

  16. NIF Project Quality Assurance Program Plan Revision E

    Energy Technology Data Exchange (ETDEWEB)

    Dun, C; Brereton, S; Yatabe, J; Moses, E I

    2001-06-01

    The National Ignition Facility (NIF) is a key constituent of the Department Energy's (DOE's) Stockpile Stewardship Program. The NIF will use inertial confinement fusion (ICF) to produce ignition and energy gain in ICF targets and will perform weapons physics, weapons effects, and high-energy-density experiments in support of national security and civilian objectives. The primary mission of the NIF Project is the design and construction of the facility and equipment, acceptance testing, and activation. To accomplish this mission, the LLNL Director created the NIF Programs Directorate, and within that Directorate, the NIF Project Office to organize and manage the Project. The NIF Project Office establishes this QA Program to ensure its success. This QA Program Plan (QAPP) defines and describes the program--the management system--for specifying, achieving, and assuring the quality of all NIF Project work consistent with the policies of LLNL and the NIF Programs Directorate.

  17. Quality assurance program plan for low-level waste at the WSCF Laboratory

    International Nuclear Information System (INIS)

    The purpose of this document is to provide guidance for the implementation of the Quality Assurance Program Plan (QAPP) for the management of low-level waste at the Waste Sampling and Characterization Facility (WSCF) Laboratory Complex as required by WHC-CM-4-2, Quality Assurance Manual, which is based on Quality Assurance Program Requirements for Nuclear Facilities, NQA-1 (ASME)

  18. 42 CFR 423.153 - Drug utilization management, quality assurance, and medication therapy management programs (MTMPs).

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Drug utilization management, quality assurance, and... management, quality assurance, and medication therapy management programs (MTMPs). (a) General rule. Each... utilization management program, quality assurance measures and systems, and an MTMP as described in...

  19. Quality assurance program requirements for research reactors - approved 1976

    International Nuclear Information System (INIS)

    The standard provides requirements for establishing, managing, conducting, and evaluating quality assurance programs for the design, construction, testing, modification and maintenance of research reactors and associated experiments, but not routine reactor operations. In terms of this standard: (1) quality assurance comprises those planned and systematic actions necessary to provide adequate confidence that a structure, system, or component will perform satisfactorily in service; (2) a research reactor is one used for scientific, engineering, or training purposes which operates at: (a) a thermal power level of 1 megawatt or less; or (b) a thermal power level of 10 megawatts or less and does not contain: (i) a flow loop through the core in which fueled experiments are conducted, or (ii) a liquid fuel loading, or (iii) an experimental facility in the core in excess of 16 square inches (103.2 cm2) in cross-section. Quality assurance effort is applied to safety-related items, which are defined as those physical structures, systems, and components whose intended functions are to either prevent accidents that could cause undue risk to the health and safety or the public, or to control and mitigate the consequences of such accidents

  20. Argonne National Laboratory Internal Appraisal Program environment, safety, health/quality assurance oversight

    Energy Technology Data Exchange (ETDEWEB)

    Winner, G.L.; Siegfried, Y.S.; Forst, S.P.; Meshenberg, M.J.

    1995-06-01

    Argonne National Laboratory`s Internal Appraisal Program has developed a quality assurance team member training program. This program has been developed to provide training to non-quality assurance professionals. Upon successful completion of this training and approval of the Internal Appraisal Program Manager, these personnel are considered qualified to assist in the conduct of quality assurance assessments. The training program has been incorporated into a self-paced, computerized, training session.

  1. Data Control Program to support the Quality Assurance System

    International Nuclear Information System (INIS)

    In order to give support the Quality Assurance System (QAS) in Odontological Radiology a software called Data Control Program (DCP) was developed. The aim of the DCP was to applied an uniform methodology during the inspections and for control of administrative and financial data. First, the DCP was developed using microsoft. The microcomputer configuration employs a Pentium 200 MHz processor, 64 MB of memory and 3,2 GB of free space in the hard disk. The DCP allows for the simultaneous use of several departments in the company providing the elaboration of safe and reliable system of information management in several areas and a fast and good performance in services

  2. A comparative study of the properties of TiN films deposited by MAIP and FCAP

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    In this study two types of TiN films were prepared, one using the filtered cathodic arc plasma (FC AP) technique with an in-plane "S" filier, and the other using the multi-arc ion-plating (MAIP), and both deposited under the same parameters. Comparisons of the texture, hardness, roughness, tribological and electrochemical corrosion behaviors of the two types of TiN films were given. The TiN films obtained by the FCAP technology were found to be highly uniform, smooth and macroparticle-free. The TiN films deposited by FCAP had a (111) preferred orientation, while there was no texture in the films deposited by MAIP. Under low load the two kinds of TiN coatings had very different wear mechanisms; the films of FCAP had a lower wear rate and friction coefficient compared with the TiN films deposited by the MAIP technique. The dense and hole-free structure of TiN films of FCAP could effectively avoid the avalanche of TiN films from the substrate during corrosion tests.

  3. Quality Assurance Program Plan (QAPP) Waste Management Project

    Energy Technology Data Exchange (ETDEWEB)

    VOLKMAN, D.D.

    1999-10-27

    This document is the Quality Assurance Program Plan (QAPP) for Waste Management Federal Services of Hanford, Inc. (WMH), that implements the requirements of the Project Hanford Management Contract (PHMC), HNF-MP-599, Project Hanford Quality Assurance Program Description (QAPD) document, and the Hanford Federal Facility Agreement with Consent Order (Tri-Party Agreement), Sections 6.5 and 7.8. WHM is responsible for the treatment, storage, and disposal of liquid and solid wastes generated at the Hanford Site as well as those wastes received from other US Department of Energy (DOE) and non-DOE sites. WMH operations include the Low-Level Burial Grounds, Central Waste Complex (a mixed-waste storage complex), a nonradioactive dangerous waste storage facility, the Transuranic Storage Facility, T Plant, Waste Receiving and Processing Facility, 200 Area Liquid Effluent Facility, 200 Area Treated Effluent Disposal Facility, the Liquid Effluent Retention Facility, the 242-A Evaporator, 300 Area Treatment Effluent Disposal Facility, the 340 Facility (a radioactive liquid waste handling facility), 222-S Laboratory, the Waste Sampling and Characterization Facility, and the Hanford TRU Waste Program.

  4. Importance of quality assurance in establishing nucleoelectric programs - Spanish experience

    International Nuclear Information System (INIS)

    One condition which must be fulfilled in order for a nucleoelectric station to be successfully introduced, in countries being developed, is to define and structure the necessary organizations which will carry out the programs and insure that the stations be reliable, safe and economical. The two basic organizations which should be defined and structured are: a) The Government organization, whose objective is to insure the health and safety of the public, by means of evaluation, revision and control of the projects and their future operation; and b) The Project Management organization, whose objective is to select the site and the prototype of the station to be installed as well as carry out the project in such a way that the stations produce the expected amount of energy at a competitive kwh price and so that the operation does not create undue or unacceptable risks for the public. The importance of the quality assurance on the job is analyzed to achieve the indicated objectives, specific missions are defined and the quality assurance is presented as the link between the binomial National Participation-Quality Demands. The Spanish experience, referring to the application of quality in its present nuclear program with about 6500 Mwe in the construction stage and another 15.000 Mwe in various study and contracting stages, is also analyzed

  5. Recommendations for quality assurance programs in nuclear medicine facilities. Radiation recommendations series

    International Nuclear Information System (INIS)

    The publication provides the elements that should be considered by nuclear medicine facilities to improve their existing programs or develop new quality assurance programs. The important administrative aspects of quality assurance programs are stressed. Each facility is encouraged to adopt those elements of the recommended program that are appropriate to its individual needs and resources

  6. Three steps to a more successful quality assurance program

    International Nuclear Information System (INIS)

    The three steps that will be presented are by no means a cure-all for the variety of problems and challenges that a Quality Assurance (QA) Department is faced with in its role in the design and construction of a nuclear power plant. However, these steps are considered to be three of the most important ones in the realization of an effective and efficient QA program. Step 1. Awareness. With the multitude of people involved in activities that effect the resultant Quality of Design, Procurement, and Construction of a nuclear power plant, a concerted effort has been put forth at Bechtel to promote 'Quality Awareness'. This effort has resulted in presentations to thousands of engineers, buyers, superintendents, supervisors and many others to make them more aware of their role in the Quality program. These presentations cover the Quality criteria, organizations, manuals, and implementation responsibilities that constitute the Company Quality program. In addition to the above, many specialized courses covering inspection techniques, communications, auditing, problem solving, etc. have been given to the people involved in the Generic Quality Assurance functions. Step 2. Attitude. Nuclear Power Quality requirements are quite stringent and have presented additional requirements to engineers, buyers, and superintendents who have previously designed and constructed fossil fuel power plants. Logically there was a resistance to these new requirements and a number of attitudes had to be changed. The most effective way that we have found to accomplish this is through communications from top management expressing their support of the Quality Program. Step 3. Objective and economical compliance. With the increased awareness and a more positive attitude toward Quality requirements, Bechtel has been able to devote considerable effort on finding effective methods to comply with Quality requirements in the most economical way. The complete presentation will include several examples of

  7. Environmental Assurance Program for the Phoenix Mars Mission

    Science.gov (United States)

    Man, Kin F.; Natour, Maher C.; Hoffman, Alan R.

    2008-01-01

    The Phoenix Mars mission involves delivering a stationary science lander on to the surface of Mars in the polar region within the latitude band 65 deg N to 72 deg N. Its primary objective is to perform in-situ and remote sensing investigations that will characterize the chemistry of the materials at the local surface, subsurface, and atmosphere. The Phoenix spacecraft was launched on August 4, 2007 and will arrive at Mars in May 2008. The lander includes a suite of seven (7) science instruments. This mission is baselined for up to 90 sols (Martian days) of digging, sampling, and analysis. Operating at the Mars polar region creates a challenging environment for the Phoenix landed subsystems and instruments with Mars surface temperature extremes between -120 deg C to 25 deg C and diurnal thermal cycling in excess of 145 deg C. Some engineering and science hardware inside the lander were qualification tested up to 80 deg C to account for self heating. Furthermore, many of the hardware for this mission were inherited from earlier missions: the lander from the Mars Surveyor Program 2001 (MSP'01) and instruments from the MSP'01 and the Mars Polar Lander. Ensuring all the hardware was properly qualified and flight acceptance tested to meet the environments for this mission required defining and implementing an environmental assurance program that included a detailed heritage review coupled with tailored flight acceptance testing. A heritage review process with defined acceptance success criteria was developed and is presented in this paper together with the lessons learned in its implementation. This paper also provides a detailed description of the environmental assurance program of the Phoenix Mars mission. This program includes assembly/subsystem and system level testing in the areas of dynamics, thermal, and electromagnetic compatibility, as well as venting/pressure, dust, radiation, and meteoroid analyses to meet the challenging environment of this mission.

  8. Quality Assurance of ARM Program Climate Research Facility Data

    International Nuclear Information System (INIS)

    This report documents key aspects of the Atmospheric Radiation Measurement (ARM) Climate Research Facility (ACRF) data quality assurance program as it existed in 2008. The performance of ACRF instruments, sites, and data systems is measured in terms of the availability, usability, and accessibility of the data to a user. First, the data must be available to users; that is, the data must be collected by instrument systems, processed, and delivered to a central repository in a timely manner. Second, the data must be usable; that is, the data must be inspected and deemed of sufficient quality for scientific research purposes, and data users must be able to readily tell where there are known problems in the data. Finally, the data must be accessible; that is, data users must be able to easily find, obtain, and work with the data from the central repository. The processes described in this report include instrument deployment and calibration; instrument and facility maintenance; data collection and processing infrastructure; data stream inspection and assessment; the roles of value-added data processing and field campaigns in specifying data quality and characterizing the basic measurement; data archival, display, and distribution; data stream reprocessing; and engineering and operations management processes and procedures. Future directions in ACRF data quality assurance also are presented

  9. Quality Assurance of ARM Program Climate Research Facility Data

    Energy Technology Data Exchange (ETDEWEB)

    Peppler, RA; Kehoe, KE; Sonntag, KL; Bahrmann, CP; Richardson, SJ; Christensen, SW; McCord, RA; Doty, DJ; Wagener, Richard [BNL; Eagan, RC; Lijegren, JC; Orr, BW; Sisterson, DL; Halter, TD; Keck, NN; Long, CN; Macduff, MC; Mather, JH; Perez, RC; Voyles, JW; Ivey, MD; Moore, ST; Nitschke, DL; Perkins, BD; Turner, DD

    2008-03-01

    This report documents key aspects of the Atmospheric Radiation Measurement (ARM) Climate Research Facility (ACRF) data quality assurance program as it existed in 2008. The performance of ACRF instruments, sites, and data systems is measured in terms of the availability, usability, and accessibility of the data to a user. First, the data must be available to users; that is, the data must be collected by instrument systems, processed, and delivered to a central repository in a timely manner. Second, the data must be usable; that is, the data must be inspected and deemed of sufficient quality for scientific research purposes, and data users must be able to readily tell where there are known problems in the data. Finally, the data must be accessible; that is, data users must be able to easily find, obtain, and work with the data from the central repository. The processes described in this report include instrument deployment and calibration; instrument and facility maintenance; data collection and processing infrastructure; data stream inspection and assessment; the roles of value-added data processing and field campaigns in specifying data quality and haracterizing the basic measurement; data archival, display, and distribution; data stream reprocessing; and engineering and operations management processes and procedures. Future directions in ACRF data quality assurance also are presented.

  10. Data Quality Assurance Program Plan for NRC Division of Risk Analysis Programs at the INL

    International Nuclear Information System (INIS)

    The Division of Risk Analysis (DRA), Office of Nuclear Regulatory Research (RES), must ensure that the quality of the data that feed into its programs follow Office of Management and Budget (OMB) and U.S. Nuclear Regulatory Commission (NRC) guidelines and possibly other standards and guidelines used in nuclear power plant risk analyses. This report documents the steps taken in DRA's Data Quality Improvement project (Job Control Number N6145) to develop a Data Quality Assurance Program Plan. These steps were: (1) Conduct a review of data quality requirements; (2) Review current data programs, products, and data quality control activities; (3) Review the Institute of Nuclear Power Operation (INPO) Equipment Performance and Information Exchange (EPIX) data quality programs and characterize the EPIX data quality and uncertainty; (4) Compare these programs, products, and activities against the requirements; and (5) Develop a program plan that provides assurance that data quality is being maintained. It is expected that the Data Quality Assurance Program Plan will be routinely implemented in all aspects of future data collection and processing efforts and that specific portions will be executed annually to provide assurance that data quality is being maintained

  11. Data Quality Assurance Program Plan for NRC Division of Risk Analysis Programs at the INL

    Energy Technology Data Exchange (ETDEWEB)

    Sattison, Martin B. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Wierman, Thomas E. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Vedros, Kurt G. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Germain, Shawn W. St. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Eide, Steven A. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Sant, Robert L. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2009-07-01

    The Division of Risk Analysis (DRA), Office of Nuclear Regulatory Research (RES), must ensure that the quality of the data that feed into its programs follow Office of Management and Budget (OMB) and U.S. Nuclear Regulatory Commission (NRC) guidelines and possibly other standards and guidelines used in nuclear power plant risk analyses. This report documents the steps taken in DRA’s Data Quality Improvement project (Job Control Number N6145) to develop a Data Quality Assurance Program Plan. These steps were 1. Conduct a review of data quality requirements 2. Review current data programs, products, and data quality control activities 3. Review the Institute of Nuclear Power Operation (INPO) Equipment Performance and Information Exchange (EPIX) data quality programs and characterize the EPIX data quality and uncertainty 4. Compare these programs, products, and activities against the requirements 5. Develop a program plan that provides assurance that data quality is being maintained. It is expected that the Data Quality Assurance Program Plan will be routinely implemented in all aspects of future data collection and processing efforts and that specific portions will be executed annually to provide assurance that data quality is being maintained.

  12. Results of the quality assurance testing program for radiopharmaceuticals, 1994

    International Nuclear Information System (INIS)

    The Australian Radiation Laboratory conducts a Radiopharmaceutical Quality Assurance Test Program in which radiopharmaceuticals used in nuclear medicine in Australia are tested for compliance with specifications. Where the radiopharmaceutical is the subject of a monograph in the British Pharmacopoeia or the European Pharmacopoeia, then the specifications given in the Pharmacopoeia are adopted. In other cases the specifications quoted have been adopted by this Laboratory and have no legal status. It should be noted that unless stated otherwise, the specifications listed apply at all times up to product expiry. Radionuclidic purity has been determined at the calibration time, except for Thallous [201Tl] Chloride injection where the highest impurity level up to product expiry is quoted. Samples for testing were obtained through commercial channels. All technetium-99m cold kits were reconstituted according to the directions in the package insert using Sodium Pertechnetate[99mTc] Injection. Methods used for testing are described in the report ARL/TR093

  13. LANL Safeguards and Security Assurance Program. Revision 6

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-04-03

    The Safeguards and Security (S and S) Assurance Program provides a continuous quality improvement approach to ensure effective, compliant S and S program implementation throughout the Los Alamos National Laboratory. Any issues identified through the various internal and external assessments are documented, tracked and closed using the Safeguards and Security Issue Management Program. The Laboratory utilizes an integrated S and S systems approach to protect US Department of Energy (DOE) interests from theft or diversion of special nuclear material (SNM), sabotage, espionage, loss or theft of classified/controlled matter or government property, and other hostile acts that may cause unacceptable impacts on national security, health and safety of employees and the public, and the environment. This document explains the basis, scope, and conduct of the S and S process to include: self-assessments, issue management, risk assessment, and root cause analysis. It also provides a discussion of S and S topical areas, roles and responsibilities, process flow charts, minimum requirements, methodology, terms, and forms.

  14. Risk assessment in the DOE Assurance Program for Remedial Action

    International Nuclear Information System (INIS)

    This document provides information obtained during the performance of risk assessment tasks in support of the Assurance Program for Remedial Action (APRA) sponsored by the Office of Operational Safety of the Department of Energy. We have presented a method for the estimation of projected health effects at properties in the vicinity of uranium mill tailing piles due to transported tailings or emissions from the piles. Because radon and radon daughter exposure is identified as the principal factor contributing to health effects at such properties, the basis for estimating lung cancer risk as a result of such exposure is discussed in detail. Modeling of health risk due to a secondary pathway, ingestion of contaminated, home-grown food products, is also discussed since it is a potentially important additional source of exposure in certain geographic locations. Risk assessment methods used in various mill tailings reports are reviewed. The protocols for radiological surveys conducted in DOE-sponsored remedial action programs are critically reviewed with respect to their relevance to the needs of health risk estimation. The relevance of risk assessment to the APRA program is discussed briefly

  15. Risk assessment in the DOE Assurance Program for Remedial Action

    Energy Technology Data Exchange (ETDEWEB)

    Marks, S.; Cross, F.T.; Denham, D.H.; Kennedy, W.E.; Stenner, R.D.

    1985-08-01

    This document provides information obtained during the performance of risk assessment tasks in support of the Assurance Program for Remedial Action (APRA) sponsored by the Office of Operational Safety of the Department of Energy. We have presented a method for the estimation of projected health effects at properties in the vicinity of uranium mill tailing piles due to transported tailings or emissions from the piles. Because radon and radon daughter exposure is identified as the principal factor contributing to health effects at such properties, the basis for estimating lung cancer risk as a result of such exposure is discussed in detail. Modeling of health risk due to a secondary pathway, ingestion of contaminated, home-grown food products, is also discussed since it is a potentially important additional source of exposure in certain geographic locations. Risk assessment methods used in various mill tailings reports are reviewed. The protocols for radiological surveys conducted in DOE-sponsored remedial action programs are critically reviewed with respect to their relevance to the needs of health risk estimation. The relevance of risk assessment to the APRA program is discussed briefly.

  16. LANL Safeguards and Security Assurance Program. Revision 6

    International Nuclear Information System (INIS)

    The Safeguards and Security (S and S) Assurance Program provides a continuous quality improvement approach to ensure effective, compliant S and S program implementation throughout the Los Alamos National Laboratory. Any issues identified through the various internal and external assessments are documented, tracked and closed using the Safeguards and Security Issue Management Program. The Laboratory utilizes an integrated S and S systems approach to protect US Department of Energy (DOE) interests from theft or diversion of special nuclear material (SNM), sabotage, espionage, loss or theft of classified/controlled matter or government property, and other hostile acts that may cause unacceptable impacts on national security, health and safety of employees and the public, and the environment. This document explains the basis, scope, and conduct of the S and S process to include: self-assessments, issue management, risk assessment, and root cause analysis. It also provides a discussion of S and S topical areas, roles and responsibilities, process flow charts, minimum requirements, methodology, terms, and forms

  17. UMTRA technical assistance contractor Quality Assurance Program Plan

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) provides the primary requirements for the integration of quality functions into all Technical Assistance Contractor (TAC) Project organization activities. The QAPP is the written directive authorized by the TAC Program Manager to accomplish this task and to implement procedures that provide the controls and sound management practices needed to ensure TAC contractual obligations are met. The QA program is designed to use monitoring, audit, and surveillance functions as management tools to ensure that all Project organization functions are executed in a manner that will protect public health and safety, promote the success of the Project, and meet or exceed contract requirements. The key to ensuring compliance with this directive is a two-step professional approach: utilize the quality system in all areas of activity, and generate a personal commitment from all personnel to provide quality service. The quality staff will be experienced, trained professionals capable of providing maximum flexibility to Project goal attainment. Such flexibility will enable the staff to be more cost effective and to further improve communication and coordination. To provide control details, this QAPP will be supplemented by approved standard operating procedures that provide requirements for performing the various TAC quality-related activities. These procedures shall describe applicable design input and document control activities and documentation

  18. Quality Assurance Program Plan (QAPP) Waste Encapsulation and Storage Facility (WESF)

    International Nuclear Information System (INIS)

    This Quality Assurance Plan describes how the Waste Encapsulation and Storage Facility (WESF) implements the quality assurance (QA) requirements of the Quality Assurance Program Description (QAPD) (HNF-Mp-599) for Project Hanford activities and products. This QAPP also describes the organizational structure necessary to successfully implement the program. The QAPP provides a road map of applicable Project Hanford Management System Procedures, and facility specific procedures, that may be utilized by WESF to implement the requirements of the QAPD

  19. Quality assurance FY 1995 site support program plan WBS 6.7.2.5

    International Nuclear Information System (INIS)

    This report is a summary of the quality assurance plan and program for the Westinghouse Hanford Company. The quality assurance plan verifies that the appropriate quality assurance programs and controls are applied to activities that affect quality related to work in: waste management; environmental activities (restoration, remediation, and monitoring); implementation of environmental, state, local, and federal regulations; tri-party agreement activities; facility operation and deactivation/transition to shutdown; new facility construction and operation

  20. Extending cluster lot quality assurance sampling designs for surveillance programs.

    Science.gov (United States)

    Hund, Lauren; Pagano, Marcello

    2014-07-20

    Lot quality assurance sampling (LQAS) has a long history of applications in industrial quality control. LQAS is frequently used for rapid surveillance in global health settings, with areas classified as poor or acceptable performance on the basis of the binary classification of an indicator. Historically, LQAS surveys have relied on simple random samples from the population; however, implementing two-stage cluster designs for surveillance sampling is often more cost-effective than simple random sampling. By applying survey sampling results to the binary classification procedure, we develop a simple and flexible nonparametric procedure to incorporate clustering effects into the LQAS sample design to appropriately inflate the sample size, accommodating finite numbers of clusters in the population when relevant. We use this framework to then discuss principled selection of survey design parameters in longitudinal surveillance programs. We apply this framework to design surveys to detect rises in malnutrition prevalence in nutrition surveillance programs in Kenya and South Sudan, accounting for clustering within villages. By combining historical information with data from previous surveys, we design surveys to detect spikes in the childhood malnutrition rate. PMID:24633656

  1. The Role Of Quality Assurance Program For Safety Operation Of Nuclear Installations

    International Nuclear Information System (INIS)

    Nuclear installations expose potential hazard of radiation, therefore in their construction, operation and maintenance, it is necessary to consider safety aspect, in which the safety requirements which has been determined must be met. One of the requirements that is absolutely needed is quality assurance, which covers arrangement of quality assurance program, organization and administration of the implementation of quality assurance, and supervision. Quality Assurance program is a guideline containing quality policies and basic determination on the realization of activities that effect the quality of equipment's and items used in the operation of nuclear installations in order that the operation of nuclear installation can run safety and in accordance with their design aims and operation limits. Quality Assurance Program includes document control, design control, supply control, control of equipment s and items, operation/process control, inspection and control of equipment test, and control of nonconformance and corrections. General system of nuclear installation operation is equipped with safety and supporting systems. These systems must apply the quality assurance program that cover control of activities in the systems. In the implementation of the quality assurance program, it is necessary to establish procedures, work guidelines/instructions, and quality recording that constitutes documents of quality system 2nd, 3th, and 4th level after the quality assurance program. To ensure the effectivity and to prove whether the realization of the program has been pursuant to the determined requirements, an internal audit must be conducted accordingly

  2. Qualification of quality assurance program audit personnel for nuclear power plants - August 1980

    International Nuclear Information System (INIS)

    Appendix B, Quality Assurance Criteria for Nuclear Power Plants and Fuel Reprocessing Plants, to 10 CFR Part 50, Domestic Licensing of Production and Utilization Facilities, establishes overall quality assurance requirements for the design, construction, and operation of safety-related structures, and components of nuclear power plants. Criterion XVIII, Audits, of Appendix B establishes requirements for conducting audits of the quality assurance program. This guide describes a method acceptable to the NRC staff for complying with the Commission's regulations with regard to qualification of quality assurance program audit personnel for nuclear power plants

  3. Toward development of a comprehensive external quality assurance program for polyfunctional intracellular cytokine staining assays

    OpenAIRE

    Staats, Janet S.; Enzor, Jennifer H.; Sanchez, Ana M.; Rountree, Wes; Chan, Cliburn; Jaimes, Maria; Chan, Ray Chun-Fai; Gaur, Amitabh; Thomas N Denny; Weinhold, Kent J.

    2014-01-01

    The External Quality Assurance Program Oversight Laboratory (EQAPOL) Flow Cytometry Program assesses the proficiency of NIH/NIAID/DAIDS-supported and potentially other interested research laboratories in performing Intracellular Cytokine Staining (ICS) assays. The goal of the EQAPOL Flow Cytometry External Quality Assurance Program (EQAP) is to provide proficiency testing and remediation for participating sites. The program is not punitive; rather, EQAPOL aims to help sites identify areas for...

  4. Results of the quality assurance testing program for radiopharmaceuticals, 1994

    Energy Technology Data Exchange (ETDEWEB)

    Baldas, J.; Bonnyman, J.; Ivanov, Z.; Lauder, R

    1995-08-01

    The Australian Radiation Laboratory conducts a Radiopharmaceutical Quality Assurance Test Program in which radiopharmaceuticals used in nuclear medicine in Australia are tested for compliance with specifications. Where the radiopharmaceutical is the subject of a monograph in the British Pharmacopoeia or the European Pharmacopoeia, then the specifications given in the Pharmacopoeia are adopted. In other cases the specifications quoted have been adopted by this Laboratory and have no legal status. It should be noted that unless stated otherwise, the specifications listed apply at all times up to product expiry. Radionuclidic purity has been determined at the calibration time, except for Thallous [{sup 201}Tl] Chloride injection where the highest impurity level up to product expiry is quoted. Samples for testing were obtained through commercial channels. All technetium-99m cold kits were reconstituted according to the directions in the package insert using Sodium Pertechnetate[{sup 99m}Tc] Injection. Methods used for testing are described in the report ARL/TR093 24 tabs.

  5. Relevant aspects of a quality assurance program applied to a nuclear power plant operation

    International Nuclear Information System (INIS)

    The purpose of this work was to enumerate the most relevant subjects to be taken into account for the elaboration of a Quality Assurance Program aimed to regulate a nuclear power plant operation. At first, it was necessary to point out the relevance that implies the presence of a group of personnel, experienced in quality assurance with enough knowledge on the technical and organizing aspects of the plant. Other aspect to be taken into account was the contemplation of the international requirements, through the International Atomic Energy Agency and of the national requirements that each country had set up by the corresponding regulating agencies. These organizations pointed out the minimum rules that must be followed for the adequate and efficient execution of a program. The Quality Assurance Manual and the program and work procedures constituted the Quality Assurance Program which must be checked as regards its fulfillment by auditors and quality assurance supervisions. (Author)

  6. A TLD therapy dosimetry quality assurance program for Australia

    International Nuclear Information System (INIS)

    characteristics of the TLD powder; Contamination of the light emitted by non-radiation induced signals; The absorption of light in the TLD powder; False readings due to dust or other particles which glow when heated, and; The exposure of TLD to ultraviolet light. A pilot study is being undertaken in selected Australian radiotherapy centres. IAEA standard capsules and jigs are being used. Each of these centres will be sent several capsules filled with LiF powder. Two or three will be exposed to 2 Gy in a water phantom, with either a TPR20/10 or D20/10 beam specification. An unexposed capsule will measure environmental effects on the TLD powder during transport and storage. The centres will be given a 2 week window in which to expose the capsules. They will be asked to nominate the date of exposure so that a normalisation capsule, exposed at ARPANSA on the same day, can be used to correct the results. The pilot study will help to correct problems encountered with the TLD method before the TLD Quality Assurance Program begins for all radiotherapy centres in Australia. There are approximately 33 radiotherapy centres in the country, and all will be expected to participate. Initially ARPANSA's TLD QA Program will involve one photon beam per centre. Future work at ARPANSA will include the development of procedures so that 1-3 photon beams and 1-2 electron beams will be offered. The assistance of the IAEA is gratefully acknowledged in providing a quality assurance program for some Australian hospitals through the World Health Organisation (WHO) and in recent years for directly organising two Australia-wide TLD QA programs. (author)

  7. A DOCTORAL PROGRAM WITH SPECIALIZATION IN INFORMATION SECURITY A High Assurance Constructive Security Approach

    OpenAIRE

    Irvine, Cynthia E.; Levin, Timothy E.

    2003-01-01

    A doctoral program in computer science with a specialization in information security is described. The focus of the program is constructive security. Key elements of the program are the strong computer science core upon which it builds, coursework on the theory and principles of information assurance, and a unifying research project. The doctoral candidate is a member of the project team, whose research contributes to the goals of the project and to fundamental advancements in high assurance ...

  8. 14 CFR 13.401 - Flight Operational Quality Assurance Program: Prohibition against use of data for enforcement...

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Flight Operational Quality Assurance... ENFORCEMENT PROCEDURES Flight Operational Quality Assurance Programs § 13.401 Flight Operational Quality... Operational Quality Assurance (FOQA) program means an FAA-approved program for the routine collection...

  9. Development of a quality assurance program for ionizing radiation secondary calibration laboratories

    International Nuclear Information System (INIS)

    For calibration laboratories, routine calibrations of instruments meeting stated accuracy goals are important. One method of achieving the accuracy goals is to establish and follow a quality assurance program designed to monitor all aspects of the calibration program and to provide the appropriate feedback mechanism if adjustments are needed. In the United States there are a number of organizations with laboratory accreditation programs. All existing accreditation programs require that the laboratory implement a quality assurance program with essentially the same elements in all of these programs. Collectively, these elements have been designated as a Measurement Quality Assurance (MQA) program. This paper will briefly discuss the interrelationship of the elements of an MQA program. Using the Center for Devices and Radiological Health (CDRH) X-ray Calibration Laboratory (XCL) as an example, it will focus on setting up a quality control program for the equipment in a Secondary Calibration Laboratory

  10. Development of a quality assurance program for ionizing radiation secondary calibration laboratories

    Energy Technology Data Exchange (ETDEWEB)

    Heaton, H.T. II; Taylor, A.R. Jr. [Center for Devices and Radiological Health, Rockville, MD (United States)

    1993-12-31

    For calibration laboratories, routine calibrations of instruments meeting stated accuracy goals are important. One method of achieving the accuracy goals is to establish and follow a quality assurance program designed to monitor all aspects of the calibration program and to provide the appropriate feedback mechanism if adjustments are needed. In the United States there are a number of organizations with laboratory accreditation programs. All existing accreditation programs require that the laboratory implement a quality assurance program with essentially the same elements in all of these programs. Collectively, these elements have been designated as a Measurement Quality Assurance (MQA) program. This paper will briefly discuss the interrelationship of the elements of an MQA program. Using the Center for Devices and Radiological Health (CDRH) X-ray Calibration Laboratory (XCL) as an example, it will focus on setting up a quality control program for the equipment in a Secondary Calibration Laboratory.

  11. Quality assurance requirements and description for the Civilian Radioactive Waste Management Program

    International Nuclear Information System (INIS)

    The Quality Assurance Requirements and Description (QARD) is the principal quality assurance document for the Civilian Radioactive Waste Management Program (Program). It establishes the minimum requirements for the Quality Assurance Program. The QARD contains regulatory requirements and program commitments necessary for the development of an effective quality assurance program. Quality assurance implementing documents must be based on, and consistent with, QARD requirements. The QARD applies to the following: (1) acceptance of spent nuclear fuel and high-level radioactive waste; (2) transport of spent nuclear fuel and high-level radioactive waste; (3) the Monitored Retrievable Storage (MRS) facility through application for an operating license; (4) Mined Geologic Disposal System (MGDS), including the site characterization activities (exploratory studies facility (ESF) and surface based testing), through application for an operating license; (5) the high-level-waste form from production through acceptance. Section 2.0 defines in greater detail criteria for determining work subject to QARD requirements. The QARD is organized into sections, supplements, appendices, and a glossary. The sections contain requirements that are common to all Program elements. The supplements contain requirements for specialized activities. The appendices contain requirements that are specific to an individual Program element. The glossary establishes a common vocabulary for the Quality Assurance Program

  12. Implementation of quality assurance program for operational safety of P2TBDU installation

    International Nuclear Information System (INIS)

    According to Decree of Head of BAPETEN No : 07/Ka-BAPETEN/V-99 which determines the duties to perform the quality assurance function for each nuclear installation, the Head of P2TBDU has decided to perform and maintain the quality assurance program controlling each activity which may influence the safety. The P2TBDU Quality Assurance Program has been arranged and put into force since 1993, however the implementation of the program has not been effective as expected. The change of organization structure shall cause the changes of organisation's function and main duty, therefore it requires that the change/revision be made to accommodate the new policy on the quality assurance program. The Quality Assurance Program revision 1 has been arranged and put into force since Nov. 19, 1999 which incorporated the change of the organizational structure. The effectiveness of implementation of the program shall extremely be determined y commitment of the P2TBDU management as well as awareness of each personal of the organization on the necessity of Quality Assurance Program for operational safety of the installation. (author)

  13. Quality Assurance Program Plan for the Waste Isolation Pilot Plant Experimental-Waste Characterization Program

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) identifies the quality of data necessary to meet the specific objectives associated with the Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Experimental-Waste Characterization Program (the Program). This experimental-waste characterization program is only one part of the WIPP Test Phase, both in the short- and long-term, to quantify and evaluate the characteristics and behavior of transuranic (TRU) wastes in the repository environment. Other parts include the bin-scale and alcove tests, drum-scale tests, and laboratory experiments. In simplified terms, the purpose of the Program is to provide chemical, physical, and radiochemical data describing the characteristics of the wastes that will be emplaced in the WIPP, while the remaining WIPP Test Phase is directed at examining the behavior of these wastes in the repository environment. 50 refs., 35 figs., 33 tabs

  14. The development of quality assurance program in Reactor TRIGA PUSPATI (RTP)

    International Nuclear Information System (INIS)

    One of the trivial issues in the operation of Nuclear Reactor is the safety of the system. Worldwide publicity on a few nuclear accidents as well as the notorious Hiroshima and Nagasaki bombing has always bring about general public fear on anything related to nuclear. IAEA has always emphasized on the assurance of nuclear safety for all nuclear installations and activities. According to the IAEA safety guides, all research reactors are required to implement quality assurance programs to ensure the conduct of operations are in accordance with the safety standards required. This paper discusses the activities carried out toward the establishment of Quality Assurance Program for Reaktor TRIGA PUSPATI (RTP). (Author)

  15. The Fort St. Vrain HTGR quality assurance program

    International Nuclear Information System (INIS)

    A description is given of the Quality Assurance organization at the Fort St. Vrain nuclear power station. QA's responsibilities include auditing and monitoring activities, quality control inspection, non-destructive examination, records control, vendor activities, equipment and metallurgical evaluation, weld control, convective action follow up, status keeping of commitments and coordination with the NRC. (U.K.)

  16. Standard guide for establishing a quality assurance program for uranium conversion facilities

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2004-01-01

    1.1 This guide provides guidance and recommended practices for establishing a comprehensive quality assurance program for uranium conversion facilities. 1.2 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate health and safety practices and determine the applicability of regulatory limitations prior to use. 1.3 The basic elements of a quality assurance program appear in the following order: FUNCTION SECTION Organization 5 Quality Assurance Program 6 Design Control 7 Instructions, Procedures & Drawings 8 Document Control 9 Procurement 10 Identification and Traceability 11 Processes 12 Inspection 13 Control of Measuring and Test Equipment 14 Handling, Storage and Shipping 15 Inspection, Test and Operating Status 16 Control of Nonconforming Items 17 Corrective Actions 18 Quality Assurance Records 19 Audits 20 TABLE 1 NQA-1 Basic Requirements Relat...

  17. Quality assurance program plan for the Radiological Survey Activities Program - Uranium Mill Tailings Remedial Action Project

    International Nuclear Information System (INIS)

    The Radiological Survey Activities (RASA) program at Oak Ridge National Laboratory (ORNL) is responsible for surveying designated sites in the vicinity of 24 inactive mill sites involved in the Department of Energy's (DOE) Uranium Mill Tailings Remedial Action Project (UMTRAP). The purpose of these surveys is to provide a recommendation to DOE whether to include or exclude the site from UMTRAP based on whether the onsite residual radioactive material (if any) originated from the former mill sites, and radiation levels onsite are in excess of appropriate Environmental Protection Agency (EPA) criteria. This report describes the quality assurance program plan for the RASA program in conducting all activities related to the UMTRA project. All quality assurance provisions given by the DOE, DOE/UMTRA, and ORNL organizations are integrated into this plan. Specifically, this report identifies the policies and procedures followed in accomplishing the RASA/UMTRAP QA program, identifies those organizational units involved in the implementation of these procedures, and outlines the respective responsibilities of those groups

  18. Quality assurance program plan for the Site Physical and Electrical Calibration Services Lab. Revision 1

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) is organized to address WHC's implementation of quality assurance requirements as they are presented as interpretive guidance endorsed by the Department of Energy (DOE) Field Office, Richland DOE Order 5700.6C Quality Assurance. The quality assurance requirements presented in this plan will assure Measuring and Test Equipment (M and TE) are in conformance with prescribed technical requirements and that data provided by testing, inspection, or maintenance are valid. This QAPP covers all activities and work elements that are variously called QA, quality control, and quality engineering regardless of the organization performing the work. This QAPP identifies the QA requirements for planning, control, and documentation of operations, modifications, and maintenance of the WHC Site Physical and Electrical Calibration Services Laboratory. The primary function of the WHC Site Physical and Electrical Calibration Services Laboratory is providing calibration, standardization, or repair service of M and TE

  19. Quality Assurance Program Plan for the Waste Isolation Pilot Plant Experimental-Waste Characterization Program

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) identifies the quality of data necessary to meet the specific objectives associated with the Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Experimental-Waste Characterization Program (the Program). DOE plans to conduct experiments in the WIPP during a Test Phase of approximately 5 years. These experiments will be conducted to reduce the uncertainties associated with the prediction of several processes (e.g., gas generation) that may influence repository performance. The results of the experiments will be used to assess the ability of the WIPP to meet regulatory requirements for the long-term protection of human health and the environment from the disposal of TRU wastes. 37 refs., 25 figs., 18 tabs

  20. Multi-Function Waste Tank Facility Quality Assurance Program Plan, Project W-236A. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Hall, L.R.

    1995-05-30

    This document describes the Quality Assurance (QA) program for the Multi-Function Waste Tank Facility (MWTF) Project. The purpose of this QA program is to control project activities in such a manner as to achieve the mission of the MWTF Project in a safe and reliable manner. The QA program for the MWTF Project is founded on DOE Order 5700.6C, Quality Assurance, and implemented through the use of ASME NQA-1, Quality Assurance Program Requirements for Nuclear Facilities (ASME 1989 with addenda la-1989, lb-1991 and lc-1992). This document describes the program and planned actions which the Westinghouse Hanford Company (WHC) will implement to demonstrate and ensure that the project meets the requirements of DOE Order 5700.6C through the interpretive guidance of ASME NQA-1.

  1. Multi-Function Waste Tank Facility Quality Assurance Program Plan, Project W-236A. Revision 2

    International Nuclear Information System (INIS)

    This document describes the Quality Assurance (QA) program for the Multi-Function Waste Tank Facility (MWTF) Project. The purpose of this QA program is to control project activities in such a manner as to achieve the mission of the MWTF Project in a safe and reliable manner. The QA program for the MWTF Project is founded on DOE Order 5700.6C, Quality Assurance, and implemented through the use of ASME NQA-1, Quality Assurance Program Requirements for Nuclear Facilities (ASME 1989 with addenda la-1989, lb-1991 and lc-1992). This document describes the program and planned actions which the Westinghouse Hanford Company (WHC) will implement to demonstrate and ensure that the project meets the requirements of DOE Order 5700.6C through the interpretive guidance of ASME NQA-1

  2. Auditing of quality assurance programs for nuclear power plants - September 1980 - (Rev.1)

    International Nuclear Information System (INIS)

    Appendix B, Quality Assurance Criteria for Nuclear Power Plants and Fuel Reprocessing Plants, to 10 CFR Part 50, Domestic Licensing of Production and Utilization Facilities, establishes overall quality assurance requirements for the design, construction, and operation of structures, systems, and components of nuclear power plants important to safety. Criterion XVIII, Audits, of Appendix B to 10 CFR Part 50 establishes requirements for conducting audits of the quality assurance program. This guide describes a method acceptable to the NRC staff for complying with the Commission's regulations with regard to auditing of quality assurance programs for nuclear power plants. The Advisory Committee on Reactor Safeguards has been consulted concerning this guide and has concurred in the regulatory position

  3. Study of the Nuclear Regulatory Commission quality assurance program

    International Nuclear Information System (INIS)

    Recommendations from a three month study are presented for quality assurance in nuclear power plants as it is practiced in industry and regulated by the NRC. Requested by the NRC, the study was accomplished through on-site visits by Sandia personnel at NRC offices and industry locations and through discussion with relevant technical society groups and interested individuals. The study group recommended changes to improve QA regulation by the NRC, to improve industry application of 10CFR50, Appendix B criteria, and to extend and expand the scope of QA activities by both industry and NRC

  4. Quality assurance program plan for 324 Building B-Cell safety cleanout project (BCCP)

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) provides information on how the Quality Assurance Program is implemented for the 324 Building B-Cell Safety Cleanout Project (BCCP). This QAPP is responsive to the Westinghouse Hanford Company Quality Assurance Program and Implementation Plan, WHC-SP-1131, for 10 CFR 830.120, Nuclear Safety Management, Quality Assurance Requirements; and DOE Order 5700.6C, Quality Assurance. This QAPP supersedes PNNL PNL-MA-70 QAP Quality Assurance Plan No. WTC-050 Rev. 2, issue date May 3, 1996. This QAPP has been developed specifically for the BCCP. It applies to those items and tasks which affect the completion of activities identified in the work breakdown structure of the Project Management Plan (PMP). These activities include all aspects of decontaminating B-Cell and project related operations within the 324 Building as it relates to the specific activities of this project. General facility activities (i.e. 324 Building Operations) are covered in the Building 324 QAPP. In addition, this QAPP supports the related quality assurance activities addressed in CM-2-14, Hazardous Material Packaging and Shipping, and HSRCM-1, Hanford Site Radiological Control Manual, The 324 Building is currently transitioning from being a Pacific Northwest National Laboratory (PNNL) managed facility to a B and W Hanford Company (BWHC) managed facility. During this transition process existing, PNNL procedures and documents will be utilized until replaced by BWHC procedures and documents. These documents conform to the requirements found in PNL-MA-70, Quality Assurance Manual and PNL-MA-8 1, Hazardous Materials Shipping Manual. The Quality Assurance Program Index (QAPI) contained in Table 1 provides a matrix which shows how project activities relate to 10 CFR 83 0.120 and 5700.6C criteria. Quality Assurance program requirements will be addressed separate from the requirements specified in this document. Other Hanford Site organizations/companies may be

  5. Traceability of metrologic references of dose absorbed to water used in a Dosimetry Quality Assurance Program

    International Nuclear Information System (INIS)

    Objective: to present the solidly established traceability structure for ionometric standards and for thermoluminescent dosimetry system that ensures reliability of the Dosimetry Quality Assurance Program and is aimed to certify the highest level of accuracy of the measurements. Materials and methods: thermoluminescent powder dosimeters (DTL 937) placed into plastic capsules and packed in specific kits for each intended application were mailed to the participant centers. Results: the results of the intercomparisons performed between 'Laboratorio de Ciencias Radiologicas da Universidade do Estado do Rio de Janeiro' and EQUAL-ESTRO for the beam of 60Co gamma rays, expressed for (1σ), and the results of the dose absorbed measurements obtained with the chambers of the Program EQUAL and the chambers of the Dosimetry Quality Assurance Program were lower than 0.5%. Conclusion: based on these results we concluded that the Dosimetry Quality Assurance Program reached the desired level of reliability to allow its implementation. (author)

  6. Quality assurance program requirements for Space and Terrestrial Nuclear Power Systems

    Energy Technology Data Exchange (ETDEWEB)

    1982-10-01

    This publication gives the general requirements for planning, managing, and evaluating quality assurance (QA) programs for Space and Terrestrial Nuclear Power Systems. These requirements are based on proven practices and provide direction to project management to aid in safe, reliable, and economical operation. The program's objective is to assure that systems, components, piece parts and materials (including those used for facilities and testing) are designed, developed, fabricated, installed, operated, and maintained in compliance with established engineering criteria. It is the intent of the Department of Energy (DOE) that QA standards be applied to hardware design and development programs from their inception to their completion.

  7. SWRL Communication Skills Programs: Quality Assurance Information for the 1973-74 Academic Year.

    Science.gov (United States)

    Hanson, Ralph A.; And Others

    This document reports on the quality assurance aspects of the tryout of three SWRL (Southwest Regional Laboratory) Communication Skills Programs: Reading, Composition, and Expressive Language. The sample population was both large and diverse, and a pattern of high proficiency was achieved both within program blocks or levels and across program…

  8. REVIEW OF U.S. ENVIRONMENTAL PROTECTION AGENCY NO2 MONITORING QUALITY ASSURANCE PROGRAM

    Science.gov (United States)

    A review of EPA's Quality Assurance Program for monitoring NO2 in ambient air is presented. Included are a discussion of the nationwide audit program, special audits of continuous monitors, the preparation of NO2 audit samples, and a general interpretation of the results of these...

  9. Hanford Waste Vitrification Plant Quality Assurance Program description: Overview and applications

    International Nuclear Information System (INIS)

    This document (Parts 1 and 2) describes the requirements that must be implemented during the design and construction phases for the Hanford Waste Vitrification Plant Project Quality Assurance Program. This program is being implemented to ensure the acceptability of high-level radioactive canistered waste forms produced by the Hanford Waste Vitrification Plant for disposal in a licensed federal repository

  10. Results of the quality assurance testing program for radiopharmaceuticals 1995

    Energy Technology Data Exchange (ETDEWEB)

    Baldas, J.; Binnyman, J.; Ivanov, Z.; Lauder, R.

    1996-07-01

    The results of the quality assurance testing conducted by the Australian Radiation Laboratory is summarised. Overall 111 batches of 27 different types of radiopharmaceuticals were tested on samples obtained through normal commercial channels. Failure to meet full specifications was observed in 10 of the 111 batches. All technetium-99m cold kits were reconstituted according to the directions in the package insert using sodium pertechnetate ( {sup 99m}Tc) injection. Radionuclidic purity has been determined at the calibration time, except for Thallous [{sup 201}Tl] Chloride injection where the highest impurity level up to product expiry is quoted. Non-compliance of the vial label was observed in one of the ten batches failing specification and was the sole cause of product failure for this batch. Vial label non-compliance consisted of, absence of volume in the vial. Six batches failed the biodistribution test but in no case did this involve failure of the distribution for the target organs. tabs.

  11. Results of the quality assurance testing program for radiopharmaceuticals 1995

    International Nuclear Information System (INIS)

    The results of the quality assurance testing conducted by the Australian Radiation Laboratory is summarised. Overall 111 batches of 27 different types of radiopharmaceuticals were tested on samples obtained through normal commercial channels. Failure to meet full specifications was observed in 10 of the 111 batches. All technetium-99m cold kits were reconstituted according to the directions in the package insert using sodium pertechnetate ( 99mTc) injection. Radionuclidic purity has been determined at the calibration time, except for Thallous [201Tl] Chloride injection where the highest impurity level up to product expiry is quoted. Non-compliance of the vial label was observed in one of the ten batches failing specification and was the sole cause of product failure for this batch. Vial label non-compliance consisted of, absence of volume in the vial. Six batches failed the biodistribution test but in no case did this involve failure of the distribution for the target organs. tabs

  12. Quality Assurance Program Plan for the Waste Sampling and Characterization Facility

    International Nuclear Information System (INIS)

    The objective of this Quality Assurance Plan is to provide quality assurance (QA) guidance, implementation of regulatory QA requirements, and quality control (QC) specifications for analytical service. This document follows the Department of Energy (DOE)-issued Hanford Analytical Services Quality Assurance Plan (HASQAP) and additional federal [10 US Code of Federal Regulations (CFR) 830.120] QA requirements that HASQAP does not cover. This document describes how the laboratory implements QA requirements to meet the federal or state requirements, provides what are the default QC specifications, and/or identifies the procedural information that governs how the laboratory operates. In addition, this document meets the objectives of the Quality Assurance Program provided in the WHC-CM-4-2, Section 2.1. This document also covers QA elements that are required in the Guidelines and Specifications for Preparing Quality Assurance Program Plans (QAPPs), (QAMS-004), and Interim Guidelines and Specifications for Preparing Quality Assurance Product Plans (QAMS-005) from the Environmental Protection Agency (EPA). A QA Index is provided in the Appendix A

  13. Quality Assurance Program Plan for the Waste Sampling and Characterization Facility

    Energy Technology Data Exchange (ETDEWEB)

    Grabbe, R.R.

    1995-03-02

    The objective of this Quality Assurance Plan is to provide quality assurance (QA) guidance, implementation of regulatory QA requirements, and quality control (QC) specifications for analytical service. This document follows the Department of Energy (DOE)-issued Hanford Analytical Services Quality Assurance Plan (HASQAP) and additional federal [10 US Code of Federal Regulations (CFR) 830.120] QA requirements that HASQAP does not cover. This document describes how the laboratory implements QA requirements to meet the federal or state requirements, provides what are the default QC specifications, and/or identifies the procedural information that governs how the laboratory operates. In addition, this document meets the objectives of the Quality Assurance Program provided in the WHC-CM-4-2, Section 2.1. This document also covers QA elements that are required in the Guidelines and Specifications for Preparing Quality Assurance Program Plans (QAPPs), (QAMS-004), and Interim Guidelines and Specifications for Preparing Quality Assurance Product Plans (QAMS-005) from the Environmental Protection Agency (EPA). A QA Index is provided in the Appendix A.

  14. Summary report on the Solar Consumer Assurance Network (SOLCAN) Program Planning Task in the southern region

    Energy Technology Data Exchange (ETDEWEB)

    Browne, M. B. [comp.

    1981-03-15

    The goal of the SOLCAN Program Planning Task is to assist in the development, at the state and local levels, of consumer assurance approaches that will support the accelerated adoption and effective use of new products promoted by government incentives to consumers to meet our nation's energy needs. The task includes state-conducted evaluations and state SOLCAN meetings to identify consumer assurance mechanisms, assess their effectiveness, and identify and describe alternative means for strengthening consumer and industry assurance in each state. Results of the SOLCAN process are presented, including: a Solar Consumer Protection State Assessment Guide; State Solar Consumer Assurance Resources for Selected States; State Solar Consumer Protection Assessment Interviews for Florida; and state SOLCAN meeting summaries and participants. (LEW)

  15. Implementing the AECL decommissioning quality assurance program at the Chalk River and Whiteshell Laboratories

    International Nuclear Information System (INIS)

    This paper describes the approach and progress in developing, implementing and maintaining a quality assurance (QA) program for decommissioning at the nuclear facilities managed by Atomic Energy of Canada Limited (AECL). Decommissioning activities conducted by AECL are varied in nature, so the QA program must provide adequate flexibility, while maintaining consistency with accepted quality standards. Well-written documentation adhering to the applicable decommissioning standards is a key factor. Manager commitment and input during the writing of the documentation are also important to ensure relevance of the QA program and effectiveness of implementation. Training in the use of the quality assurance plan and procedures is vital to the understanding of the QA program. Beyond the training aspect there is a need for the quality assurance program to be supported by a QA subject expert who is able to advise the group in implementing the Quality Program with consistency over the range of decommissioning work activities and to provide continual assessment of the quality assurance program for efficiency and effectiveness, with a concomitant continuous improvement process. (author)

  16. Chemical Reactivity Testing for the National Spent Nuclear Fuel Program. Quality Assurance Project Plan

    Energy Technology Data Exchange (ETDEWEB)

    Newsom, H.C.

    1999-01-24

    This quality assurance project plan (QAPjP) summarizes requirements used by Lockheed Martin Energy Systems, Incorporated (LMES) Development Division at Y-12 for conducting chemical reactivity testing of Department of Energy (DOE) owned spent nuclear fuel, sponsored by the National Spent Nuclear Fuel Program (NSNFP). The requirements are based on the NSNFP Statement of Work PRO-007 (Statement of Work for Laboratory Determination of Uranium Hydride Oxidation Reaction Kinetics.) This QAPjP will utilize the quality assurance program at Y-12, QA-101PD, revision 1, and existing implementing procedures for the most part in meeting the NSNFP Statement of Work PRO-007 requirements, exceptions will be noted.

  17. Chemical Reactivity Testing for the National Spent Nuclear Fuel Program. Quality Assurance Project Plan

    International Nuclear Information System (INIS)

    This quality assurance project plan (QAPjP) summarizes requirements used by Lockheed Martin Energy Systems, Incorporated (LMES) Development Division at Y-12 for conducting chemical reactivity testing of Department of Energy (DOE) owned spent nuclear fuel, sponsored by the National Spent Nuclear Fuel Program (NSNFP). The requirements are based on the NSNFP Statement of Work PRO-007 (Statement of Work for Laboratory Determination of Uranium Hydride Oxidation Reaction Kinetics.) This QAPjP will utilize the quality assurance program at Y-12, QA-101PD, revision 1, and existing implementing procedures for the most part in meeting the NSNFP Statement of Work PRO-007 requirements, exceptions will be noted

  18. A new postal quality assurance program for diagnostic radiology departments

    International Nuclear Information System (INIS)

    The Federal Government of Canada has responsibility for the design and performance of new x-ray equipment, but the Provinces have responsibility for controlling the installation, maintenance and use of the equipment. For the past 30 years Saskatchewan has had regular inspection of X-ray units by radiation health officers who have ensured that deficiencies are corrected. With the present emphasis on quality assurance procedures and hospital accreditation requirements some additional needs have had to be met. These are primarily due to unusual geographical factors. The province covers a quarter to a million square miles and has a continental climate with very severe winters. This used to impede winter travel and many small communities therefore established their own hospital. Today there are a large number of very small hospitals (four beds and upwards) which are geographically widely spread and which, with current resources, can only be visited rather infrequently. A mail out test package, primarily designed to give early warning of the existence of radiation related problems, has therefore been introduced. If a test gives an unexpected result, a prompt visit can be made to the centre concerned to carry out whatever more sophisticated test procedures may be necessary. Experience has shown however that the postal test package has, in itself, a high diagnostic potential so the source of the problem can often be identified without a visit becoming necessary

  19. Quality assurance package for routine thermoluminescence dosimetry program

    International Nuclear Information System (INIS)

    The Quality Assurance Package presented here specifies a set of reader-related hardware diagnostics and calibration procedures and automatically maintains audit trails of generated and derived thermoluminescence data. It specifies acceptable performance criteria for the reader and dosimeter assemblies; tracks and controls Readout Cycle Temperature Profiles; and ensures that the acquired data is verified. The quality of the generated glow curves is tracked by the real-time application of Computerized Glow Curve Deconvolution to reference dosimeters that may be mixed with field dosimeters during readout sessions. This package is supported by a menu-driven software system using vertical auto-selection menus, lotus-style horizontal menus, data entry menus with automatic error checking, and pop-up windows. The menu system is supported by an extensive HELP file; data EDITING is password-protected, and a journal is maintained for each editing session as part of the audit trail. Files for the Raw Data and Derived Dose results are maintained and managed in seven databases. The paper provides an in-depth analysis of each of the procedures, specifies data validation criteria, and presents samples of the reports generated

  20. Regulatory activities in gaining assurance of training program effectiveness in Canada

    International Nuclear Information System (INIS)

    This presentation shows the regulator's point of view on evaluating a training program effectiveness. The mission of the Training Program Evaluation Section of the Canadian Atomic Energy Control Board is to obtain and document assurance that the training of NPP operators is effective in providing them with the knowledge and skills needed to become and remain competent. Proposals are made to be considered when drafting the IAEA guideline on evaluation of training program effectiveness

  1. John F. Kennedy Space Center, Safety, Reliability, Maintainability and Quality Assurance, Survey and Audit Program

    Science.gov (United States)

    1994-01-01

    This document is the product of the KSC Survey and Audit Working Group composed of civil service and contractor Safety, Reliability, and Quality Assurance (SR&QA) personnel. The program described herein provides standardized terminology, uniformity of survey and audit operations, and emphasizes process assessments rather than a program based solely on compliance. The program establishes minimum training requirements, adopts an auditor certification methodology, and includes survey and audit metrics for the audited organizations as well as the auditing organization.

  2. Planning and programing a quality assurance system in the National Institute of Nuclear Research

    International Nuclear Information System (INIS)

    The quality assurance systems implanted in the National Institute of Nuclear Research toward the latest of 70's, was derived in two main emptying the first one is dedicated to verify the system implantation in several studies, projects, services and areas of the Institute through the application of inspection, vigilance and auditories. The second one is referred the present paper which is the representative to watch the document completion of the diverse distinguished requisites in the codes, by-laws, standards, specifications and other applicable standing documents as national as internationals. In the NINR is started the Quality Assurance Systems implantation, through of its 'Quality Assurance Plan' which to determine the Quality Institutional policies and the general nature requisites which must be executed in every study, project or area subjected to the Institutional Quality Assurance Systems. From this plan are derived the 'Quality Assurance Programs', in which are indicated the specific requisites in according to the activity type to development. Later is started the documentation preparation which is previous to activities developing which is verified by Quality Assurance with the object to check between other aspects, its foundation and convenience with respect to the applicable standing standards; just as the competence, brightness, legibility, homogeneity and formality of each document. (Author)

  3. System for the quality assurance of personnel training programs

    International Nuclear Information System (INIS)

    In this work are described the fundamental possibilities and characteristics of a software that allows to carry out the management and automatic evaluation of all data gotten during jobs analysis and design, development, implementation and evaluation of personnel training programs of nuclear and radioactive installations and risk industries. The system that is introduced, GESAT, proportion a tool of centralized managerial control of training data and the obtaining of the quality objectives of each installation in the training of their personnel. GESAT includes all phases of SAT method (Systematic Approach to Training). It constitutes the necessary practical support for the elaboration, implementation and evaluation of training programs, allowing the establishment of restrictions and controls and avoiding inconsistencies in the process. It offers the possibility of automatic evaluation that identify fundamental deficiencies in the planning and implementation of training programs. This evaluation facilitates the systematic feed back and the continuous improvement of the training programs.(author)

  4. Quality Assurance Plan for Transportation Management Division Transportation Training Programs

    International Nuclear Information System (INIS)

    The U.S. Department of Transportation (DOT) implemented new rules requiring minimum levels of training for certain key individuals who handle, package, transport, or otherwise prepare hazardous materials for transportation. In response to these rules, the U.S. Department of Energy (DOE), Transportation Management Division (TMD), has developed a transportation safety training program. This program supplies designed instructional methodology and course materials to provide basic levels of DOT training to personnel for whom training has become mandatory. In addition, this program provides advanced hazardous waste and radioactive material packaging and transportation training to help personnel achieve proficiency and/or certification as hazardous waste and radioactive material shippers. This training program does not include site-specific or task-specific training beyond DOT requirements

  5. Standard guide for establishing a quality assurance program for analytical chemistry laboratories within the nuclear industry

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2006-01-01

    1.1 This guide covers the establishment of a quality assurance (QA) program for analytical chemistry laboratories within the nuclear industry. Reference to key elements of ANSI/ISO/ASQC Q9001, Quality Systems, provides guidance to the functional aspects of analytical laboratory operation. When implemented as recommended, the practices presented in this guide will provide a comprehensive QA program for the laboratory. The practices are grouped by functions, which constitute the basic elements of a laboratory QA program. 1.2 The essential, basic elements of a laboratory QA program appear in the following order: Section Organization 5 Quality Assurance Program 6 Training and Qualification 7 Procedures 8 Laboratory Records 9 Control of Records 10 Control of Procurement 11 Control of Measuring Equipment and Materials 12 Control of Measurements 13 Deficiencies and Corrective Actions 14

  6. Requirements for an ES and H assurance program at the working levels of organization

    International Nuclear Information System (INIS)

    Means by which the disciplines of quality assurance (QA), reliability (R), and human factors (HF) might be used to the advantage of Environment, Safety, and Health (ES and H) programs are being investigated. A generalized model assurance program, based on QA, R, and HF principles but specifically tailored to ES and H program needs, has been developed. Current studies address implementation of the model assurance program at the working levels of organization. It appears that the only way practicability at the working level can be determined is by the case study method. The present study represents a first step in the application of such a procedure. An attempt was made to approach the question of practicability by first constructing a generic ES and H assurance plan for working-level organizations that is based upon the more widely-applied model plan and studies mentioned earlier. Then the elements of this generic working-level plan were compared with the practices of an existing R and D organization at Sandia Laboratories, Albuquerque. Some of the necessary steps were taken to convert these practices to those required by the generic plan in order to gain a measure of the feasibility, cost, and some of the possible benefits of such a conversion. Partial results of one case study are presented, and some generalizations that emerge regarding the structure of an idealized working-level ES and H plan are made

  7. Quality Assurance Program Plan for Project W-379: Spent Nuclear Fuels Canister Storage Building Projec

    International Nuclear Information System (INIS)

    This document describes the Quality Assurance Program Plan (QAPP) for the Spent Nuclear Fuels (SNF) Canister Storage Building (CSB) Project. The purpose of this QAPP is to control project activities ensuring achievement of the project mission in a safe, consistent and reliable manner

  8. Requirements for auditing of quality assurance programs for nuclear power plants

    International Nuclear Information System (INIS)

    Requirements and guidance are provided for establishing and implementing a system of internal and external audits of quality assurance programs for nuclear power plants, including the preparation, performance, reporting and follow-up of audits by both the auditing and the audited organizations. This standard is to be used in conjunction with ANSI N45.2

  9. Quality Assurance of Non-Local Accounting Programs Conducted in Hong Kong

    Science.gov (United States)

    Cheng, Mei-Ai; Leung, Noel W.

    2014-01-01

    This study examines the current government policy and institutional practice on quality assurance of non-local accounting programs conducted in Hong Kong. Both international guidelines, national regulations and institutional frameworks in higher education and transnational higher education, and professional practice in accounting education are…

  10. 21 CFR 1000.55 - Recommendation for quality assurance programs in diagnostic radiology facilities.

    Science.gov (United States)

    2010-04-01

    ... diagnostic radiology facilities. 1000.55 Section 1000.55 Food and Drugs FOOD AND DRUG ADMINISTRATION... Recommendations § 1000.55 Recommendation for quality assurance programs in diagnostic radiology facilities. (a... diagnostic radiology facilities. (b) Definitions. As used in this section, the following definitions...

  11. THE IMPORTANCE OF A SUCCESSFUL QUALITY ASSURANCE (QA) PROGRAM FROM A RESEARCH MANAGER'S PERSPECTIVE

    Science.gov (United States)

    The paper discusses the Air Pollution Prevention and Control Division's Quality Assurance (QA) program and the approaches used to meet QA requirements in the Division. The presentation is a technical manager's perspective of the Division's requirements for and approach to QA in i...

  12. Requirements for an ES and H assurance program at the working levels of organization

    Energy Technology Data Exchange (ETDEWEB)

    Tierney, M.S.; Ellingson, A.C.

    1979-07-01

    Means by which the disciplines of quality assurance (QA), reliability (R), and human factors (HF) might be used to the advantage of Environment, Safety, and Health (ES and H) programs are being investigated. A generalized model assurance program, based on QA, R, and HF principles but specifically tailored to ES and H program needs, has been developed. Current studies address implementation of the model assurance program at the working levels of organization. It appears that the only way practicability at the working level can be determined is by the case study method. The present study represents a first step in the application of such a procedure. An attempt was made to approach the question of practicability by first constructing a generic ES and H assurance plan for working-level organizations that is based upon the more widely-applied model plan and studies mentioned earlier. Then the elements of this generic working-level plan were compared with the practices of an existing R and D organization at Sandia Laboratories, Albuquerque. Some of the necessary steps were taken to convert these practices to those required by the generic plan in order to gain a measure of the feasibility, cost, and some of the possible benefits of such a conversion. Partial results of one case study are presented, and some generalizations that emerge regarding the structure of an idealized working-level ES and H plan are made. (JGB)

  13. Plutonium immobilization project development and testing quality assurance program description - February 1999

    International Nuclear Information System (INIS)

    Lawrence Livermore National Laboratory Immobilization Development and Testing organization (LLNL ID and T) is a Participant in the Plutonium Immobilization Project (PIP). The LLNL D and T has lead responsibilities for form characterization and qualification, ceramic form development, process/equipment development with plutonium, and process systems testing and validation for both conversion and immobilization. This work must be performed in accordance with the graded approach of a Quality Assurance (QA) Program. A QA Program has been developed at LLNL to meet the requirements of the DOE/MD Quality Assurance Requirements. The LLNL QA Program consists of a Quality Assurance Program Description (QAPD) and Quality Implementing Procedures. These documents interface and are a subset of the overall PIP QA Program Documents. The PIP QA Program is described in the PIP ID and T QA Plan, PIP QAPD, and QA Procedures. Other Participant Organizations also must document and describe their PIP compliant QA Programs in a QAPD and implementing procedures. The purpose of this LLNL QAPD is to describe the organization, management processes, QA Controls for Grading, functional responsibilities, levels of authority, and interfaces for those managing, performing, and assessing the adequacy of work

  14. B and W NPGD quality assurance program for nuclear equipment. Revision 1

    International Nuclear Information System (INIS)

    B and W's Quality Assurance Program (QAP) is described. The program is implemented through the Nuclear Power Generation Division (NPGD) and includes design, procurement, and manufacturing activities of NPGD and all its suppliers furnishing items in the B and W scope of supply including other Divisions/ Subsidiaries of B and W. These activities are controlled by including applicable quality assurance requirements, as described, in NPGD procurement documents imposed on its suppliers. Each supplier must then establish and/or maintain a documented QA Program to meet the requirements imposed by the procurement documents. Implementation of the suppliers' NPGD-approved QA Program is verified by NPGD through Audit and QC Surveillance activities. The position and relationships of the NPGD within the Company's corporate structure are described. An overview of the QAP describing its implementation, its operation, the controls imposed on all suppliers (both corporate and vendor) and site consulting activities is presented. (U.S.)

  15. EFFICIENT QUALITY ASSURANCE PROGRAMS IN RADIOLOGY AND NUCLEAR MEDICINE IN ÖSTERGÖTLAND, SWEDEN

    OpenAIRE

    Sandborg, Michael; Nilsson Althen, Jonas; Gustafsson, Agneta

    2010-01-01

    Owners of imaging modalities using ionising radiation should have a documented quality assurance (QA) program, as well as methods to justify new radiological procedures to ensure safe operation and adequate clinical image quality. This includes having a system for correcting divergences, written imaging protocols, assessment of patient and staff absorbed doses and a documented education and training program. In this work, how some aspects on QA have been implemented in the County of Östergötl...

  16. Bruce Power's nuclear pressure boundary quality assurance program requirements, implementation and transition

    International Nuclear Information System (INIS)

    The development of a full scope nuclear pressure boundary quality assurance program in Canada requires extensive knowledge of the structure and detailed requirements of codes and standards published by the Canadian Standards Association (CSA) and American Society of Mechanical Engineers (ASME). Incorporation into company governance documents and implementation of these requirements while managing the transition to more recent revisions of these codes and standards represents a significant challenge for Bruce Power, Canada's largest independent nuclear operator. This paper explores the key developments and innovative changes that are used to ensure successful regulatory compliance and effective implementation of the Bruce Power Pressure Boundary Quality Assurance Program. Challenges and mitigating strategies to sustain this large compliance based program at Bruce Power's 8 unit nuclear power plant site will also be detailed. (author)

  17. Technical Excellence and Communication: The Cornerstones for Successful Safety and Mission Assurance Programs

    Science.gov (United States)

    Malone, Roy W.; Livingston, John M.

    2010-01-01

    The paper describes the role of technical excellence and communication in the development and maintenance of safety and mission assurance programs. The Marshall Space Flight Center (MSFC) Safety and Mission Assurance (S&MA) organization is used to illustrate philosophies and techniques that strengthen safety and mission assurance efforts and that contribute to healthy and effective organizational cultures. The events and conditions leading to the development of the MSFC S&MA organization are reviewed. Historic issues and concerns are identified. The adverse effects of resource limitations and risk assessment roles are discussed. The structure and functions of the core safety, reliability, and quality assurance functions are presented. The current organization s mission and vision commitments serve as the starting points for the description of the current organization. The goals and objectives are presented that address the criticisms of the predecessor organizations. Additional improvements are presented that address the development of technical excellence and the steps taken to improve communication within the Center, with program customers, and with other Agency S&MA organizations.

  18. Analytical Chemistry Laboratory Quality Assurance Project Plan for the Transuranic Waste Characterization Program

    Energy Technology Data Exchange (ETDEWEB)

    Sailer, S.J.

    1996-08-01

    This Quality Assurance Project Plan (QAPJP) specifies the quality of data necessary and the characterization techniques employed at the Idaho National Engineering Laboratory (INEL) to meet the objectives of the Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Transuranic Waste Characterization Quality Assurance Program Plan (QAPP) requirements. This QAPJP is written to conform with the requirements and guidelines specified in the QAPP and the associated documents referenced in the QAPP. This QAPJP is one of a set of five interrelated QAPjPs that describe the INEL Transuranic Waste Characterization Program (TWCP). Each of the five facilities participating in the TWCP has a QAPJP that describes the activities applicable to that particular facility. This QAPJP describes the roles and responsibilities of the Idaho Chemical Processing Plant (ICPP) Analytical Chemistry Laboratory (ACL) in the TWCP. Data quality objectives and quality assurance objectives are explained. Sample analysis procedures and associated quality assurance measures are also addressed; these include: sample chain of custody; data validation; usability and reporting; documentation and records; audits and 0385 assessments; laboratory QC samples; and instrument testing, inspection, maintenance and calibration. Finally, administrative quality control measures, such as document control, control of nonconformances, variances and QA status reporting are described.

  19. Quality assurance program manual for nuclear power plants. Volume I. Policies

    International Nuclear Information System (INIS)

    The Consumers Power Company Quality Assurance Program Manual for Nuclear Power Plants consists of policies and procedures which comply with current NRC regulatory requirements and industry codes and standards in effect during the design, procurement, construction, testing, operation, refueling, maintenance, repair and modification activities associated with nuclear power plants. Specific NRC and industry documents that contain the requirements, including the issue dates in effect, are identified in each nuclear power plant's Safety Analysis Report. The requirements established by these documents form the basis for the Consumer Power Quality Assurance Program, which is implemented to control those structures, systems, components and operational safety actions listed in each nuclear power plant's Quality List (Q-List). As additional and revised requirements are issued by the NRC and professional organizations involved in nuclear activities, they will be reviewed for their impact on this manual, and changes will be made where considered necessary. CP Co 1--Consumers Power Company QA Program Topical Report is Volume I of this manual and contains Quality Assurance Program Policies applicable during all phases of nuclear power plant design, construction and operation

  20. USCEA/NIST measurement assurance programs for the radiopharmaceutical and nuclear power industries

    Energy Technology Data Exchange (ETDEWEB)

    Golas, D.B. [Council for Energy Awareness, Washington, DC (United States)

    1993-12-31

    In cooperation with the U.S. Council for Energy Awareness (USCEA), the National Institute of Standards and Technology (NIST) supervises and administers two measurement assurance programs for radioactivity measurement traceability. One, in existence since the mid 1970s, provides traceability to suppliers of radiochemicals and radiopharmaceuticals, dose calibrators, and nuclear pharmacy services. The second program, begun in 1987, provides traceability to the nuclear power industry for utilities, source suppliers, and service laboratories. Each program is described, and the results of measurements of samples of known, but undisclosed activity, prepared at NIST and measured by the participants are presented.

  1. USCEA/NIST measurement assurance programs for the radiopharmaceutical and nuclear power industries

    International Nuclear Information System (INIS)

    In cooperation with the U.S. Council for Energy Awareness (USCEA), the National Institute of Standards and Technology (NIST) supervises and administers two measurement assurance programs for radioactivity measurement traceability. One, in existence since the mid 1970s, provides traceability to suppliers of radiochemicals and radiopharmaceuticals, dose calibrators, and nuclear pharmacy services. The second program, begun in 1987, provides traceability to the nuclear power industry for utilities, source suppliers, and service laboratories. Each program is described, and the results of measurements of samples of known, but undisclosed activity, prepared at NIST and measured by the participants are presented

  2. QUALITY ASSURANCE IN SECONDARY EDUCATION PROGRAME OF BANGLADESH OPEN UNIVERSITY: Present Status and Challenges

    Directory of Open Access Journals (Sweden)

    Zobaida AKHTER

    2008-04-01

    Full Text Available In the present day in national and international perspectives, quality is the top of most agendas. Quality of education has significant impact and invaluable contribution to the area of development. Recently, the SSC & HSC program of BOU have earned recognition of equivalency with the formal education sector, which has naturally raised the question of quality assurance of these programs By applying the quantitative method, the study has assessed the present status of the quality of SSC & HSC program of BOU and also put some recommendations to meet the challenges for further development.

  3. Remedial investigation quality assurance program plan: Weldon Spring Site Remedial Action Project: Revision 0

    International Nuclear Information System (INIS)

    The Remedial Investigations Quality Assurance Program Plan (RIQAPP) for Weldon Spring Site Remedial Action Project (WSSRAP) is distinguished by purpose from the WSSRAP overall Quality Assurance/Quality Control Program Plan (QAPP). The RIQAPP is focused only on meeting EPA requirements under CERCLA whereas the QAPP is designed to meet quality assurance program requirements for nuclear facilities. The RIQAPP specifically addresses factors, methods and criteria. Specific QC procedures are contained in existing documents incorporated into the plan by reference. These include Standard Operating Procedures, laboratory QA procedures, and activity level sampling plans. The existing procedures provide many of the required QA elements: measurement, sampling, sample and document custody and control, calibration, analysis and data reduction, validation and reporting. Addition QA elements addressed in the RIQAPP include performance and system audits, surveillance, and reporting and correction of deficiencies. System audits, on a regularly scheduled basis, will evaluate all components of measurement systems to determine capability, proper selection and use. Performance audits, on a scheduled basis, will determine adequacy and accuracy of a given measurement system and/or procedural compliance. Surveillance, both scheduled and unscheduled, of field and laboratory activities will be performed to verify conformance to specified requirements. 8 refs., 1 fig., 1 tab

  4. Quality assurance program in the External dosimetry laboratory of the CPHR

    International Nuclear Information System (INIS)

    From 1999 the Laboratory of External Dosimetry of the Radiation Protection and Hygiene Center comes applying in its service of personal dosimetry a Program of Quality Assurance. This program was designed according to the recommendations of national and international organizations as the National Assuring Office of the Republic of Cuba (ONARC), the International Standards Organization (ISO), the International Electro technique Commission (IEC) and the International Atomic Energy Agency (IAEA). In this work it is presented in a summarized way the operation of this Program of Quality Assurance which includes the administration and conservation of the results and the documentation of the service, the controls that are carried out to the equipment, the acceptance tests that are applied to the equipment and new dosemeters, the shipment and prosecution of the dosemeters, the evaluation, storage and conservation of the doses, the report of the results, the traceability and reproducibility of the measurements, the attention to the reclamations and the clients complaints and the internal and external audits to those that it undergoes periodically the laboratory. (Author)

  5. Utility QA viewpoint: Quality assurance program conforming to 10CFR50, Appendix B and 10CFR71, subpart H

    International Nuclear Information System (INIS)

    The Nuclear Regulatory Commission issued IE Information Notice No. 84-50: ''Clarification of Scope of Quality Assurance Programs for Transport Packages Pursuant to 10CFR50, Appendix B, in June, 1984. The reason for this notice was to eliminate confusion applicable to the quality assurance provisions of Appendix B, 10CFR50 to certain transport packages for which a quality assurance program is required by 10 CFR 71. The purpose of this paper is to provide methodology for establishing, implementing and verifying that all 10CFR71, Subpart H requirements are met with the utility's NRC approved 10CFR50, Appendix B Quality Assurance Program when utilizing a contractor (with a NRC approved Quality Assurance Program for Radioactive Waste Packaging and Transport) providing the radioactive waste solidification, packaging and transport for the utility. Collectively (utility and contractor) the quality assurance programs will meet the applicable regulatory requirements without the necessity of the utility establishing a separate and specific quality assurance program for Packaging and Transport of Radioactive Waste

  6. Implementation of a quality assurance program for computerized treatment planning systems

    International Nuclear Information System (INIS)

    In the present investigation, the necessary tests for implementing a quality assurance program for a commercial treatment planning system (TPS), recently installed at Sao Paulo University School of Medicine Clinicas Hospital--Brazil, was established and performed in accordance with the new IAEA publication TRS 430, and with AAPM Task Group 53. The tests recommended by those documents are classified mainly into acceptance, commissioning (dosimetric and nondosimetric), periodic quality assurance, and patient specific quality assurance tests. The recommendations of both IAEA and AAPM documents are being implemented at the hospital for photon beams produced by two linear accelerators. A Farmer ionization chamber was used in a 30x30x30 cm3 phantom with a dose rate of 320 monitor unit (MU)/min and 50 MU in the case of the dosimetric tests. The acceptance tests verified hardware, network systems integration, data transfer, and software parameters. The results obtained are in good agreement with the specifications of the manufacturer. For the commissioning dosimetric tests, the absolute dose was measured for simple geometries, such as square and rectangular fields, up to more complex geometries such as off-axis hard wedges and for behavior in the build up region. Results were analysed by the use of confidence limit as proposed by Venselaar et al. [Radio Ther. Oncol. 60, 191-201 (2001)]. Criteria of acceptability had been applied also for the comparison between the values of MU calculated manually and MU generated by TPS. The results of the dosimetric tests show that work can be reduced by choosing to perform only those that are more crucial, such as oblique incidence, shaped fields, hard wedges, and buildup region behavior. Staff experience with the implementation of the quality assurance program for a commercial TPS is extremely useful as part of a training program

  7. Quality Assurance of Computer Programs for Photopeak Integration in Activation Analysis

    DEFF Research Database (Denmark)

    Heydorn, Kaj

    1978-01-01

    The purpose of a computer program for quantitative activation analysis is basically to produce information on the ratio of radioactive decays of a specific radio-nuclide observed by a detector from two alternative sources. It is assumed that at least one of the sources is known to contain...... the radionuclide in question, and qualitative analysis is therefore needed only to the extent that the decay characteristics of this radionuclide could be confused with those of other possible radionuclides, thus interfering with its determination. The quality of these computer programs can only be assured...

  8. The Evolution of the NASA Commercial Crew Program Mission Assurance Process

    Science.gov (United States)

    Canfield, Amy C.

    2016-01-01

    In 2010, the National Aeronautics and Space Administration (NASA) established the Commercial Crew Program (CCP) in order to provide human access to the International Space Station and low Earth orbit via the commercial (non-governmental) sector. A particular challenge to NASA has been how to determine that the Commercial Provider's transportation system complies with programmatic safety requirements. The process used in this determination is the Safety Technical Review Board which reviews and approves provider submitted hazard reports. One significant product of the review is a set of hazard control verifications. In past NASA programs, 100% of these safety critical verifications were typically confirmed by NASA. The traditional Safety and Mission Assurance (S&MA) model does not support the nature of the CCP. To that end, NASA S&MA is implementing a Risk Based Assurance process to determine which hazard control verifications require NASA authentication. Additionally, a Shared Assurance Model is also being developed to efficiently use the available resources to execute the verifications.

  9. Pilot program to assess proposed basic quality assurance requirements in the medical use of byproduct materials

    Energy Technology Data Exchange (ETDEWEB)

    Kaplan, E.; Nelson, K.; Meinhold, C.B. (Brookhaven National Lab., Upton, NY (United States))

    1991-10-01

    In January 1990, the Nuclear Regulatory Commission (NRC) proposed amendments to 10 CFR Part 35 that would require medical licensees using byproduct material to establish and implement a basic quality assurance program. A 60-day real-world trial of the proposed rules was initiated to obtain information beyond that generally found through standard public comment procedures. Volunteers from randomly selected institutions had opportunities to review the details of the proposed regulations and to implement these rules on a daily basis during the trial. The participating institutions were then asked to evaluate the proposed regulations based on their personal experiences. The pilot project sought to determine whether medical institutions could develop written quality assurance programs that would meet the eight performance-based objectives of proposed Section 35.35. In addition, the NRC wanted to learn from these volunteers if they had any recommendations on how the rule could be revised to minimized its cost and to clarify its objectives without decreasing its effectiveness. It was found that licensees could develop acceptable QA programs under a performance-based approach, that most licensee programs did meet the proposed objectives, and that most written QA plans would require consultations with NRC or Agreement State personnel before they would fully meet all objectives of proposed Section 35.35. This report describes the overall pilot program. The methodology used to select and assemble the group of participating licensees is presented. The various workshops and evaluation questionnaires are discussed, and detailed findings are presented. 7 refs.

  10. Pilot program to assess proposed basic quality assurance requirements in the medical use of byproduct materials

    International Nuclear Information System (INIS)

    In January 1990, the Nuclear Regulatory Commission (NRC) proposed amendments to 10 CFR Part 35 that would require medical licensees using byproduct material to establish and implement a basic quality assurance program. A 60-day real-world trial of the proposed rules was initiated to obtain information beyond that generally found through standard public comment procedures. Volunteers from randomly selected institutions had opportunities to review the details of the proposed regulations and to implement these rules on a daily basis during the trial. The participating institutions were then asked to evaluate the proposed regulations based on their personal experiences. The pilot project sought to determine whether medical institutions could develop written quality assurance programs that would meet the eight performance-based objectives of proposed Section 35.35. In addition, the NRC wanted to learn from these volunteers if they had any recommendations on how the rule could be revised to minimized its cost and to clarify its objectives without decreasing its effectiveness. It was found that licensees could develop acceptable QA programs under a performance-based approach, that most licensee programs did meet the proposed objectives, and that most written QA plans would require consultations with NRC or Agreement State personnel before they would fully meet all objectives of proposed Section 35.35. This report describes the overall pilot program. The methodology used to select and assemble the group of participating licensees is presented. The various workshops and evaluation questionnaires are discussed, and detailed findings are presented. 7 refs

  11. Standard review plan for the review of environmental restoration remedial action quality assurance program plans

    International Nuclear Information System (INIS)

    This plan establishes both the scope of the review and the acceptance criteria to be utilized for the review of Quality Assurance Program Plans (QAPPs) developed in accordance with the requirements of DOE/RL-90-28. DOE/RL-90-28, the Environmental Restoration Remedial Action Quality Assurance Requirements Document (QARD) defines all quality assurance (QA) requirements governing activities that affect the quality of the Environmental Restoration Remedial Action (ERRA) program at the Hanford Site. These requirements are defined in three parts, Part 1 of Quality Management and Administration tasks, Part 2 for Environmental Data Operations, and Part 3 of the Design and Construction of items, systems, and facilities. The purpose of this document is to identify the scope of the review by the DOE Field Office, Richland staff, and establish the acceptance criteria (Parts 1, 2, and 3) that the DOE Field Office, Richland staff will utilize to evaluate the participant QAPPs. Use of the standard review plan will (1) help ensure that participant QAPPs contain the information required by DOE/RL-90-28, (2) aid program participant and DOE Field Office, Richland staff is ensuring that the information describing the participant's QAPP is complete, (3) help persons regarding DOE/RL- 90-28 to locate information, and (4) contribute to decreasing the time needed for the review process. In addition, the Standard Review Plan (SRP) ensures the quality and uniformity of the staff reviews and presents a well-defined base from which to evaluate compliance of participant quality programs against DOE/RL-90-28

  12. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) Quality Assurance Manual

    Energy Technology Data Exchange (ETDEWEB)

    C. L. Smith; R. Nims; K. J. Kvarfordt; C. Wharton

    2008-08-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) is a software application developed for performing a complete probabilistic risk assessment using a personal computer running the Microsoft Windows operating system. SAPHIRE is primarily funded by the U.S. Nuclear Regulatory Commission (NRC). The role of the INL in this project is that of software developer and tester. This development takes place using formal software development procedures and is subject to quality assurance (QA) processes. The purpose of this document is to describe how the SAPHIRE software QA is performed for Version 6 and 7, what constitutes its parts, and limitations of those processes.

  13. Quality Assurance Program Plan Waste Management Federal Services of Hanford, Inc

    International Nuclear Information System (INIS)

    This document is the Quality Assurance Program Plan (QAPP) for Waste Management Federal Services of Hanford, Inc. (WMH), that implements the requirements of the Project Hanford Management Contract (PHMC), HNF-MP-599, Project Hanford Quality Assurance Program Description (QAPD) document, and the Hanford Federal Facility Agreement with Consent Order (Tri-Party Agreement), Sections 6.5 and 7.8. WHM is responsible for the treatment, storage, and disposal of liquid and solid wastes generated at the Hanford Site as well as those wastes received from other US Department of Energy (DOE) and non-DOE sites. WMH operations include the Low-Level Burial Grounds, Central Waste Complex (a mixed-waste storage complex), a nonradioactive dangerous waste storage facility, the Transuranic Storage Facility, T Plant, Waste Receiving and Processing Facility, 200 Area Liquid Effluent Facility, 200 Area Treated Effluent Disposal Facility, the Liquid Effluent Retention Facility, the 242-A Evaporator, 300 Area Treatment Effluent Disposal Facility, the 340 Facility (a radioactive liquid waste handling facility), 222-S Laboratory, the Waste Sampling and Characterization Facility, and the Hanford TRU Waste Program

  14. A program on quality assurance and dose calibration for radiation therapy units in Venezuela

    International Nuclear Information System (INIS)

    The results of a five year program (1988-90-91-92-93) on quality assurance and dose calibration for 12 Cobalt-60 units from public hospitals, which represents 30% of total radiation therapy units in Venezuela, are presented. The remarkable improvement in the general performance of these units can be seen in the IAEA/WHO Postal TLD Intercomparison results which gave 100% within ± 5% in 1990 and 1992, while 63% in 1990 and 44% in 1992, with errors up to 37% were obtained for the participants not included in the program. The difference between the two groups lead the government to decrete through the Gaceta Oficial de la Republica de Venezuela, Resolution G-1397 on March 3, 1993, the quality assurance and dose calibration programs shall be established for all radiation therapy installations in Venezuela. The project for the standards was developed by the SSDL physicists and it was already approbated by the Health Ministry. It is expected that the Norms will enter into effect by the end of 1994. (author). 14 refs, 1 fig., 3 tabs

  15. QUALITY ASSURANCE UPDATE

    Science.gov (United States)

    An overview of the air pollution quality assurance program as implemented by EMSL/RTP is presented. The discussion includes method standardization operations for both ambient air and stationary source measurements, the quality assurance audit program, the ambient air equivalency ...

  16. U.S. Department of Energy, Carlsbad Area Office quality assurance program document. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    Mission of the Carlsbad Area Office (CAO) is to protect human health and the environment by opening and operating the Waste Isolation Pilot Plant (WIPP) for safe disposal of TRU waste, and establishing an effective system for management of TRU waste from generation to disposal. To help in fulfilling this mission and to ensure that risks and environmental impacts are identified and minimized, and that safety, reliability, and performance are optimized, CAO`s policy is to establish and maintain an effective quality assurance (QA) program that supports compliance with applicable Federal, State, and local regulations, and DOE orders and requirements. This document establishes QA program requirements for all programs, projects, and activities sponsored by CAO.

  17. Development and status of data quality assurance program at NASA Langley research center: Toward national standards

    Science.gov (United States)

    Hemsch, Michael J.

    1996-01-01

    As part of a continuing effort to re-engineer the wind tunnel testing process, a comprehensive data quality assurance program is being established at NASA Langley Research Center (LaRC). The ultimate goal of the program is routing provision of tunnel-to-tunnel reproducibility with total uncertainty levels acceptable for test and evaluation of civilian transports. The operational elements for reaching such levels of reproducibility are: (1) statistical control, which provides long term measurement uncertainty predictability and a base for continuous improvement, (2) measurement uncertainty prediction, which provides test designs that can meet data quality expectations with the system's predictable variation, and (3) national standards, which provide a means for resolving tunnel-to-tunnel differences. The paper presents the LaRC design for the program and discusses the process of implementation.

  18. The design reliability assurance program for the Westinghouse AP600 reactor

    International Nuclear Information System (INIS)

    The mission of the Westinghouse AP600 is to provide a safe, simple, standardized and economically competitive design with a high degree of operability and ease of maintenance. To meet these goals, the AP600 Reliability, Availability and Maintainability program (RAM) and Design Reliability Assurance Program (D-RAP) were established. These programs, from the outset of the design process, systematically identified the safety and availability goals of the plant, defined the associated performance goals of the plant's critical systems, and provided insights to the design process to improve component reliability. The result is a documented list of risk-significant and availability-significant structures, systems and components (SSCs) whose reliability values must be established during manufacture and maintained throughout the life of the plant. (author)

  19. The meteorological monitoring audit, preventative maintenance and quality assurance programs at a former nuclear weapons facility

    International Nuclear Information System (INIS)

    The purposes of the meteorological monitoring audit, preventative maintenance, and quality assurance programs at the Rocky Flats Environmental Technology Site (Site), are to (1) support Emergency Preparedness (EP) programs at the Site in assessing the transport, dispersion, and deposition of effluents actually or potentially released into the atmosphere by Site operations; and (2) provide information for onsite and offsite projects concerned with the design of environmental monitoring networks for impact assessments, environmental surveillance activities, and remediation activities. The risk from the Site includes chemical and radioactive emissions historically related to nuclear weapons component production activities that are currently associated with storage of large quantities of radionuclides (plutonium) and radioactive waste forms. The meteorological monitoring program provides information for site-specific weather forecasting, which supports Site operations, employee safety, and Emergency Preparedness operations

  20. A nuclear generator's approach to pressure boundary quality assurance program certification

    International Nuclear Information System (INIS)

    The development of a full scope nuclear pressure boundary quality assurance program in Canada requires the incorporation of extensive detailed requirements of the Canadian Standards Association (CSA) and referenced American Society of Mechanical Engineers (ASME) codes and standards in company governance documents. Implementation of these requirements and demonstration of the required controls to an independent regulatory agent as required by the Power Reactor Operating Licenses at the 8 unit nuclear power plant site was a significant challenge to Bruce Power, Canada's largest independent nuclear operator. This paper explores the key developments and innovative changes that were used to ensure successful regulatory approval and independent certification of the Bruce Power Pressure Boundary QA Program. Challenges and mitigating strategies to sustain this large compliance based program will also be detailed. (author)

  1. Plutonium immobilization project development and testing technical project office quality assurance program description

    International Nuclear Information System (INIS)

    The Plutonium Immobilization Project (PIP) is one of several fissile materials disposition projects managed by the Department of Energy (DOE) Office of Fissile Materials Disposition (OFMD). The PIP is expected to evolve from the current Development and Testing (D and T) effort, to design, to construction, and finally to operations. Overall management and technical management of the D and T effort resides at the Lead Laboratory, Lawrence Livermore National Laboratory (LLNL), through the LLNL Manager, Fissile Materials Disposition Program (FMDP). Day to day project activities are managed by the D and T Technical Project Office (TPO), which reports to the LLNL Manager, FMDP. The D and T TPO consists of the Technical Manager, the TPO Quality Assurance (QA) Program Manager, and TPO Planning and Support Staff. This Quality Assurance Program Description (QAPD) defines the QA policies and controls that will be implemented by these TPO personnel in their management of D and T activities. This QAPD is consistent with and responsive to the Department of Energy Fissile Materials Disposition Program Quality Assurance Requirements Document (FMDP QARD). As the Project and upper level requirement's documents evolve, this QAPD will be updated as necessary to accurately define and describe the QA Program and Management of the PIP. The TPO has a policy that all development and testing activities be planned, performed and assessed in accordance with its customer's requirements, needs and expectations, and with a commitment to excellence and continuous improvement. The TPO QAPD describes implementation requirements which, when completed, will ensure that the project development and testing activities conform to the appropriate QA requirements. For the program to be effective, the TPO QA Program Manager will ensure that each site participating in D and T activities has developed a QAPD, which meets the customer's requirements, and has a designated quality leader in place. These customer

  2. Energy Assurance Technical Training and Awareness Program/Energy Infrastructure Training and Analysis Center

    Energy Technology Data Exchange (ETDEWEB)

    Barbara McCabe

    2005-11-15

    This report covers the work completed during Year One (Year One has a 16 month project period) of a five- year Cooperative Agreement (DE-FC26-03NT41895) between the International Union of Operating Engineers (IUOE) National Hazmat Program (OENHP) and the U. S. Department of Energy (DOE) National Energy Technology Laboratory (NETL). This final technical report is being submitted, as required by the Cooperative Agreement, within 90 (calendar) days after the project period ends (December 31, 2004). The resources allocated to Year One of the Cooperative Agreement were adequate for the completion of the required deliverables. All deliverables have been completed and sent to AAD Document Control as directed in the cooperative agreement. The allocation for Year One required 20-25 trainers to be trained in each of five Train-the-Trainer courses and a total of 6,000 workers trained throughout the country. Through cost savings employed for the scheduling and conduct of Train-the-Trainer, instructor refreshers, and direct training classes, 3171 workers have been trained to date. This total incorporates 159 trainers and members from management, local, county, state and federal organizations identified in the Strategic Plan. The largest percentage of personnel trained is heavy equipment operators, and building engineers, which is the largest targeted population identified under this cooperative agreement. The OENHP, using existing curriculum as appropriate, has modified and developed new training modules that have been used to establish four different levels of training courses. The four courses are: (1) EA 500 Energy Assurance Train-the-Trainer, (2) EA 400 Energy Assurance Instructor Refresher, (3) EA 300 Energy Assurance, and (4) EA 100 Energy Assurance Awareness. Training modules cover topics, such as, but not limited to, facility vulnerability and vulnerability assessment, physical security- heating, ventilation, air conditioning, terrorism awareness, weapons of mass

  3. Analysis of retakes: understanding, managing, and using an analysis of retakes program for Quality Assurance

    International Nuclear Information System (INIS)

    The benefits to be obtained from an analysis of retakes program include: identificaton of problems which are know to be affecting image quality and patient dose by creating additional retakes; documentation of monetary savings from QA programs by achieving fewer retakes; and potential improvement in departmental performance by using retake data feedback to increase motivation. In addition to outlining the meaning of retakes and suggested procedures for beginning and maintaining an on-going retake analysis program, the cost of retakes is discussed in both dollar and radiation exposure contexts, balanced against this cost savings is the expense of implementing a quality assurance program in a diagnostic radiology facility. This expense varies widely depending on the level and management of the QA program. The additional cost of performing the analysis of retakes study is minimal. For a facility with five rooms of radiographic equipment, the retake tabulation and analysis should require one to two hours per week to perform. The program would require $312 to $625 per year and even less with experience and streamlining. The benefits would appear to definitely outweigh the costs

  4. Guidance for implementing an environmental, safety and health assurance program. Volume 2. A model plan for environmental, safety and health staff audits and appraisals

    International Nuclear Information System (INIS)

    This is 1 of 15 documents designed to illustrate how an Environmental, Safety and Health (ES and H) Assurance Program may be implemented. The generic definition of ES and H Assurance Programs is given in a companion document entitled An Environmental, Safety and Health Assurance Program Standard. This document is concerned with ES and H audit and appraisal activities of an ES and H Staff Organization as they might be performed in an institution whose ES and H program is based upon the ES and H Assurance Program Standard. An annotated model plan for ES and H Staff audits and appraisals is presented and discussed

  5. Nutrition Program Quality Assurance through a Formalized Process of On-Site Program Review

    Science.gov (United States)

    Paddock, Joan Doyle; Dollahite, Jamie

    2012-01-01

    A protocol for a systematic onsite review of the Expanded Food and Nutrition Education Program and Supplemental Nutrition Assistance Program-Education was developed to support quality programming and ensure compliance with state guidelines and federal regulations. Onsite review of local nutrition program operations is one strategy to meet this…

  6. Quality assurance and quality control program in individual monitoring service of the ENEA radiation protection institute

    International Nuclear Information System (INIS)

    Full text: The Individual Monitoring Service (IMS) of the ENEA Radiation Protection Institute, processes 80,000 dosemeters per year and is the only Italian Dosimetric Service supplying dosemeters for neutron radiation. It has been operating since the 1970s. The dosemeters have been designed, in house-developed and tested at ENEA Radiation Protection Institute throughout computational and experimental research. Since 2001 the ENEA IMS supplies personal dosemeters to assess Hp(d), which is required by Italian legislation (D.Lgs. 241/2000). In the 30 years of activity the ENEA-IMS has developed a learning of Quality Assurance (QA) and implemented Quality Control (QC) procedures to supply a reliable dosimetry service. In Italy, there are not yet requirements for approval of dosimetric service; however the application of a quality system to dosimetry is a quite established concept and few services have obtained certification in compliant with ISO 9000 standards, whereas accreditation in compliant with ISO 17025 is still on the way. In fact, although QA is sometimes a matter of common sense, the strategy for it towards the practical implementation of a QA program requires considerable thought. The IMS at ENEA has been always followed control procedures and internal tests to assure the quality of the whole system. Few examples will be given. The present paper describes the approach and actions which have been taken to 'translate' the actual 'ENEA Quality System' toward the accreditation according to ISO 17025. (author)

  7. Hanford Waste Vitrification Plant Quality Assurance Program description for high-level waste form development and qualification

    International Nuclear Information System (INIS)

    The Hanford Waste Vitrification Plant Project has been established to convert the high-level radioactive waste associated with nuclear defense production at the Hanford Site into a waste form suitable for disposal in a deep geologic repository. The Hanford Waste Vitrification Plant will mix processed radioactive waste with borosilicate material, then heat the mixture to its melting point (vitrification) to forin a glass-like substance that traps the radionuclides in the glass matrix upon cooling. The Hanford Waste Vitrification Plant Quality Assurance Program has been established to support the mission of the Hanford Waste Vitrification Plant. This Quality Assurance Program Description has been written to document the Hanford Waste Vitrification Plant Quality Assurance Program

  8. Directory of Certificates of Compliance for Radioactive Materials Packages: Report of NRC Approved Quality Assurance Programs for Radioactive Materials Packages

    International Nuclear Information System (INIS)

    This directory contains a Report of NRC Approved Packages (Volume 1), Certificates of Compliance (Volume 2), and a Report of NRC Approved Quality Assurance Programs for Radioactive Materials Packages (Volume 3). The purpose of this directory is to make available a convenient source of information on Quality Assurance Programs and Packagings which have been approved by the US Nuclear Regulatory Commission. Shipments of radioactive material utilizing these packagings must be in accordance with the provisions of 49 CFR section 173.471 and 10 CFR Part 71, as applicable. In satisfying the requirements of Section 71.12, it is the responsibility of the licensees to insure themselves that they have a copy of the current approval and conduct their transportation activities in accordance with an NRC approved quality assurance program

  9. Guidance for implementing an environmental, safety, and health assurance program. Volume 10. Model guidlines for line organization environmental, safety and health audits and appraisals

    International Nuclear Information System (INIS)

    This is 1 of 15 documents designed to illustrate how an Environmental, Safety and Health (ES and H) Assurance Program may be implemented. The generic definition of ES and H Assurance Programs is given in a companion document entitled An Environmental, Safety and Health Assurance Program Standard. The Standard specifies that the operational level of an institution must have an internal assurance function, and this document provides guidance for the audit/appraisal portion of the operational level's ES and H program. The appendixes include an ES and H audit checklist, a sample element rating guide, and a sample audit plan for working level line organization internal audits

  10. Quality assurance manual for the Department of Energy laboratory accreditation program for personnel dosimetry systems

    International Nuclear Information System (INIS)

    The overall purpose of this document is to establish a uniform approach to quality assurance. This will ensure that uniform, high-quality personnel dosimetry practices are followed by the participating testing laboratories. The document presents guidelines for calibrating and maintaining measurement and test equipment (M and TE), calibrating radiation fields, and subsequently irradiating and handling personnel dosimeters in laboratories involved in the DOE dosimetry systems testing program. Radiation energies for which the test procedures apply are photons with approximately 15 keV to 2 MeV, beta particles above 0.3 MeV, neutrons with approximately 1 keV to 2 MeV. 12 refs., 4 tabs

  11. Quality assurance program manual for nuclear power plants. Volume I. Policies

    International Nuclear Information System (INIS)

    Policies and procedures are presented which comply with current NRC regulatory requirements and industry codes and standards in effect during the design, procurement, construction, testing, operation, refueling, maintenance, repair and modification activities associated with nuclear power plants. Specific NRC and industry documents that contain the requirements, including the issue dates in effect, are identified in each nuclear power plant's Safety Analysis Report. The requirements established by these documents form the basis for the Consumers Power Quality Assurance Program, which is implemented to control those structures, systems, components and operational safety actions listed in each nuclear power plant's Quality List (Q-List). As additional and revised requirements are issued by the NRC and professional organizations involved in nuclear activities, they will be reviewed for their impact on this manual, and changes will be made where considered necessary

  12. External Quality Assurance Programs Managed by the U.S. Geological Survey in Support of the National Atmospheric Deposition Program/Mercury Deposition Network

    Science.gov (United States)

    Latysh, Natalie E.; Wetherbee, Gregory A.

    2007-01-01

    The U.S. Geological Survey (USGS) Branch of Quality Systems operates external quality assurance programs for the National Atmospheric Deposition Program/Mercury Deposition Network (NADP/MDN). Beginning in 2004, three programs have been implemented: the system blank program, the interlaboratory comparison program, and the blind audit program. Each program was designed to measure error contributed by specific components in the data-collection process. The system blank program assesses contamination that may result from sampling equipment, field exposure, and routine handling and processing of the wet-deposition samples. The interlaboratory comparison program evaluates bias and precision of analytical results produced by the Mercury Analytical Laboratory (HAL) for the NADP/MDN, operated by Frontier GeoSciences, Inc. The HAL's performance is compared with the performance of five other laboratories. The blind audit program assesses bias and variability of MDN data produced by the HAL using solutions disguised as environmental samples to ascertain true laboratory performance. This report documents the implementation of quality assurance procedures for the NADP/MDN and the operating procedures for each of the external quality assurance programs conducted by the USGS. The USGS quality assurance information provides a measure of confidence to NADP/MDN data users that measurement variability is distinguished from environmental signals.

  13. The Quality Assurance Project assists the vitamin A capsule program in Antique Province, Philippines.

    Science.gov (United States)

    Blumenfeld, S

    1994-01-01

    Vitamin A deficiency remains an important problem in some parts of the Philippines. The Department of Health, with assistance from the Helen Keller Institute (HKI), established a vitamin A supplementation program in Antique Province providing for the administration of vitamin A capsules to malnourished children. Although the HKI cut off its assistance in 1992, continuation of the capsule supplementation program was an element of the National Nutrition Plan for 1992-96, and remains an element of the Antique Provincial health services program under the Philippines' devolved health services scheme. The Quality Assurance Program (QAP) in May 1993 began helping the Provincial Health Office improve the quality of the vitamin A program. A systems analysis was first undertaken to identify significant deviations from provider performance standards which had been adapted by the province from Nutrition Service guidelines. Many problems were observed, including lack of knowledge of the high-priority categories of children, incomplete counseling, and frequent mistakes in determining children's nutritional status. The provincial health office staff recommended that six of the province's seventeen municipalities participate in the quality improvement effort. The intent of the QAP staff was not only to help the provincial staff improve the quality of its vitamin A program by resolving some immediate operational problems, but to provide the health care workers with a quality improvement experience that they would intuitively transfer to other programs for which they were responsible. The coaching/facilitating approach of modern quality management allowed health workers to explore their own approaches to solving the problems chosen. PMID:12319096

  14. A quality assurance program for radiotherapy centers in the Republic of Korea

    International Nuclear Information System (INIS)

    Recognizing the importance of quality assurance in radiotherapy and the need to make access to radiation standards traceable to the international measurement system to every radiotherapy center, the KFDA, as a national secondary standard dosimetry laboratory (SSDL), has started a quality assurance program from 1999. This program was initiated by tele-survey to all radiotherapy centers regarding general information about their radiotherapists, medical physicists, type of equipment, dosimeters, etc. This provided the KFDA with a data file and led to links between the KFDA and the clinics. In 1999 a national quality assurance program for ensuring dosimetry accuracy has been performed by on-site dosimetry for 4 60Co γ ray, 47 high-energy photon beams used in 43 centers. During the audits, the procedure followed by the KFDA was to measure the outputs of the LINAC(6 MV) and Co-60 teletherapy units in terms of absorbed dose to water for fixed dose (2 Gy) in water phantom (only one phantom used in this on-site visit). For all the case, the measurements are carried out in a water phantom according to the IAEA recommended code of practice. The distributions of deviations in total audit are given. The results showed deviations varying between -7.11% and 8.38%. KFDA follow up the large deviated radiotherapy centers. The traceability to SSDL is a major factor of deviation between KFDA measurement dose and clinics quoted dose. The correction for air density (temperature and pressure) is a factor that sometimes introduces errors. Most of the clinics do not calibrate their own barometers and sometimes rely on the air pressure that is quoted during measurements by local metrological offices. In one case, the barometer and thermometer of the clinic were deviating from KFDA instruments by about 10 mmHg and 2, respectively even if the temperature was measured in air. In one case, about 4% of output variation with gantry head angle (horizontal vs. vertical). In the past two years the

  15. Using RUFDATA to guide a logic model for a quality assurance process in an undergraduate university program.

    Science.gov (United States)

    Sherman, Paul David

    2016-04-01

    This article presents a framework to identify key mechanisms for developing a logic model blueprint that can be used for an impending comprehensive evaluation of an undergraduate degree program in a Canadian university. The evaluation is a requirement of a comprehensive quality assurance process mandated by the university. A modified RUFDATA (Saunders, 2000) evaluation model is applied as an initiating framework to assist in decision making to provide a guide for conceptualizing a logic model for the quality assurance process. This article will show how an educational evaluation is strengthened by employing a RUFDATA reflective process in exploring key elements of the evaluation process, and then translating this information into a logic model format that could serve to offer a more focussed pathway for the quality assurance activities. Using preliminary program evaluation data from two key stakeholders of the undergraduate program as well as an audit of the curriculum's course syllabi, a case is made for, (1) the importance of inclusivity of key stakeholders participation in the design of the evaluation process to enrich the authenticity and accuracy of program participants' feedback, and (2) the diversification of data collection methods to ensure that stakeholders' narrative feedback is given ample exposure. It is suggested that the modified RUFDATA/logic model framework be applied to all academic programs at the university undergoing the quality assurance process at the same time so that economies of scale may be realized. PMID:26788815

  16. Use of the detective quantum efficiency in a quality assurance program

    Science.gov (United States)

    Cunningham, I. A.

    2008-03-01

    Radiology quality assurance programs are designed to ensure certain levels of image quality are maintained with imaging equipment. The detective quantum efficiency (DQE), expressed as a function of spatial frequency, is a direct measure of system performance and "dose efficiency" that is objective, quantitative and widely accepted by the scientific community. We have implemented a QA program in a tertiary care hospital in which both the DQE and modulation transfer function (MTF) are measured as part of a routine QA program. The DQE, MTF and system gain were measured bi-monthly over a 12-month evaluation period. Measurements of DQE were compliant with IEC62220-1 recommendations. In the past year, no significant deterioration in DQE or MTF of any system was observed. However, large differences in DQE and MTF were observed between different detector technologies. It is anticipated that routine monitoring of DQE could provide early warning of system failures or problems requiring service intervention, but no problems were experienced during the evaluation period.

  17. Quality assurance

    Energy Technology Data Exchange (ETDEWEB)

    Gillespie, B.M.; Gleckler, B.P.

    1995-06-01

    This section of the 1994 Hanford Site Environmental Report summarizes the quality assurance and quality control practices of Hanford Site environmental monitoring and surveillance programs. Samples are analyzed according to documented standard analytical procedures. This section discusses specific measures taken to ensure quality in project management, sample collection, and analytical results.

  18. Multicenter Collaborative Quality Assurance Program for the Province of Ontario, Canada: First-Year Results

    International Nuclear Information System (INIS)

    Purpose: The objective of this work was to develop a collaborative quality assurance (CQA) program to assess the performance of intensity modulated radiation therapy (IMRT) planning and delivery across the province of Ontario, Canada. Methods and Materials: The CQA program was designed to be a comprehensive end-to-end test that can be completed on multiple planning and delivery platforms. The first year of the program included a head-and-neck (H and N) planning exercise and on-site visit to acquire dosimetric measurements to assess planning and delivery performance. A single dosimeter was used at each institution, and the planned to measured dose agreement was evaluated for both the H and N plan and a standard plan (linear-accelerator specific) that was created to enable a direct comparison between centers with similar infrastructure. Results: CQA program feasibility was demonstrated through participation of all 13 radiation therapy centers in the province. Planning and delivery was completed on a variety of infrastructure (treatment planning systems and linear accelerators). The planning exercise was completed using both static gantry and rotational IMRT, and planned-to-delivered dose agreement (pass rates) for 3%/3-mm gamma evaluation were greater than 90% (92.6%-99.6%). Conclusions: All centers had acceptable results, but variation in planned to delivered dose agreement for the same planning and delivery platform was noted. The upper end of the range will provide an achievable target for other centers through continued quality improvement, aided by feedback provided by the program through the use of standard plans and simple test fields

  19. Assuring CANDU nuclear safety competence in Korea: regulatory research and development program

    International Nuclear Information System (INIS)

    According to a two-reactor policy developed in the late 1980s in Korea, the national short and mid-term power reactor strategy has been established in such a way PWR should play a principal role in the development of nuclear power plants and CANDU a supplementary role taking advantage of its localization potentials. However, the diversification of reactor types and vendors has caused some difficulties in the process of the individual nuclear power plants licensing and regulation. During the licensing of Wolsong units 2, 3 and 4, every effort has been made to harmonize the Canadian regulations with those of Korea by establishing the various and specific regulatory positions and guidelines. The safety assuring method of CANDU reactors has been improved subatantially through these efforts, resulting in the improvement of regulatory system and procedure in Korea. However, the incident of heavy water leaks from Wolsong unit 3 in October 1999 and recently raised CANDU generic safety issues, such as feeder wall thinning, have motivated the need to re-emphasize the operational safety of CANDUs. As the necessity of improving and developing regulatory requirements, procedures, and technologies considering the design and operating characteristics of CANDUs was recognized, a need of a new mid-and long-term R and D program with an aim to develop and improve regulatory infrastructure such as legal system, generic regulatory requirements and technical standards for CANDUs was sought. The regulatory research programs for CANDUs were launched last August and the 1st phase of the project will go on to March 2002. The R and D program consists of four sub-programs; (i) development of regulatory requirments and technical standard, (ii) development of regulatory inspection manuals, (iii) development of performance indicators (PIs), and (iv) development of Safety Review Guides(SRGs). In this paper, the overview of the mid- and long-term regulatory R and D program for CANDU NPPs and its

  20. Implementation of a program of quality assurance of image in an imaging system of flat panel portal

    International Nuclear Information System (INIS)

    (IGRT) image-guided radiation therapy is the one in which images are used to locate the area of treatment. Modern irradiation systems are equipped with different modalities for obtaining images, such as flat panel systems, systems conebeam, tomoimagen, etc. This paper describes the start-up and the experience of a quality assurance program based on a flat panel portal Imaging System. (Author)

  1. Implementation of an integral program of quality assurance based on EPID to the IMRT

    International Nuclear Information System (INIS)

    We bring forward with this research the implementation of a procedure related to the assurance guaranty in the control of tue quality of IMRT treatment based on the technology of electronic portal images digital (EPID). For the sake of accomplishing quality controls, based in pylic digital images, we used like main tool the System of pylic digital images IviewGTTM with his application software. For the control of positioning of the multi-plates, we implemented a program in MATLAB, which yields the errors of positioning of the plates. For the dosimetric controls, the images obtained for the fields of treatment were climbed with the software ImageJ, and compared with the treatment planning systems (TPS) model Elekta's PrecisePlan® for it we used the software Verisoft. We managed to implement a comprehensive program of quality control for IMRT. The positioning errors of the multiplates intervening bayouth's test younger errors of positioning under a 1m threw which the requisite is for the IMRT. The rest of the geometric proofs yielded favorable results inmail with them tolerance, same as the test Picket Fence. We verified 2 cases with the technique step and shoot, for it we verified 16 field, where gamma Index varied 85,8 - 98,9. It was checked the possibility to accomplish the quality controls for IMRT using pylic digital images, in our case checked itself himself I apply the Linac Elekta specify on the Ameijeiras. (Author)

  2. LABORATORY AND FIELD AUDITS AS PART OF THE EPA (ENVIRONMENTAL PROTECTION AGENCY) HAZARDOUS WASTE ENGINEERING RESEARCH LABORATORY (HWERL) QUALITY ASSURANCE PROGRAM

    Science.gov (United States)

    Audits are an important and integral part of the EPA Hazardous Waste Engineering Research Laboratory (HWERL) Quality Assurance (QA) Program. As part of the overall QA program, audits are used to determine contractor compliance with quality assurance plans and to assess the overal...

  3. Illinois Breast and Cervical Cancer Program: Implementing Effective Public-Private Partnerships to Assure Population Health.

    Science.gov (United States)

    Handler, Arden S; Henderson, Vida A; Rosenfeld, Amy; Rankin, Kristin; Jones, Brenda; Issel, L Michele

    2015-01-01

    With the implementation of the Affordable Care Act (ACA), it is essential for the public health sector to elucidate its role with respect to its mission of assuring population health, and to clarify its role with respect to the private health care system. To that end, we examined the value added to the population health enterprise of successful public-private partnerships (PPPs) such as those found in the Illinois Breast and Cervical Cancer Program (IBCCP), the Centers for Disease Control and Prevention's (CDC's) National Breast and Cervical Cancer Early Detection Program (NBCCEDP) in Illinois. Key Informant (KI) interviews focused on IBCCP implementation were conducted with IBCCP lead agency (LA) program coordinators (n = 35/36) in winter 2012-2013. Analysis was conducted using Atlas.ti software. The KI interviews revealed the existence of highly developed PPPs between the IBCCP LAs and individual medical providers and hospitals across Illinois. The data suggest that the small amount of funding provided by IBCCP to each LA in Illinois has been used to build and sustain robust PPPs in the majority of the IBCCP communities. The PPPs developed through the IBCCP can be seen as an unplanned benefit of CDC's investment in breast and cervical health through the NBCCEDP. While the IBCCP/NBCCEDP might be considered a "boutique" categorical program which some may consider no longer necessary as individuals gain insurance under the ACA, the KI data underscore the critical role of public sector dollars, not only to serve individuals and communities directly but also to mobilize the private health care sector to act in partnership with public entities and become advocates for underserved communities. PMID:25470661

  4. Obtaining accreditation by the pharmacy compounding accreditation board, part 3: developing a program of qualtity assurance and continuous qualtiy improvement.

    Science.gov (United States)

    Cabaleiro, Joe

    2008-01-01

    Before a compounding pharmacy can receive accreditation from the Pharmacy Compounding Accreditation Board, the pharmacy must show evidence of both quality assurance activities and continuous quality improvement activities. Although quality assurance data gathering and monitoring can be integrated into pharmacy activities fairly easily, the coninuous quality improvement program may take a little more time and effort to implement . Before integrating these programs, compounding pharmacists must have a complete understanding of the differences between these two programs. Even if accreditation with the Pharmacy Compounding Accreditation Board is not being considered, it is important that compounding pharmacies have these two programs implemented. In the long run, it will pay off in higher quality services, error prevention, and perhaps greater efficiency of pharmacy operations. PMID:23969712

  5. Quality assurance of HDR prostate plans: Program implementation at a community hospital

    International Nuclear Information System (INIS)

    Adenocarcinoma of the prostate is currently the most commonly diagnosed cancer in men in the United States, and the second leading cause of cancer mortality. The utilization of radiation therapy is regarded as the definitive local therapy of choice for intermediate- and high-risk disease, in which there is increased risk for extracapsular extension, seminal vesicle invasion, or regional node involvement. High-dose-rate (HDR) brachytherapy is a logical treatment modality to deliver the boost dose to an external beam radiation therapy (EBRT) treatment to increase local control rates. From a treatment perspective, the utilization of a complicated treatment delivery system, the compressed time frame in which the procedure is performed, and the small number of large dose fractions make the implementation of a comprehensive quality assurance (QA) program imperative. One aspect of this program is the QA of the HDR treatment plan. Review of regulatory and medical physics professional publications shows that substantial general guidance is available. We provide some insight to the implementation of an HDR prostate plan program at a community hospital. One aspect addressed is the utilization of the low-dose-rate (LDR) planning system and the use of existing ultrasound image sets to familiarize the radiation therapy team with respect to acceptable HDR implant geometries. Additionally, the use of the LDR treatment planning system provided a means to prospectively determine the relationship between the treated isodose volume and the product of activity and time for the department's planning protocol prior to the first HDR implant. For the first 12 HDR prostate implants, the root-mean-square (RMS) deviation was 3.05% between the predicted product of activity and time vs. the actual plan values. Retrospective re-evaluation of the actual implant data reduced the RMS deviation to 2.36%

  6. National waste terminal storage repository in a bedded salt formation for spent unreprocessed fuel. Quality assurance program for licensing

    International Nuclear Information System (INIS)

    A National Waste Terminal Storage Repository, in bedded salt, for spent unreprocessed fuel is the subject of a conceptual design project which began in January 1977. This volume presents a preliminary quality assurance program to guide the license applicant in developing a detailed program that will be compatible with anticipated National Waste Terminal Storage (NWTSR2) contracting arrangements and provide the documentation required by regulatory bodies. This QA program is designed to provide confidence that the quality-related activities pertaining to safety-related structures, systems, and components will be identified and controlled. Specific responsibilities for quality-related activities are documented and assigned to personnel and organizations for the major phases of facility design and construction. These responsibilities encompass a broad range of activities and are addressed in this preliminary program. The quality assurance program elements are organized and discussed herein as follows: (1) quality assurance during design and construction; (2) the applicant (DOE); (3) siting contractor; (4) architect/engineer; (5) project field management; and (6) operations contractor

  7. Final Report Project Activity Task ORD-FY04-002 Nevada System of Higher Education Quality Assurance Program

    Energy Technology Data Exchange (ETDEWEB)

    Smiecinski, Amy; Keeler, Raymond; Bertoia, Julie; Mueller, Terry; Roosa, Morris; Roosa, Barbara

    2008-03-07

    The principal purpose of DOE Cooperative Agreement DE-FC28-04RW12232 is to develop and continue providing the public and the U.S. Department of Energy’s (DOE) Office of Civilian Radioactive Waste Management (OCRWM) with an independently derived, unbiased body of scientific and engineering data concerning the study of Yucca Mountain as a potential high-level radioactive waste repository. Under this agreement, the Nevada System of Higher Education (NSHE), formerly the University and Community College System of Nevada (UCCSN), performs scientific or engineering research, and maintains and fosters collaborative working relationships between government and academic researchers. In performing these activities, the NSHE has already developed and implemented a Quality Assurance (QA) program, which was accepted by the DOE Office of Quality Assurance, under the previous Cooperative Agreement Number DE-FC28-98NV12081. The following describes the objectives of Project Activity 002 “Quality Assurance Program” under cooperative agreement DE-FC28-04RW12232. The objective of this QA program was to assure that data produced under the cooperative agreement met the OCRWM QA Requirements and Description (QARD) requirements for quality-affecting (Q) data. The QA Program was written to address specific QARD requirements historically identified and incorporated in Q activities to the degree appropriate for the nature, scope, and complexity of the activity. Additional QARD requirements were integrated into the program when required to complete a specific activity. NSHE QA staff developed a detailed matrix to address each QARD element, identifying the applicable requirements and specifying where each requirement is addressed in the QA program procedures, or identify requirements as “not applicable” to the QA program. Controlled documents were prepared in the form of QA procedures (QAPs) and implementing procedures (IPs). NSHE identified new QAPs and IPs when needed. NSHE PIs

  8. Quality assurance program for determining the radioactivity in environmental samples at the Institute of Nuclear Energy Research in Taiwan

    International Nuclear Information System (INIS)

    Interest in determining radioactivity in environmental samples has increased considerably in recent years after the Chernobyl accident in 1986. Environmental monitoring programs have been set up in different countries to measure the trace amount of radionuclides in the environment, and quality of the analytical results on these samples is important because the regulation and safety concerns. A good quality assurance program is essential to provide accurate information for the regulatory body and environmentalists to set proper reactions to protect the environment, and a good analytical result is also important for scientists to determine the transfer of radionuclides between environmental matrices. The Institute of Nuclear Energy Research (lNER) in Taiwan has been working on radionuclide analysis in environmental samples for years, and it's environmental media radioanalytical laboratory (EMRAL) has recently upgraded its quality assurance program for the international standard ISO/lEC guide 25 requirements. The general requirements of lSO/lEC guide 25 has been adapted by the Chinese National Laboratory Accreditation (CNLA) of Taiwan, and CNLA is also a member of International Laboratory Accreditation Cooperation (ILAC) and Asia Pacific Laboratory Accreditation Cooperation (APLAC). This paper summarizes the quality assurance program of lNER's EMRAL. It covers both management and technical sections. These sections have ensured the quality of INER's EMRAL, and they can be applied to different laboratories in the future. (author)

  9. External quality-assurance programs managed by the U.S. Geological Survey in support of the National Atmospheric Deposition Program/National Trends Network

    Science.gov (United States)

    Latysh, Natalie E.; Wetherbee, Gregory A.

    2005-01-01

    The U.S. Geological Survey, Branch of Quality Systems, operates the external quality-assurance programs for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN). Beginning in 1978, six different programs have been implemented?the intersite-comparison program, the blind-audit program, the sample-handling evaluation program, the field-audit program, the interlaboratory-comparison program, and the collocated-sampler program. Each program was designed to measure error contributed by specific components in the data-collection process. The intersite-comparison program, which was discontinued in 2004, was designed to assess the accuracy and reliability of field pH and specific-conductance measurements made by site operators. The blind-audit and sample-handling evaluation programs, which also were discontinued in 2002 and 2004, respectively, assessed contamination that may result from sampling equipment and routine handling and processing of the wet-deposition samples. The field-audit program assesses the effects of sample handling, processing, and field exposure. The interlaboratory-comparison program evaluates bias and precision of analytical results produced by the contract laboratory for NADP, the Illinois State Water Survey, Central Analytical Laboratory, and compares its performance with the performance of international laboratories. The collocated-sampler program assesses the overall precision of wet-deposition data collected by NADP/NTN. This report documents historical operations and the operating procedures for each of these external quality-assurance programs. USGS quality-assurance information allows NADP/NTN data users to discern between actual environmental trends and inherent measurement variability.

  10. The quality assurance program data analysis for diagnostic radiology in government hospitals in southern provinces of Syria

    International Nuclear Information System (INIS)

    This study covered comprehensive evaluation for diagnostic radiography and fluorography equipment used in medicine by applying SAEC quality control rules. The results showed that most of considered x-ray equipment have an acceptable performance but few reached 21.6% in radiography and 36.8% in fluorography need repair and recalibration. Also recommendations and guidance for repair and preventative maintenance are required and quality assurance program should be applied in all diagnostic radiology institutions in Syria.(author)

  11. Implementation of a lung radiosurgery program: technical considerations and quality assurance in an Australian institution

    International Nuclear Information System (INIS)

    The Peter MacCallum Cancer Centre has established a stereotactic lung radiosurgery program for the treatment of isolated lung metastases. The aim of this study was to critically assess the technical feasibility of performing stereotactic lung radiosurgery in an Australian institution. A single 26-Gy fraction of radiotherapy was delivered to patients with positron emission tomography (PET) staged solitary lung metastases. Motion management was addressed using four-dimensional computed tomographic simulation, and cone beam CT (CBCT) online soft-tissue matching. Treatments were with multiple coplanar and non-coplanar asymmetric beams. Patients were immobilised in a dedicated stereotactic body cradle. Quality assurance (QA) of treatment plans with both ion chamber and film measurements was performed accounting for patient-specific respiratory motion. Between February 2010 and February 2011, nine patients received stereotactic lung radiosurgery. One grade 1 toxicity and one grade 2 toxicity were recorded after treatment. The mean planning target volume was 22.6 cc. A median of eight beams were delivered per treatment plan (range 7–10) with a median of two non-coplanar beams (range 0–6). At treatment plan QA, the difference between planned and delivered dose was ≤1.76% in all static and dynamic ion chamber recordings. A mid-treatment CBCT was performed at a median time of 21 min, with the mean displacement discrepancy from initial set-up being 0.4 mm (range 0–2 mm). Stereotactic radiosurgery to the lung was both feasible and tolerable at our institution. Intrafractional immobilisation within 2 mm was reproducible. Excellent concordance between planned and delivered treatments was achieved in the phantom QA.

  12. Implementation of a quality assurance program for computerized treatment planning systems according to TRS 430

    International Nuclear Information System (INIS)

    This work presents the guidelines and necessary tests tom implement a quality assurance program for Eclipse 7.3.10 from Varian at Hospital das Clinicas, Sao Paulo University School of Medicine - Brazil, in accordance with the new IAEA publication TRS 430. The recommended tests for the TRS 430 air mainly classified into acceptance tests, commissioning (dosimetric and non-dosimetric tests), and routine tests. The IAEA document's recommendations are being implemented at the hospital for two Varian linear accelerators - Clinac 600C e Clinac 2100C. The acceptance tests verified 'hardware', integration of network systems, data transfer and 'software' parameters. The results obtained are in a good agreement with the manufacturer's specifications. Measurements of absolute dose in several set-ups were made for the commissioning dosimetric tests. These data were compared to the absolute doses determined by the TPS. The great majority of the tests showed 90% to 80% of the analyzed data in acceptance levels, with a good agreement between the experimental data and the data determined by the TPS. Only settings with asymmetric fields presented significant discords, showing the need for a more detailed inquiry for these settings. The non-dosimetric commissioning tests have also presented excellent results, with virtually all the system tools and general performance in compliance with TRS 430. The acceptance criteria have been applied for a comparison between the values of MUs generated by TPS and the calculated manually ones. The beams have been characterized for Eclipse with data transferred from CadPlan and with data from recommissioning of accelerators, so for these tests it was found a difference of at least 3% for the conformal field shape for the data originated in the beams of recommissioning and at least 4% for the data proceeded from CadPlan. The tolerance level established by TRS 430 for this setting was 3%. (author)

  13. Experience in the implementation of quality assurance program and safety culture assessment of research reactor operation and maintenance

    International Nuclear Information System (INIS)

    The implementation of quality assurance program and safety culture for research reactor operation are of importance to assure its safety status. It comprises an assessment of the quality of both technical and organizational aspects involved in safety. The method for the assessment is based on judging the quality of fulfillment of a number of essential issues for safety i.e. through audit, interview and/or discussions with personnel and management in plant. However, special consideration should be given to the data processing regarding the fuzzy nature of the data i.e. in answering the questionnaire. To accommodate this situation, the SCAP, a computer program based on fuzzy logic for assessing plant safety status, has been developed. As a case study, the experience in the assessment of Kartini research reactor safety status shows that it is strongly related to the implementation of quality assurance program in reactor operation and awareness of reactor operation staffs to safety culture practice. It is also shown that the application of the fuzzy rule in assessing reactor safety status gives a more realistic result than the traditional approach. (author)

  14. The integrated performance evaluation program quality assurance guidance in support of EM environmental sampling and analysis activities

    International Nuclear Information System (INIS)

    EM's (DOE's Environmental Restoration and Waste Management) Integrated Performance Evaluation Program (IPEP) has the purpose of integrating information from existing PE programs with expanded QA activities to develop information about the quality of radiological, mixed waste, and hazardous environmental sample analyses provided by all laboratories supporting EM programs. The guidance addresses the goals of identifying specific PE sample programs and contacts, identifying specific requirements for participation in DOE's internal and external (regulatory) programs, identifying key issues relating to application and interpretation of PE materials for EM headquarters and field office managers, and providing technical guidance covering PE materials for site-specific activities. (PE) Performance Evaluation materials or samples are necessary for the quality assurance/control programs covering environmental data collection

  15. The implementation of quality assurance programs: basic aspect in nuclear plants management

    International Nuclear Information System (INIS)

    Experience in implementing and developing the Quality Assurance programme for the Almaraz nuclear power plant is briefly described. Almaraz was the first Spanish nuclear plant that had to apply specific Quality Assurance standards to its project and construction. The complexity of the project which was developed using standards in a continuous state of evolution, the large number of participating organizations and the numerous interrelationships between them, made the working methods required by the Quality Assurance standards a fundamental tool for establishing order within the framework of the projects, an essential requirement to achieve the objectives regarding costs, schedules and quality. The experience has shown that implementation of Quality Assurance programmes must be accomplished from the highest levels of management and must be thought of as being an essential management tool for achievement of the objectives established, and subjected to periodic revisions in order to check their effectiveness. This logically means that the scope of Quality Assurance must be extended to cover not only those aspects relating to safety but also all activities directly or indirectly affecting adequate operation of the plant, grading the requirements depending on several factors as impact on plant availability, costs of items, complexity of activities, etc. (author)

  16. Modality-dependent dose requirements in the Austrian breast cancer early detection program. First results from technical quality assurance

    International Nuclear Information System (INIS)

    The Austrian Breast Cancer Early Detection Program (BKFP) has officially started in January 2014. In order to ensure that all participating women can rely on a sufficient cancer detection rate while at the same time the required dose is as low as reasonably achievable, all participating radiology institutes (approx. 200) have to fulfill strict quality assurance requirements. The control and certification is performed by the Reference Center for Technical Quality Assurance (RefZQS), which has been developing the methods and tolerances in a pilot project since 2007. The limits are defined in the EUREF-Oeprotocol which is based on the European EPQC guidelines. From the requirement for optimized image quality while simultaneously following the ALARA principle, we found modality-dependent dose requirements, which we had expected but which have now been compiled for the first time for Austria.

  17. Independent oversight review of the Department of Energy Quality Assurance Program for suspect/counterfeit parts. Revision 1

    International Nuclear Information System (INIS)

    To address the potential threat that suspect/counterfeit parts could pose to DOE workers and the public, the Office of the Deputy Assistant Secretary for Oversight initiated a number of activities beginning in mid-1995. Oversight placed increased emphasis on the field's quality assurance-suspect/counterfeit parts programs during safety management evaluations, in keeping with the Office of Environment, Safety and Health (EH) oversight responsibilities, which include oversight of the Department's quality assurance (QA) programs. In addition, Oversight reviewed relevant policy documents and occurrence reports to determine the nature and magnitude of the problem within the Department. The results of that review, contained in an Office of Oversight report, Independent Oversight Analysis of Suspect/Counterfeit Parts Within the Department of Energy (November 1995), indicate a lack of consistency and comprehensiveness in the Department's QA-suspect/counterfeit parts program. A detailed analysis of the causes and impacts of the problem was recommended. In response, this review was initiated to determine the effectiveness of the Department's QA program for suspect/counterfeit parts. This study goes beyond merely assessing and reporting the status of the program, however. It is the authors intention to highlight the complex issues associated with suspect/counterfeit parts in the Department today and to present approaches that DOE managers might consider to address these issues

  18. Summary of development and recommendations for a quality assurance program for the procurement and manufacture of urban mass transit operating equipment and systems

    Science.gov (United States)

    Witkin, S. A.

    1976-01-01

    A viable quality program for the urban mass transit industry, and a management approach to ensure compliance with the program are outlined. Included are: (1) a set of guidelines for quality assurance to be imposed on transit authorities, and a management approach to ensure compliance with them; (2) a management approach to be used by the transit authorities (properties) for assuring compliance with the QA guidelines; and (3) quality assurance guidelines to be imposed by properties and umta for procurement of hardware and systems.

  19. 76 FR 26341 - Medicaid Program; Methods for Assuring Access to Covered Medicaid Services

    Science.gov (United States)

    2011-05-06

    ... payments are consistent with efficiency, economy, and quality of care and are sufficient to enlist enough... assure that payments are consistent with efficiency, economy, and quality of care and are sufficient to.... We are soliciting comments on this basic approach. It is important to note that, if adopted,...

  20. Quality assurance manual for the environmental survey and site assessment program, Oak Ridge Institute for Science and Education

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-03-21

    The purpose of this manual is to provide Program policy and oversight for the maintenance of Quality Assurance (QA) and Quality Control (QC) within the Environmental Survey and Site Assessment Program (ESSAP) of Oak Ridge Institute for Science and Education. This manual describes administrative systems, as well as specific quality control procedures, which apply to all functional groups in ESSAP. The sites surveyed under this program are primarily those where residual contamination from previous operations may pose a potential risk to the environment or to the health and safety of those in the immediate vicinity. Other major activities include environmental assessments, training related to decommissioning survey activities, effluent sampling and monitoring, special laboratory analyses, program appraisals and document reviews, consulting on environment-related topics, and technical assistance for guideline development. The methodology for performance of particular field and laboratory activities is presented in the ESSAP Survey Procedures Manual and the Laboratory Procedures Manual.

  1. Revitalizing quality assurance

    International Nuclear Information System (INIS)

    The image of someone inspecting or auditing often comes to mind when people hear the term quality assurance. Although partially correct, this image is not the complete picture. The person doing the inspecting or auditing is probably part of a traditional quality assurance organization, but that organization is only one aspect of a properly conceived and effectively implemented quality assurance system whose goal is improved facility safety and reliability. This paper introduces the underlying philosophies and basic concepts of the International Atomic Energy Agency's new quality assurance initiative that began in 1991 as part of a broad Agency-wide program to enhance nuclear safety. The first product of that initiative was publication in 1996 of a new Quality Assurance Code 50-C/SG-Q and fourteen related Safety Guides. This new suite of documents provide the technical and philosophical foundation upon which Member States can base their quality assurance programs. (author)

  2. Overview of the Quality Assurance Program Applied to the Performance Assessment of the Waste Isolation Pilot Plant

    International Nuclear Information System (INIS)

    The Waste Isolation Pilot Plant (WIPP) is the first deep geologic repository for radioactive waste disposal in the world to be certified by a regulator. Rigorous, nuclear-industry quality assurance (QA) requirements were imposed by the US Environmental Protection Agency. As the Scientific Advisor to the US Department of Energy, Sandia National Laboratories applied these standards to the experimental studies and performance assessment used in the certification process. The QA program ensured that activities conducted by SNL were traceable, transparent, reviewed, reproducible, and retrievable. As a result, regulators and stakeholders were able to evaluate and ultimately certify and accept the WIPP

  3. The development and implementation of a quality assurance program for manufacturing and support of international safeguards equipment

    International Nuclear Information System (INIS)

    This paper reports that safeguards equipment for nuclear facilities, such as the Modular Integrated Video System (MIVS) manufactured by Aquila Technologies Group, Inc., must operate reliably and unattended over long surveillance periods. To gain confidence in this reliability a comprehensive Quality Assurance Program (QAP) was established for production and acceptance operations. The guidelines for this QAP are contained in the Sandia National Laboratories procedure EP401418, Quality Program Requirements which is a part of the production contract. This procedure contains the nationally recognized elements of a production QA program including organization, specification control, manufacture control, calibration, procurement control, inspection, material control, training, quality record, auditing and performance reviews. Aquila has developed and implemented a comprehensive QAP for MIVS production and now is applied company wide for safeguards product

  4. Summary report of the Department of Energy, Division of Operational and Environmental Safety: Quality Assurance Programs 9 through 12

    International Nuclear Information System (INIS)

    Analaytical Laboratories which provide environmental monitoring data for assessment of radioactive contamination, under the Department of Energy (DOE) Contract, were requested to participate in a Quality Assurance Program. The Environmental Measurement Laboratory (EML) was asked to prepare intercomparison samples for radionuclide analysis of soil, water, air filters, tissue ash and vegetation ash for distribution to the Analytical Laboratories. Samples were collected in the environment of DOE facilities, since only water and air samples could be conveniently spiked. A set of 6 to 8 samples is distributed quarterly to 34 laboratories. EML performed multiple analyses on the samples, however, the results are considered intercomparisons, not standards. The program is summarized, and data for Quality Assessment Programs (QAP) 9 through 12 are evaluated

  5. Directory of certificates of compliance for radioactive materials packages: Report of NRC approved quality assurance programs for radioactive material packages

    International Nuclear Information System (INIS)

    This directory contains a Report of the US Nuclear Regulatory Commission's Approved Packages (Volume 1), all Certificates of Compliance (Volume 2), and a Report of NRC Approved Quality Assurance Programs (Volume 3) for Radioactive Material Packages effective October 1, 1988. The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the front of Volume 2 of the directory. A listing by packaging types is included in the back of Volume 2. An alphabetical listing by Company name is included in the back of Volume 3 for approved QA programs. The Reports include a listing of all users of each package design and approved QA programs prior to the publication date of the directory

  6. The Australian Quality Assurance and Continuing Education Program as a model for the reaccreditation of general practitioners in the United Kingdom.

    OpenAIRE

    Salisbury, C.

    1997-01-01

    A Quality Assurance and Continuing Education Program has been developed in Australian general practice over the past nine years. This effectively integrates audit and education within a coherent strategy for quality improvement. The programme fulfils many of the same aims as current proposals for reaccreditation in the United Kingdom (UK). This report describes the operation of the programme and an analysis of the effects of the scheme. A similar quality assurance strategy is proposed for the...

  7. Significance and organizational principles of the quality assurance program in nuclear medicine

    Energy Technology Data Exchange (ETDEWEB)

    Sushkevich, G.N.; Rakovyanu, N. (World Health Organization, Geneva (Switzerland))

    1985-01-01

    Consideration is being given to the problems related to the necessity of organization and functioning of the quality assuarance programme (QAP) at all levels of the public health system. The programme will enable the solution of such cardinal problems of nuclear medicine as improvement of diagnostic information quality, the use of the minimal radionuclide amount assuring the availability of necessary diagnostic information, effective use of all accessible resources (finances, equipment, personnel). Introduction of the QAP would result in decreasing radiation dose per patient as well as in the economic effect due to exclusion of repeated investigations. Attention is paid to the problems of the QAP organization.

  8. Significance and organizational principles of the quality assurance program in nuclear medicine

    International Nuclear Information System (INIS)

    Consideration is being given to the problems related to the necessity of organization and functioning of theq quality assuarance programme (QAP) at all levels of the public health system. The programme will enable to solve such cardinal problems of nuclear medicine as improvement of diagnostic information quality, the use of the minimal radionuclide amount assuring the availability of necessary diagnostic information, effective use of all accessible resources (finances, equipment, personel) Introduction of the QAP would result in dacreasning radiation dose per patient as well as in the economic effect due to exclusion of repeated investigations. Attention is paid to the problems of the QAP organization

  9. Technical position on items and activities in the high-level waste geologic repository program subject to quality assurance requirements

    International Nuclear Information System (INIS)

    This document provides guidance on how to identify items and activities subject to Quality Assurance in the high-level nuclear waste repository program for pre-closure and post-closure phases of the repository. In the pre-closure phase, structures, systems and components essential to the prevention or mitigation of an accident that could result in an off-site radiation dose of 0.5rem or greater are termed ''important to safety''. In the post-closure phase, the barriers which are relied on to meet the containment and isolation requirements are defined as ''important to waste isolation''. These structures, systems, components, and barriers, and the activities related to their characterization, design, construction, and operation are required to meet quality assurance (QA) criteria to provide confidence in the performance of the geologic repository. The list of structures, systems, and components important to safety and engineered barriers important to waste isolation is referred to as the ''Q-List'' and lies within the scope of the QA program. 10 refs

  10. External quality-assurance results for the National Atmospheric Deposition Program/National Trends Network, 2002-03

    Science.gov (United States)

    Wetherbee, Gregory A.; Latysh, Natalie E.; Burke, Kevin P.

    2005-01-01

    Six external quality-assurance programs were operated by the U.S. Geological Survey (USGS) External Quality-Assurance (QA) Project for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN) from 2002 through 2003. Each program measured specific components of the overall error inherent in NADP/NTN wet-deposition measurements. The intersite-comparison program assessed the variability and bias of pH and specific conductance determinations made by NADP/NTN site operators twice per year with respect to accuracy goals. The percentage of site operators that met the pH accuracy goals decreased from 92.0 percent in spring 2002 to 86.3 percent in spring 2003. In these same four intersite-comparison studies, the percentage of site operators that met the accuracy goals for specific conductance ranged from 94.4 to 97.5 percent. The blind-audit program and the sample-handling evaluation (SHE) program evaluated the effects of routine sample handling, processing, and shipping on the chemistry of weekly NADP/NTN samples. The blind-audit program data indicated that the variability introduced by sample handling might be environmentally significant to data users for sodium, potassium, chloride, and hydrogen ion concentrations during 2002. In 2003, the blind-audit program was modified and replaced by the SHE program. The SHE program was designed to control the effects of laboratory-analysis variability. The 2003 SHE data had less overall variability than the 2002 blind-audit data. The SHE data indicated that sample handling buffers the pH of the precipitation samples and, in turn, results in slightly lower conductivity. Otherwise, the SHE data provided error estimates that were not environmentally significant to data users. The field-audit program was designed to evaluate the effects of onsite exposure, sample handling, and shipping on the chemistry of NADP/NTN precipitation samples. Field-audit results indicated that exposure of NADP/NTN wet-deposition samples

  11. Quality assurance program on the individual monitory service of the Protection Radiology Laboratory of the Universidade Federal de Pernambuco, Recife, PE (Brazil): preliminary results

    International Nuclear Information System (INIS)

    The current stage of the quality assurance program on the individual monitoring service of the Protection Radiology Laboratory of the Universidade Federal de Pernambuco, Recife, PE (Brazil) is presented. The program emphasizes the personnel training and its development is focused to meet national and international standards requirements

  12. Results of the quality assurance testing program for radiopharmaceuticals 1982-1983

    International Nuclear Information System (INIS)

    The Australian Radiation Laboratory conducts a Radiopharmaceutical Quality Assurance Test Programme in which radiopharmaceuticals used in nuclear medicine in Australia are tested for compliance with specifications. The results of testing during 1982 and 1983 are summarised. Overall 144 batches of 27 different types of radiopharmaceutical were tested in 1982-83. Samples failed to meet specification in 17 of the 1150 tests performed. In all, failure to meet full specification was observed in 13 different types of radiopharmaceutical. No single radiopharmaceutical was responsible for more than 2 failures. Labelling errors accounted for 6/17 failures. Most other errors were of a minor nature and were due to the product being slightly outside specified limits. Of the 17 failures, 11 were associated with imported radiopharmaceuticals (86 batches tested) and 6 were associated with locally produced radiopharmaceuticals (58 batches tested). There is thus no significant difference in the failure rate of local and imported radiopharmaceuticals

  13. Methodology for establishing of a control and assurance program on a Radiology Department of a university hospital

    International Nuclear Information System (INIS)

    The purpose of this work is to present a proposal of a quality assurance program developed for a typical diagnostic radiology department of a University Hospital. The aim of this program is to reduce the number of films lost due to several kinds of problems, equipment malfunction, incorrect selection of the physical parameters of the X-ray equipment, poor conditions of the film ecrans and chassis, excessive temperature fluctuations on the processor, personnel training and organizational related aspects. The preliminary results shows that the main causes of problems are film overexposure, film under exposure, unexposed films taken back to the dark room, inadequate positioning of the film in the couch, inadequate positioning of the patient and the X-ray processor in addition to others of minor importance. It is very important to emphasize that the data acquisition methodology must contemplate a professional posture of respect for those involved in the procedures and as result of this one would expect their active participation in the program. As result of the first year of study, this program has demonstrated that the annual losses in the department studied are over US$ 125.000,00 and the goal of this program now is to reduce this figure to an acceptable number, US$40.000,00 a reasonable value for a large diagnostic radiology facility. (author). 6 refs., 4 figs

  14. Hanford Waste Vitrification Plant Quality Assurance Program description for high-level waste form development and qualification. Revision 3, Part 2

    Energy Technology Data Exchange (ETDEWEB)

    1993-08-01

    The Hanford Waste Vitrification Plant Project has been established to convert the high-level radioactive waste associated with nuclear defense production at the Hanford Site into a waste form suitable for disposal in a deep geologic repository. The Hanford Waste Vitrification Plant will mix processed radioactive waste with borosilicate material, then heat the mixture to its melting point (vitrification) to forin a glass-like substance that traps the radionuclides in the glass matrix upon cooling. The Hanford Waste Vitrification Plant Quality Assurance Program has been established to support the mission of the Hanford Waste Vitrification Plant. This Quality Assurance Program Description has been written to document the Hanford Waste Vitrification Plant Quality Assurance Program.

  15. Directory of certificates of compliance for radioactive materials packages. Volume 3, Revision 14: Report of NRC approved quality assurance programs for radioactive materials packages

    International Nuclear Information System (INIS)

    This directory contains a Report of NRC Approved Packages (Volume 1), Certificates of Compliance (Volume 2), and a Report of NRC Approved Quality Assurance Programs for Radioactive Materials Packages (Volume 3). The purpose of this directory is to make available a convenient source of information on Quality Assurance Programs and Packagings which have been approved by the US Nuclear Regulatory Commission. Shipments of radioactive material utilizing these packagings must be in accordance with the provisions of 49 CFR section 173.471 and 10 CFR Part 71, as applicable. In satisfying the requirements of Section 71.12, it is the responsibility of the licensees to insure themselves that they have a copy of the current approval and conduct their transportation activities in accordance with an NRC approved quality assurance program

  16. 10 CFR 71.37 - Quality assurance.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance. 71.37 Section 71.37 Energy NUCLEAR... Package Approval § 71.37 Quality assurance. (a) The applicant shall describe the quality assurance program... quality assurance program that are applicable to the particular package design under...

  17. Quality Assurance Through Reimbursement

    OpenAIRE

    Shaughnessy, Peter W.; Kurowski, Bettina

    1982-01-01

    Quality assurance and reimbursement programs normally function separately in the health care field. This paper reviews objectives and certain conceptual issues associated with each type of program. Its primary intent is to summarize substantive and operational topics which must be addressed if quality of care is to be enhanced through reimbursement. The focus is on methods for integrating quality assurance and reimbursement. The final section presents topics for future research.

  18. Quality Assurance Program: Argonne peer review activities for the salt host-rock portion of the Civilian Radioactive Waste Management Program

    International Nuclear Information System (INIS)

    This Quality Assurance (QA) Program sets forth the methods, controls, and procedures used to ensure that the results of Argonne National Laboratory's peer review activities are consistently of the highest quality and responsive to Salt Repository Project Office's needs and directives. Implementation of the QA procedures described herein establishes an operational framework so that task activities are traceable and the activities and decisions that influence the overall quality of the peer review process and results are fully documented. 56 refs., 5 figs., 6 tabs

  19. Need of patient-specific quality assurance and pre-treatment verification program for special plans in radiotherapy

    International Nuclear Information System (INIS)

    Accuracy in planned radiation dose delivery in cancer treatments becomes necessary in the advent of complex treatment delivery options with newer technology using medical linear accelerators, which makes patient management very crucial. Treatment outcome in an individual patient therefore depends on the professional involvement of staff and execution accuracy of planned procedure. Therefore, this article has addressed an important problem. International Atomic Energy Agency (IAEA) and International Commission on Radiological Protection (ICRP) reported mis-administrations of radiation dose, the nature of their occurrence and complexity of situations. Lack of adequate quality assurance (QA) program or failure in their routine applications, complacency in attention, lack of knowledge, overconfidence, pressures of time, lack of resources and failures in communication are some of the general human causes of errors. A recent report enumerated misadministration of radiation doses under the heading 'harming instead of healing' delivery of wrong doses in small field treatment plans with stereotactic equipment' was mostly highlighted

  20. MDEP VICWG-02 Technical Report - Survey on quality assurance program requirements

    International Nuclear Information System (INIS)

    The survey was prepared using the requirements of Appendix B to 10 CFR Part 50, 'Quality Assurance Criteria for Nuclear Power Plants and Fuel Reprocessing Plants'. These requirements form the basis upon which the U.S. NRC oversees the activities of vendors providing parts and services to the commercial U.S. nuclear power industry. As discussed and agreed to at the October 2008 Vendor Inspection Cooperation Working Group meeting in Dijon, France, the survey that follows was developed using these requirements. The survey is divided into the 18 basic criteria of Appendix B to 10 CFR Part 50. Within each criteria there are individual requirements that have been identified as separate and distinct elements that are covered during the inspection of vendor activities. In addition to the requirements of Appendix B to 10 CFR Part 50, the requirements of 10 CFR Part 21, 'Reporting of Defects and Non-compliance', have been listed at the end of the survey as an example of 'Other Requirements Related To Vendor Inspections', for the NRC. (authors)

  1. External quality-assurance results for the National Atmospheric Deposition Program and the National Trends Network during 1986

    Science.gov (United States)

    See, Randolph B.; Schroder, LeRoy J.; Willoughby, Timothy C.

    1988-01-01

    During 1986, the U.S. Geological Survey operated three programs to provide external quality-assurance monitoring of the National Atmospheric Deposition Program and National Trends Network. An intersite-comparison program was used to assess the accuracy of onsite pH and specific-conductance determinations at quarterly intervals. The blind-audit program was used to assess the effect of routine sample handling on the precision and bias of program and network wet-deposition data. Analytical results from four laboratories, which routinely analyze wet-deposition samples, were examined to determine if differences existed between laboratory analytical results and to provide estimates of the analytical precision of each laboratory. An average of 78 and 89 percent of the site operators participating in the intersite-comparison met the network goals for pH and specific conductance. A comparison of analytical values versus actual values for samples submitted as part of the blind-audit program indicated that analytical values were slightly but significantly (a = 0.01) larger than actual values for pH, magnesium, sodium, and sulfate; analytical values for specific conductance were slightly less than actual values. The decreased precision in the analyses of blind-audit samples when compared to interlaboratory studies indicates that a large amount of uncertainty in network deposition data may be a result of routine field operations. The results of the interlaboratory comparison study indicated that the magnitude of the difference between laboratory analyses was small for all analytes. Analyses of deionized, distilled water blanks by participating laboratories indicated that the laboratories had difficulty measuring analyte concentrations near their reported detection limits. (USGS)

  2. External quality-assurance results for the National Atmospheric Deposition Program / National Trends Network and Mercury Deposition Network, 2004

    Science.gov (United States)

    Wetherbee, Gregory A.; Latysh, Natalie E.; Greene, Shannon M.

    2006-01-01

    The U.S. Geological Survey (USGS) used five programs to provide external quality-assurance monitoring for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN) and two programs to provide external quality-assurance monitoring for the NADP/Mercury Deposition Network (NADP/MDN) during 2004. An intersite-comparison program was used to estimate accuracy and precision of field-measured pH and specific-conductance. The variability and bias of NADP/NTN data attributed to field exposure, sample handling and shipping, and laboratory chemical analysis were estimated using the sample-handling evaluation (SHE), field-audit, and interlaboratory-comparison programs. Overall variability of NADP/NTN data was estimated using a collocated-sampler program. Variability and bias of NADP/MDN data attributed to field exposure, sample handling and shipping, and laboratory chemical analysis were estimated using a system-blank program and an interlaboratory-comparison program. In two intersite-comparison studies, approximately 89 percent of NADP/NTN site operators met the pH measurement accuracy goals, and 94.7 to 97.1 percent of NADP/NTN site operators met the accuracy goals for specific conductance. Field chemistry measurements were discontinued by NADP at the end of 2004. As a result, the USGS intersite-comparison program also was discontinued at the end of 2004. Variability and bias in NADP/NTN data due to sample handling and shipping were estimated from paired-sample concentration differences and specific conductance differences obtained for the SHE program. Median absolute errors (MAEs) equal to less than 3 percent were indicated for all measured analytes except potassium and hydrogen ion. Positive bias was indicated for most of the measured analytes except for calcium, hydrogen ion and specific conductance. Negative bias for hydrogen ion and specific conductance indicated loss of hydrogen ion and decreased specific conductance from contact of the sample with

  3. Development of a Program on quality assurance in radiotherapy and radiology

    International Nuclear Information System (INIS)

    In this paper the development of a program of QA in radiotherapy and radiology is described. The objectives, resources, manpower and the cooperation between the IAEA and the Direccion General de Energia are outlined

  4. External quality-assurance results for the National Atmospheric Deposition Program/National Trends Network during 1991

    Science.gov (United States)

    Nilles, M.A.; Gordon, J.D.; Schroder, L.J.; Paulin, C.E.

    1995-01-01

    The U.S. Geological Survey used four programs in 1991 to provide external quality assurance for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN). An intersite-comparison program was used to evaluate onsite pH and specific-conductance determinations. The effects of routine sample handling, processing, and shipping of wet-deposition samples on analyte determinations and an estimated precision of analyte values and concentrations were evaluated in the blind-audit program. Differences between analytical results and an estimate of the analytical precision of four laboratories routinely measuring wet deposition were determined by an interlaboratory-comparison program. Overall precision estimates for the precipitation-monitoring system were determined for selected sites by a collocated-sampler program. Results of the intersite-comparison program indicated that 93 and 86 percent of the site operators met the NADP/NTN accuracy goal for pH determinations during the two intersite-comparison studies completed during 1991. The results also indicated that 96 and 97 percent of the site operators met the NADP/NTN accuracy goal for specific-conductance determinations during the two 1991 studies. The effects of routine sample handling, processing, and shipping, determined in the blind-audit program indicated significant positive bias (a=.O 1) for calcium, magnesium, sodium, potassium, chloride, nitrate, and sulfate. Significant negative bias (or=.01) was determined for hydrogen ion and specific conductance. Only ammonium determinations were not biased. A Kruskal-Wallis test indicated that there were no significant (*3t=.01) differences in analytical results from the four laboratories participating in the interlaboratory-comparison program. Results from the collocated-sampler program indicated the median relative error for cation concentration and deposition exceeded eight percent at most sites, whereas the median relative error for sample volume

  5. Design of the BENT dosimetry system and its application to a nationwide mammography quality assurance program

    International Nuclear Information System (INIS)

    The Bureau of Radiological Health has initiated a program called BENT (Breast Exposure: Nationwide Trends). The goal of this program is to assist the practitioner in obtaining diagnostic quality information for a reasonable dose to the patient. The program is designed to be a cooperative effort between the Bureau and State or local radiological health programs. After a State or local program agrees to participate in BENT, four phases are carried out. Phase one determines through a questionnaire which facilities in the State or local jurisdiction perform mammography. Phase two is a mail-out of dosimetry cards for exposure in each machine used for mammography. Phase three is a followup performed by State or local personnel at facilities flagged as being out of the norm by the phase two survey card. Phase four is a repeat of the phase two mail-out of dosimetry cards to determine the impact of the survey. Of particular importance to this paper are the phase two and four dosimetry cards and the phase three followup kit. The purpose of the card is to provide information on the entrance exposure, exit exposure, and beam quality characteristics of the x-ray unit for a craniocaudal view of a medium size, medium density breast. Included with the card is a disposable cardboard spacer used to raise the top of the card 6 cm above the image receptor to simulate the average entrance location of the breast

  6. On-board imaging commissioning and quality assurance program: ROV experience

    International Nuclear Information System (INIS)

    Currently, there have been no published recommendations and guidelines for a QA program to verify the functionality, accuracy, stability, and image quality of the radiographic mode of an on-board imaging (OBI) system. This paper evaluates a comprehensive QA program for the OBI system. Objective To generate and run a QA program for the OBI system and to summarize the results of these QA tests over extended periods from two Radiation Oncology Victoria (ROV) centers after implementing two new Rapid Arc machines with OBI capability. The radiographic mode of operation has been evaluated. The QA programs from the two centers have been generated through a series of tests for evaluating the performance of the On-Board Imager. Safety and functionality tests evaluate the functionality of safety features and the clinical operation of the entire system during the tube warm-up as show in the QA form. Geometry QA verifies the geometric accuracy and stability of the OBI hardware/software. Image quality QA monitors spatial resolution and contrast sensitivity of the radiographic images. All safety and functionality tests passed on a daily basis. Measurements of geometry QA tests showed stable results within tolerance throughout the test periods. Use of the tests over extended periods show that the OBI system has reliable mechanical accuracy and stable image quality. In this article we describe the procedures of test items included in the QA program and present the results of measurements over extended periods from the two ROV centers

  7. The role of radiologic technologist in radiation protection and quality assurance programs

    International Nuclear Information System (INIS)

    The most important sources of ionizing radiation for general public are medical sources. Good working protocols and radiological protections measurements provided significant reduction of patients and professional doses. Medical users of ionizing radiation are radiological technologists. The purpose of this paper is to point out to several facts and errors in radiation protection educational programs for radiological technologists. Medical College educational program covers main specific topics in radiation protection, but there are some omissions in training process. Radiological technologists must be actively involved in radiation protection. Following ethical standards they will reach higher standards than the law requires

  8. Quality assurance of analytical, scientific, and design computer programs for nuclear power plants

    International Nuclear Information System (INIS)

    This Standard applies to the design and development, modification, documentation, execution, and configuration management of computer programs used to perform analytical, scientific, and design computations during the design and analysis of safety-related nuclear power plant equipment, systems, structures, and components as identified by the owner. 2 figs

  9. 78 FR 12157 - RFS Renewable Identification Number (RIN) Quality Assurance Program

    Science.gov (United States)

    2013-02-21

    ... to the Definition and Treatment of Invalid RINs ] A. Export and Exporter Provisions 1. Exporter RVO 2....\\1\\ \\1\\ 75 FR 14670. The RFS program requires that specified volumes of renewable fuel be used as... percentage standards annually that apply to the sum of all gasoline and diesel produced or imported....

  10. 77 FR 14955 - DoD Information Assurance Scholarship Program (IASP)

    Science.gov (United States)

    2012-03-14

    ... procedures for recruiting students to meet service obligations through employment with a DoD Component upon graduation from their academic program. (C) Ensure that all students' academic eligibility is maintained... graduated students shall provide relevant, follow-on utilization of academic credentials in accordance...

  11. Initial experience with the installation and quality assurance program of the Philips SRI-100 digital portal imaging

    International Nuclear Information System (INIS)

    The Radiotherapy Department at Heidelberg Repatriation Hospital has purchased the first Digital Portal Imaging System (DPIS) in Australia. The DPIS has a demountable armature attached to a Philips SL15 6MV X-ray therapy unit. The SRI-100 captures images which can then be printed, stored or processed for image enhancement. The component sections of the DPIS are image detection, conversion, processing, control and display. All sections are made up from original equipment manufacturer modules that should provide for ease of access to spare parts and technical support. Computer control is provided from a Compaq 386-SX PC using DOS version 3.3 and a GEM desktop environment. The imaging software is user friendly and provides the operator with a comparatively easy environment in which to write dedicated image processing procedures as the need arises. The standard software provides a large number of image processing routines including filters, statistical functions, grey-scale manipulation and image housekeeping. A daily quality assurance (QA) program has been implemented using system software to check camera noise and image saturation, with a monthly imaging QA program using the RMI Portal Film Phantom. The systems strengths and weaknesses are discussed along with suggested hardware and software improvements and upgrades. 8 refs., 2 tabs., 7 figs

  12. Project quality assurance plan for research and development services provided by Oak Ridge National Laboratory in support of the Hanford Grout Disposal Program

    International Nuclear Information System (INIS)

    This Project Quality Assurance Plan (PQAP) is being published to provide the sponsor with referenceable documentation for work conducted in support of the Hanford WHC Grout Disposal Program. This plan, which meets NQA-1 requirements, is being applied to work performed at Oak Ridge National Laboratory (ORNL) during FY 1991 in support of this program. It should also be noted that with minor revisions, this plan should be applicable to other projects involving research and development that must comply with NQA-1 requirements

  13. Navy Radon Assessment and Mitigation Program: Work/quality assurance project plan screening phase

    International Nuclear Information System (INIS)

    In 1987, the military services of the United States were tasked to take appropriate action to establish an indoor radon assessment and mitigation program. As a result, the Naval Facilities Engineering Command (NAVFACENGCOM) was assigned the responsibility of identifying potential hazards to personnel from exposure to naturally occurring radon gas and prioritizing corrective actions and to coordinating these actions with the major claimants. NAVRAMP is based upon current US Environmental Protection Agency (EPA) guidelines. The program has been separated into four phases. The screening phase will concentrate on evaluating radon levels, based on statistical samples, in those buildings that have been determined to be at most at risk to elevated levels of radon, such as base housing, schools, day-care centers, hospitals, brigs, Base Officer Quarters, and Base Enlisted Quarters. During the assessment phase, every building that contains personnel for over 4 h/day will be evaluated. Mitigation work will be accomplished by Navy or Navy-contracted personnel. HAZWRAP services during the mitigation phase will consist of determining the extent of reduction in radon levels after the mitigation effort. 7 refs., 11 figs

  14. Development of a Reliability Program approach to assuring operational nuclear safety

    International Nuclear Information System (INIS)

    A Reliability Program (RP) model based on proven reliability techniques used in other high technology industries is being formulated for potential application in the nuclear power industry. Research findings are discussed. The reliability methods employed under NASA and military direction, commercial airline and related FAA programs were surveyed with several reliability concepts (e.g., quantitative reliability goals, reliability centered maintenance) appearing to be directly transferable. Other tasks in the RP development effort involved the benchmarking and evaluation of the existing nuclear regulations and practices relevant to safety/reliability integration. A review of current risk-dominant issues was also conducted using results from existing probabilistic risk assessment studies. The ongoing RP development tasks have concentrated on defining a RP for the operating phase of a nuclear plant's lifecycle. The RP approach incorporates safety systems risk/reliability analysis and performance monitoring activities with dedicated tasks that integrate these activities with operating, surveillance, and maintenance of the plant. The detection, root-cause evaluation and before-the-fact correction of incipient or actual systems failures as a mechanism for maintaining plant safety is a major objective of the RP

  15. External quality-assurance results for the national atmospheric deposition program/national trends network, 2000-2001

    Science.gov (United States)

    Wetherbee, Gregory A.; Latysh, Natalie E.; Gordon, John D.

    2004-01-01

    Five external quality-assurance programs were operated by the U.S. Geological Survey for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN) from 2000 through 2001 (study period): the intersite-comparison program, the blind-audit program, the field-audit program, the interlaboratory-comparison program, and the collocated-sampler program. Each program is designed to measure specific components of the total error inherent in NADP/NTN wet-deposition measurements. The intersite-comparison program assesses the variability and bias of pH and specific-conductance determinations made by NADP/NTN site operators with respect to accuracy goals. The accuracy goals are statistically based using the median of all of the measurements obtained for each of four intersite-comparison studies. The percentage of site operators responding on time that met the pH accuracy goals ranged from 84.2 to 90.5 percent. In these same four intersite-comparison studies, 88.9 to 99.0 percent of the site operators met the accuracy goals for specific conductance. The blind-audit program evaluates the effects of routine sample handling, processing, and shipping on the chemistry of weekly precipitation samples. The blind-audit data for the study period indicate that sample handling introduced a small amount of sulfate contamination and slight changes to hydrogen-ion content of the precipitation samples. The magnitudes of the paired differences are not environmentally significant to NADP/NTN data users. The field-audit program (also known as the 'field-blank program') was designed to measure the effects of field exposure, handling, and processing on the chemistry of NADP/NTN precipitation samples. The results indicate potential low-level contamination of NADP/NTN samples with calcium, ammonium, chloride, and nitrate. Less sodium contamination was detected by the field-audit data than in previous years. Statistical analysis of the paired differences shows that contaminant ions

  16. A workstation-integrated peer review quality assurance program: pilot study

    International Nuclear Information System (INIS)

    The surrogate indicator of radiological excellence that has become accepted is consistency of assessments between radiologists, and the technique that has become the standard for evaluating concordance is peer review. This study describes the results of a workstation-integrated peer review program in a busy outpatient radiology practice. Workstation-based peer review was performed using the software program Intelerad Peer Review. Cases for review were randomly chosen from those being actively reported. If an appropriate prior study was available, and if the reviewing radiologist and the original interpreting radiologist had not exceeded review targets, the case was scored using the modified RADPEER system. There were 2,241 cases randomly assigned for peer review. Of selected cases, 1,705 (76%) were interpreted. Reviewing radiologists agreed with prior reports in 99.1% of assessments. Positive feedback (score 0) was given in three cases (0.2%) and concordance (scores of 0 to 2) was assigned in 99.4%, similar to reported rates of 97.0% to 99.8%. Clinically significant discrepancies (scores of 3 or 4) were identified in 10 cases (0.6%). Eighty-eight percent of reviewed radiologists found the reviews worthwhile, 79% found scores appropriate, and 65% felt feedback was appropriate. Two-thirds of radiologists found case rounds discussing significant discrepancies to be valuable. The workstation-based computerized peer review process used in this pilot project was seamlessly incorporated into the normal workday and met most criteria for an ideal peer review system. Clinically significant discrepancies were identified in 0.6% of cases, similar to published outcomes using the RADPEER system. Reviewed radiologists felt the process was worthwhile

  17. Preliminary results of a program of quality assurance applied to the image service of a public hospital

    International Nuclear Information System (INIS)

    Overall quality in radiological protection and medical image depend largely on keeping certain safety standards and technical procedures in good levels. In this way, in June 1998, the Ministry of Health published the document 453 - Guidelines of Radiological Protection to Medical and Dental Practices, defining different levels of actions and responsibility for radiological installation where the critical starting point was the necessity of a previous quality assurance program (QAP) into the radiological service. Preliminary results of a QAP realized in the Department of Radiology of a high complexity Hospital in Rio de Janeiro has showed that, although the importance of 453 Regulation be recognized, there is a few motivation for implementing it. Besides, during 1999 it was possible to identify film losses of 14,9 % related only to the repetition of exposures in the patients, reflecting in terms of cost about U$ 100,000 a year. Results suggest that losses of 64% of total film are due to under or over exposures and 15% are due to inadequate positioning of either film or patient, evidencing the need for training the technical and medical staff . (author)

  18. Implementation of a Quality Assurance Program in a new Radiotherapy Center taking as base the TG-40

    International Nuclear Information System (INIS)

    The recommended principles in the 'Comprehensive QA for radiation oncology: Report of AAPM Radiation Therapy Committee Task Group 40', TG-40, have been the base for implementation of the Quality Assurance Program of a modern Radiotherapy service. During its application has been necessary: to initiate its implementation before the equipment installation, assuming the costs of the contracts of the qualified personnel, realizing an initial investment adequate for equipment acquisition necessary for acceptation, commissioning and routinary control, the experienced formation of the personnel in the protocol philosophy, establishing procedures for day by day process which would allow the retrofeeding, the elaboration of templates and opening to changes and adjustments according to the necessities. The experience of two years had been demonstrated that the TG-40: a) It is feasible to be implemented but sometimes no strict totally and it is essential to have qualified personnel and the necessary material resources; b) It does not contains all the necessary for its practical implementation and must be completing with procedures and routine formats which facilitate their application; c) It allows the detection and opportune failure correction in the process; d) It is a continuous process that does not finishes. (Author)

  19. Trend analysis and data evaluation report BPMD quality assurance program: July 1, 1986--June 30, 1987

    International Nuclear Information System (INIS)

    This report contains a trend analysis and other evaluation of data conducted on deficiency and corrective action data collected during the period of July 1, 1986, through June 30, 1987. The data collected form Audit Action Reports, Management and Contractor Corrective Action Requests, and Deficiency Notices were evaluated to identify whether adverse quality trends were developing. An evaluation of quality trend data identified a suspected adverse condition related to an apparently high incidence of deficiencies related to NQA-1 Requirements for instructions, Procedures, and Drawings for BPMD contractor and DOE prime and integrated QA programs. Further evaluation of the data indicated that no adverse quality trend appears to exist; multiple deficiency reports were issued for the same system problem. This skewed the data, indicating a higher level of incidence of a deficiency type than actually existed. The Corrective Action Tracking System, now being developed, will provide management with real time comparison of trend data for use in reducing the possibility for the multiple reporting of the same deficiency. Although the average closure time for DOE prime and integrated contractor deficiencies is 235 days, the data in Figure A-6 indicates an improvement (reduction) in the closure time. As the timeliness of corrective action is impacted by how long deficiencies remain open, deficiency closure performance will be monitored during the next reporting period. 15 figs

  20. Quality assurance program of a respiratory gating irradiation system based on external and internal fiducial markers

    International Nuclear Information System (INIS)

    Respiratory Gating involves the administration of radiation during treatment delivery within a particular portion of the patients breathing cycle, so the absorbed dose administration with respiratory control techniques requires specific quality control to ensure the correctness of the delivered dose. The establishment of a Quality Control Program (QC) is proposed for the Respiratory Gating based techniques in order to have a better understanding of how this system works and to know its associated dosimetric impact. The influence of the CT acquisition under respiratory motion conditions has been analyzed for the treatment isocenter localization, using internal and external fiducial markers with IGRT techniques that allow the correlation of the isocenter positioning with the phase of the respiratory cycle. Radiation delivery in the presence of intra fraction organ motion causes an averaging or blurring of the static dose distribution over the path of motion increasing the beam penumbra of the radiation field and reducing the therapeutic region when the irradiation is not breath controlled. The feasibility of intensity modulated treatments (IMRT) for both static and dynamic techniques, managed by respiratory control has been tested, demonstrating the possibility of synchronizing the movement of the leaves in the microfluorimeter collimator (mMLC) with the gated beam irradiation. (Author) 45 refs.

  1. Quality assurance/quality control summary report for Phase 1 of the Clinch River remedial investigation. Environmental Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    Holladay, S.K.; Bevelhimer, M.S.; Brandt, C.C. [and others

    1994-07-01

    The Clinch River Remedial Investigation (CRRI) is designed to address the transport, fate, and distribution of waterborne contaminants released from the US Department of Energy Oak Ridge Reservation and to assess potential risks to human health and the environment associated with these contaminants. Primary areas of investigation are Melton Hill Reservoir, the Clinch River from Melton Hill Dam to its confluence with the Tennessee River, Poplar Creek, and Watts Bar Reservoir. Phase 1 of the CRRI was a preliminary study in selected areas of the Clinch River/Watts Bar Reservoir. Fish, sediment, and water samples were collected and analyzed for inorganic, organic, and radiological parameters. Phase 1 was designed to (1) obtain high-quality data to confirm existing historical data for contaminant levels; (2) determine the range of contaminant concentrations present in the river-reservoir system; (3) identify specific contaminants of concern; and (4) establish the reference (background) concentrations for those contaminants. Quality assurance (QA) objectives for Phase I were that (1) scientific data generated would withstand scientific scrutiny; (2) data would be gathered using appropriate procedures for field sampling, chain-of-custody, laboratory analyses, and data reporting; and (3) data would be of known precision and accuracy. These objectives were met through the development and implementation of (1) a QA oversight program of audits and surveillances; (2) standard operating procedures accompanied by a training program; (3) field sampling and analytical laboratory quality control requirements; (4) data and records management systems; and (5) validation of the data by an independent reviewer. Approximately 1700 inorganic samples, 1500 organic samples, and 2200 radiological samples were analyzed and validated. The QA completeness objective for the project was to obtain valid analytical results for at least 95% of the samples collected.

  2. A quality-assurance assessment for constituents reported by the National Atmospheric Deposition Program and the National Trends Network

    Science.gov (United States)

    See, R.B.; Schroder, L.J.; Willoughby, T.C.

    1989-01-01

    A continuing quality-assurance program has been operated by the U.S. Geographical Survey to evaluate any bias introduced by routine handling, shipping, and laboratory analyses of wet-deposition samples collected in the National Atmospheric Deposition Program (NADP) and National Trends Network (NTN). Blind-audit samples having a variety of constituent concentrations and values were selected. Only blind-audit samples with constituent concentrations and values less than the 95th-percentile concentration for natural wet-deposition samples were included in the analysis. Of the major ions, there was a significant increase of Ca2+, Mg2+, K+ SO42+ and Cl- in samples handled according to standard protocols and shipped in NADP/NTN sample-collection buckets. For 1979-1987, graphs of smoothed data showing the estimated contaminations in blind-audit samples indicate a decrease in the median concentration and ranges of Ca2+, Mg2+ and SO42- contamination of blind-audit samples shipped in sample-collection buckets. Part of the contamination detected in blind-audit samples can be attributed to contact with the sample-collection bucket and lid; however, additional sources also seem to contaminate the blind-audit sample. Apparent decreases in the magnitude and range of sample contamination may be caused by differences in sample-collection bucket- and lid-washing procedures by the NADP/NTN Central Analytical Laboratory. Although the degree of bias is minimal for most constituents, summaries of the NADP/NTN data base may contain overestimates of Ca2+, Mg2+, Na-, K+, SO42- and Cl- concentrations, and underestimates of H+ concentrations.

  3. Central online quality assurance in radiology. An IT solution exemplified by the German Breast Cancer Screening Program

    International Nuclear Information System (INIS)

    Purpose: Physical-technical quality assurance is one of the essential tasks of the National Reference Centers in the German Breast Cancer Screening Program. For this purpose the mammography units are required to transfer the measured values of the constancy tests on a daily basis and all phantom images created for this purpose on a weekly basis to the reference centers. This is a serious logistical challenge. To meet these requirements, we developed an innovative software tool. Materials and Methods: By the end of 2005, we had already developed web-based software (MammoControl) allowing the transmission of constancy test results via entry forms. For automatic analysis and transmission of the phantom images, we then introduced an extension (MammoControl DIANA). This was based on Java, Java Web Start, the NetBeans Rich Client Platform, the Pixelmed Java DICOM Toolkit and the ImageJ library. Results: MammoControl DIANA was designed to run locally in the mammography units. This allows automated on-site image analysis. Both results and compressed images can then be transmitted to the reference center. We developed analysis modules for the daily and monthly consistency tests and additionally for a homogeneity test. Conclusion: The software we developed facilitates the immediate availability of measurement results, phantom images, and DICOM header data in all reference centers. This allows both targeted guidance and short response time in the case of errors. We achieved a consistent IT-based evaluation with standardized tools for the entire screening program in Germany. (orig.)

  4. Quality assurance/quality control summary report for Phase 1 of the Clinch River remedial investigation. Environmental Restoration Program

    International Nuclear Information System (INIS)

    The Clinch River Remedial Investigation (CRRI) is designed to address the transport, fate, and distribution of waterborne contaminants released from the US Department of Energy Oak Ridge Reservation and to assess potential risks to human health and the environment associated with these contaminants. Primary areas of investigation are Melton Hill Reservoir, the Clinch River from Melton Hill Dam to its confluence with the Tennessee River, Poplar Creek, and Watts Bar Reservoir. Phase 1 of the CRRI was a preliminary study in selected areas of the Clinch River/Watts Bar Reservoir. Fish, sediment, and water samples were collected and analyzed for inorganic, organic, and radiological parameters. Phase 1 was designed to (1) obtain high-quality data to confirm existing historical data for contaminant levels; (2) determine the range of contaminant concentrations present in the river-reservoir system; (3) identify specific contaminants of concern; and (4) establish the reference (background) concentrations for those contaminants. Quality assurance (QA) objectives for Phase I were that (1) scientific data generated would withstand scientific scrutiny; (2) data would be gathered using appropriate procedures for field sampling, chain-of-custody, laboratory analyses, and data reporting; and (3) data would be of known precision and accuracy. These objectives were met through the development and implementation of (1) a QA oversight program of audits and surveillances; (2) standard operating procedures accompanied by a training program; (3) field sampling and analytical laboratory quality control requirements; (4) data and records management systems; and (5) validation of the data by an independent reviewer. Approximately 1700 inorganic samples, 1500 organic samples, and 2200 radiological samples were analyzed and validated. The QA completeness objective for the project was to obtain valid analytical results for at least 95% of the samples collected

  5. QA [Quality Assurance] role in advanced energy activities: Towards an /open quotes/orthodox/close quotes/ Quality Program: Canonizing the traditions at Fermilab

    International Nuclear Information System (INIS)

    After a brief description of the goal of Fermi National Accelerator Laboratory (Fermilab) this paper poses and answers three questions related to Quality Assurance (QA) at the Laboratory. First, what is the difference between 'orthodox' and 'unorthodox' QA and is there a place for 'orthodox' QA at a laboratory like Fermilab? Second, are the deeper philosophical and cultural frameworks of high-energy physics acommodating or antagonistic to an 'orthodox' QA Program? Finally, faced with the task of developing an institutional QA program for Fermilab where does one begin? The paper is based on experience with the on-going development and implementation of an institutional QA Program at Fermilab. 10 refs

  6. Directory of certificates of compliance for radioactive materials packages: Summary report of NRC approved quality assurance programs for radioactive material packages

    International Nuclear Information System (INIS)

    This directory contains a Summary Report of the US Nuclear Regulatory Commission's Summary Report of NRC Approved Quality Assurance Programs (Volume 3) for Radioactive Material Packages effective October 1, 1987. This directory makes available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an alphabetical listing by Company name is included in the back of Volume 3 for approved QA programs. The Summary Reports include a listing of all users of each package design and approved QA programs prior to the publication date of the directory

  7. Programs and analytical methods for the U.S. Geological Survey acid-rain quality-assurance project. Water Resources Investigation

    International Nuclear Information System (INIS)

    The U.S. Geological Survey operates four programs to provide external quality-assurance of wet deposition monitoring by the National Atmospheric Deposition Program and the National Trends Network. An intersite-comparison program assesses the precision and bias of onsite determinations of pH and specific conductance made by site operators. A blind-audit program is used to assess the effect of routine sample-handling procedures and transportation on the precision and bias of wet-deposition data. An interlaboratory-comparison program is used to assess analytical results from three or more laboratories, which routinely analyze wet-deposition samples from the major North American networks, to determine if comparability exists between laboratory analytical results and to provide estimates of the analytical precision of each laboratory. A collocated-sampler program is used to estimate the precision of wet/dry precipitation sampling throughout the National Atmospheric Deposition Program and the National Trends Network, to assess the variability of diverse spatial arrays, and to evaluate the impact of violations of specific site criteria. The report documents the procedures and analytical methods used in these four quality-assurance programs

  8. Design and implementation of a quality assurance program for gamma cameras; Diseno e implementacion de un programa de aseguramiento de calidad para camaras gamma

    Energy Technology Data Exchange (ETDEWEB)

    Montoya M, A.; Rodriguez L, A. [Instituto Nacional de Cancerologia, Departamento de Medicina Nuclear, Av. San Fernando No. 22, Col. Seccion XVI, 14080 Mexico D. F. (Mexico); Trujillo Z, F. E., E-mail: montoya-moreno@hotmail.co [Hospital Regional de Alta Especialidad de Oaxaca, Area de Fisica Medica, Aldama s/n, Paraje El Tule, 71256 San Bartolo Coyotepec, Oaxaca (Mexico)

    2010-09-15

    In nuclear medicine more than 90% of the carried out procedures are diagnostic. To assure an appropriate diagnostic quality of the images and the doses optimization received by the patients originated in the radioactive material, it is indispensable the periodic surveillance of the operation and performance of the equipment s by means of quality assurance tests. This work presents a proposal of a quality assurance program for gamma cameras based on recommendations of the IAEA, the American Association of Medical Physics and the National Electrical Manufacturers Association. Some tests of the program were applied to an e.cam gamma camera (Siemens) of the Nuclear Medicine Department of the National Institute of Cancer. The intrinsic and extrinsic uniformity, the intrinsic spatial resolution and the extrinsic sensibility were verified. For intrinsic uniformity the average daily values of the integral uniformity and differential uniformity in the useful vision field were 2.61% and 1.58% respectively, the average monthly values of intrinsic uniformity for the integral and differential uniformity in the useful vision field were 4.10% and 1.66% respectively. The used acceptance criterions were respectively of 3.74% and 2.74%. The average values of extrinsic uniformity for the useful vision field were of 7.65% (intrinsic uniformity) and 2.69% (extrinsic uniformity), in this case the acceptance criterion is a value of 6.00%. The average value of intrinsic spatial resolution went 4.67 mm superior to 4.4. mm that is the acceptance limit. Finally, maximum variations of 1.8% were observed (minors than 2% that is the acceptance criterion) for the extrinsic sensibility measured in different regions of the detector. Significant variations of extrinsic sensibility were not observed among the monthly lectures. Of the realized measurements was concluded that the system requires of a maintenance service by part of the manufacturer, which one carries out later on to this work. The

  9. Quality assurance program manual for nuclear power plants. Volume I. Policies. Volume II. Procedures for design and construction. Volume III. Procedures for operations

    International Nuclear Information System (INIS)

    A manual is presented which outlines the actions that are implemented by Consumers Power Company personnel during design, procurement, construction, fueling, testing, operation, refueling, maintenance, repair and modification of its nuclear power plants. The program complies with the quality assurance requirements contained in Appendix B of 10 CFR 50, and responds to the additional requirements and guidance contained in NRC Regulatory Guides and the ANSI series of Standards related to design, construction, and operation of nuclear power plants. (U.S.)

  10. A Comprehensive Quality Assurance Program for Personnel and Procedures in Radiation Oncology: Value of Voluntary Error Reporting and Checklists

    International Nuclear Information System (INIS)

    Purpose: This report describes the value of a voluntary error reporting system and the impact of a series of quality assurance (QA) measures including checklists and timeouts on reported error rates in patients receiving radiation therapy. Methods and Materials: A voluntary error reporting system was instituted with the goal of recording errors, analyzing their clinical impact, and guiding the implementation of targeted QA measures. In response to errors committed in relation to treatment of the wrong patient, wrong treatment site, and wrong dose, a novel initiative involving the use of checklists and timeouts for all staff was implemented. The impact of these and other QA initiatives was analyzed. Results: From 2001 to 2011, a total of 256 errors in 139 patients after 284,810 external radiation treatments (0.09% per treatment) were recorded in our voluntary error database. The incidence of errors related to patient/tumor site, treatment planning/data transfer, and patient setup/treatment delivery was 9%, 40.2%, and 50.8%, respectively. The compliance rate for the checklists and timeouts initiative was 97% (P<.001). These and other QA measures resulted in a significant reduction in many categories of errors. The introduction of checklists and timeouts has been successful in eliminating errors related to wrong patient, wrong site, and wrong dose. Conclusions: A comprehensive QA program that regularly monitors staff compliance together with a robust voluntary error reporting system can reduce or eliminate errors that could result in serious patient injury. We recommend the adoption of these relatively simple QA initiatives including the use of checklists and timeouts for all staff to improve the safety of patients undergoing radiation therapy in the modern era

  11. Quality assurance program in the External dosimetry laboratory of the CPHR; Programa de aseguramiento de la calidad en el laboratorio de dosimetria externa del CPHR

    Energy Technology Data Exchange (ETDEWEB)

    Molina P, D.; Pernas S, R.; Martinez H, E.; Cardenas H, J. [Centro de Proteccion e Higiene de las Radiaciones, Calle 20 No. 4113 e/41 y 47. Playa, C.P. 11300, A.P. 6195, C.P. 10600 La Habana (Cuba)

    2006-07-01

    From 1999 the Laboratory of External Dosimetry of the Radiation Protection and Hygiene Center comes applying in its service of personal dosimetry a Program of Quality Assurance. This program was designed according to the recommendations of national and international organizations as the National Assuring Office of the Republic of Cuba (ONARC), the International Standards Organization (ISO), the International Electro technique Commission (IEC) and the International Atomic Energy Agency (IAEA). In this work it is presented in a summarized way the operation of this Program of Quality Assurance which includes the administration and conservation of the results and the documentation of the service, the controls that are carried out to the equipment, the acceptance tests that are applied to the equipment and new dosemeters, the shipment and prosecution of the dosemeters, the evaluation, storage and conservation of the doses, the report of the results, the traceability and reproducibility of the measurements, the attention to the reclamations and the clients complaints and the internal and external audits to those that it undergoes periodically the laboratory. (Author)

  12. Financial assurances

    International Nuclear Information System (INIS)

    US Ecology is a full service waste management company. The company operates two of the nation's three existing low-level radioactive waste (LLRW) disposal facilities and has prepared and submitted license applications for two new LLRW disposal facilities in California and Nebraska. The issue of financial assurances is an important aspect of site development and operation. Proper financial assurances help to insure that uninterrupted operation, closure and monitoring of a facility will be maintained throughout the project's life. Unfortunately, this aspect of licensing is not like others where you can gauge acceptance by examining approved computer codes, site performance standards or applying specific technical formulas. There is not a standard financial assurance plan. Each site should develop its requirements based upon the conditions of the site, type of design, existing state or federal controls, and realistic assessments of future financial needs. Financial assurances at U.S. Ecology's existing sites in Richland, Washington, and Beatty, Nevada, have been in place for several years and are accomplished in a variety of ways by the use of corporate guarantees, corporate capital funds, third party liability insurance, and post closure/long-term care funds. In addressing financial assurances, one can divide the issue into three areas: Site development/operations, third party damages, and long-term care/cleanup

  13. Flow assurance

    Energy Technology Data Exchange (ETDEWEB)

    Mullins, O.C.; Dong, C. [Schlumberger-Doll Research Center, Cambridge, MA (United States); Elshahawi, H. [Shell Exploration and Production Company, The Hague (Netherlands)

    2008-07-01

    This study emphasized the need for considering flow assurance for producing oil and gas, particularly in high cost areas such as deepwater. Phase behaviour studies, sticking propensities, and interfacial interactions have been investigated in many laboratory studies using asphaltenes, wax, hydrates, organic and inorganic scale, and even diamondoids. However, the spatial variation of reservoir fluids has received little attention, despite the fact that it is one of the most important factors affecting flow assurance. This issue was difficult to address in a systematic way in the past because of cost constraints. Today, reservoir fluid variation and flow assurance can be considered at the outset of a project given the technological advances in downhole fluid analysis. This study described the origins of reservoir fluid compositional variations and the controversies surrounding them. It also described the indispensable chemical analytical technology. The impact of these reservoir fluid compositional variations on flow assurance considerations was also discussed. A methodology that accounts for these variations at the outset in flow assurance evaluation was also presented.

  14. The quality assurance liaison: Combined technical and quality assurance support

    International Nuclear Information System (INIS)

    This paper describes the role of the quality assurance liaison, the responsibilities of this position, and the evolutionary changes in duties over the last six years. The role of the quality assurance liaison has had a very positive impact on the Los Alamos Yucca Mountain Site Characterization (YW) quality assurance program. Having both technical and quality assurance expertise, the quality assurance liaisons are able to facilitate communications with scientists on quality assurance issues and requirements, thereby generating greater productivity in scientific investigations. The quality assurance liaisons help ensure that the scientific community knows and implements existing requirements, is aware of new or changing regulations, and is able to conduct scientific work within Project requirements. The influence of the role of the quality assurance liaison can be measured by an overall improvement in attitude of the staff regarding quality assurance requirements and improved job performance, as well as a decrease in deficiencies identified during both internal and external audits and surveillances. This has resulted in a more effective implementation of quality assurance requirements

  15. The quality assurance liaison: Combined technical and quality assurance support

    Science.gov (United States)

    Bolivar, S. L.; Day, J. L.

    1993-03-01

    The role of the quality assurance liaison, the responsibilities of this position, and the evolutionary changes in duties over the last six years are described. The role of the quality assurance liaison has had a very positive impact on the Los Alamos Yucca Mountain Site Characterization (YW) quality assurance program. Having both technical and quality assurance expertise, the quality assurance liaisons are able to facilitate communications with scientists on quality assurance issues and requirements, thereby generating greater productivity in scientific investigations. The quality assurance liaisons help ensure that the scientific community knows and implements existing requirements, is aware of new or changing regulations, and is able to conduct scientific work within Project requirements. The influence of the role of the quality assurance liaison can be measured by an overall improvement in attitude of the staff regarding quality assurance requirements and improved job performance, as well as a decrease in deficiencies identified during both internal and external audits and surveillances. This has resulted in a more effective implementation of quality assurance requirements.

  16. Integrating quality assurance and research and development

    International Nuclear Information System (INIS)

    Quality assurance programs cannot be transferred from one organization to another without attention to existing cultures and traditions. Introduction of quality assurance programs constitutes a significant change and represents a significant impact on the organizational structure and operational mode. Quality assurance professionals are change agents, but do not know how to be effective ones. Quality assurance as a body of knowledge and experience can only become accepted when its practitioners become familiar with their role as change agents. 8 references

  17. SU-C-BRD-01: Multi-Centre Collaborative Quality Assurance Program for IMRT Planning and Delivery: Year 3 Results

    International Nuclear Information System (INIS)

    Purpose: A multi-centre quality assurance program was developed to enable quality improvement by coupling measurement of intensity modulated radiotherapy (IMRT) planning and delivery performance for site-specific planning exercises with diagnostic testing. The third year of the program specifically assessed the quality of spine stereotactic body radiotherapy (SBRT) planning and delivery amongst the participating centres. Methods: A spine SBRT planning exercise (24 Gy in 2 fractions) was created and completed by participants prior to an on-site visit. The delivery portion of the on-site visit included spine SBRT plan delivery and diagnostic testing, which included portal image acquisition for quantification of phantom positioning error and multi-leaf collimator (MLC) calibration accuracy. The measured dose was compared to that calculated in the treatment planning system (TPS) using 3%/2mm composite analysis and 3%/3mm gamma analysis. Results: Fourteen institutions participated, creating 17 spine SBRT plans (15 VMAT and 2 IMRT). Three different TPS, two beam energies (6 MV and 6 MV FFF), and four MLC designs from two linac vendors were tested. Large variation in total monitor units (MU) per plan (2494–6462 MU) and dose-volume parameters was observed. The maximum point dose in the plans ranged from 116–149% and was dependent upon the TPS used. Pass rates for measured to planned dose comparison ranged from 89.4–100% and 97.3–100% for 3%/2mm and 3%/3mm criteria respectively. The largest measured MLC error did Result in one of the poorer pass rates. No direct correlation between phantom positioning error and pass rates overall. Conclusion: Significant differences were observed in the planning exercise for some plan and dose-volume parameters based on the TPS used. Standard evaluation criteria showed good agreement between planned and measured dose for all participants, however on an individual plan basis, diagnostic tests were able to identify contributing

  18. SU-C-BRD-01: Multi-Centre Collaborative Quality Assurance Program for IMRT Planning and Delivery: Year 3 Results

    Energy Technology Data Exchange (ETDEWEB)

    McNiven, A; Jaffray, D; Letourneau, D [Princess Margaret Cancer Centre and Department of Radiation Oncology, University of Toronto, Toronto, ON (Canada)

    2015-06-15

    Purpose: A multi-centre quality assurance program was developed to enable quality improvement by coupling measurement of intensity modulated radiotherapy (IMRT) planning and delivery performance for site-specific planning exercises with diagnostic testing. The third year of the program specifically assessed the quality of spine stereotactic body radiotherapy (SBRT) planning and delivery amongst the participating centres. Methods: A spine SBRT planning exercise (24 Gy in 2 fractions) was created and completed by participants prior to an on-site visit. The delivery portion of the on-site visit included spine SBRT plan delivery and diagnostic testing, which included portal image acquisition for quantification of phantom positioning error and multi-leaf collimator (MLC) calibration accuracy. The measured dose was compared to that calculated in the treatment planning system (TPS) using 3%/2mm composite analysis and 3%/3mm gamma analysis. Results: Fourteen institutions participated, creating 17 spine SBRT plans (15 VMAT and 2 IMRT). Three different TPS, two beam energies (6 MV and 6 MV FFF), and four MLC designs from two linac vendors were tested. Large variation in total monitor units (MU) per plan (2494–6462 MU) and dose-volume parameters was observed. The maximum point dose in the plans ranged from 116–149% and was dependent upon the TPS used. Pass rates for measured to planned dose comparison ranged from 89.4–100% and 97.3–100% for 3%/2mm and 3%/3mm criteria respectively. The largest measured MLC error did Result in one of the poorer pass rates. No direct correlation between phantom positioning error and pass rates overall. Conclusion: Significant differences were observed in the planning exercise for some plan and dose-volume parameters based on the TPS used. Standard evaluation criteria showed good agreement between planned and measured dose for all participants, however on an individual plan basis, diagnostic tests were able to identify contributing

  19. Project Specific Quality Assurance Plan

    International Nuclear Information System (INIS)

    This Quality Assurance Project Plan (QAPP) identifies the Westinghouse Hanford Co. (WHC) Quality Assurance (QA) program requirements for all contractors involved in the planning and execution of the design, construction, testing and inspection of the 200 Area Effluent BAT/AKART Implementation, Project W-291

  20. Project Specific Quality Assurance Plan

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, K.S.

    1995-09-27

    This Quality Assurance Project Plan (QAPP) identifies the Westinghouse Hanford Co. (WHC) Quality Assurance (QA) program requirements for all contractors involved in the planning and execution of the design, construction, testing and inspection of the 200 Area Effluent BAT/AKART Implementation, Project W-291.

  1. External quality-assurance results for the National Atmospheric Deposition Program/National Trends Network, 1997-99

    Science.gov (United States)

    Gordon, John D.; Latysh, Natalie E.; Lindholm, Sandy J.

    2003-01-01

    Five external quality-assurance programs were operated by the U.S. Geological Survey for the National Atmospheric Deposition Program/ National Trends Network (NADP/NTN) during 1997 through 1999: the intersite-comparison program, the blind-audit program, the field- audit program, the interlaboratory-comparison program, and the collocated-sampler program. The intersite-comparison program assesses the accuracy of pH and specific-conductance determinations made by NADP/NTN site operators. In two 1997 intersite-comparison studies, 83.7 and 85.8 percent of the pH determinations met the NADP/NTN accuracy goals, whereas 97.3 and 92.4 percent of the specific-conductance determinations met the NADP/NTN accuracy goals. The percentage of pH and specific-conductance determinations that met the accuracy goals in 1998 were, for the most part, higher than in 1997. In two 1998 studies, 90.9 and 90.3 percent of the pH determinations met the accuracy goals compared to 94.7 and 96.0 percent of the specific- conductance measurements meeting the accuracy goals. In one 1999 intersite-comparison study, 89.5 percent and 99.4 percent of pH and specific- conductance determinations, respectively, met the NADP/NTN accuracy goals. The blind-audit program evaluates the effects of routine sample handling, processing, and shipping on the analytical bias and precision of weekly precipitation samples. A portion of the blind-audit sample subject to the normal onsite handling and processing of a weekly precipitation sample is referred to as the bucket portion, whereas the portion receiving only minimal handling is referred to as the bottle portion. Positive bias in regard to blind-audit results indicates that the bucket portion has a higher concentration than the bottle portion. The paired t-test for the 1997 through 1999 blind- audit data indicates that routine sample handling, processing, and shipping introduced a positive bias (a=0.05) for calcium and chloride and a negative bias (cz=0.05) for

  2. Software Quality Assurance Audits Guidebooks

    Science.gov (United States)

    1990-01-01

    The growth in cost and importance of software to NASA has caused NASA to address the improvement of software development across the agency. One of the products of this program is a series of guidebooks that define a NASA concept of the assurance processes that are used in software development. The Software Assurance Guidebook, NASA-GB-A201, issued in September, 1989, provides an overall picture of the NASA concepts and practices in software assurance. Second level guidebooks focus on specific activities that fall within the software assurance discipline, and provide more detailed information for the manager and/or practitioner. This is the second level Software Quality Assurance Audits Guidebook that describes software quality assurance audits in a way that is compatible with practices at NASA Centers.

  3. External quality-assurance results for the National Atmospheric Deposition Program/National Trends Network, 1995-96

    Science.gov (United States)

    Gordon, John D.

    1999-01-01

    The U.S. Geological Survey operated four external quality-assurance programs for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN) in 1995 and 1996: the intersite-comparison program, the blind-audit program, the interlaboratory- comparison program, and the collocated-sampler program. The intersite-comparison program assessed the precision and bias of pH and specific-conductance determinations made by NADP/NTN site operators. The analytical bias introduced during routine handling, processing, and shipping of wet-deposition samples and precision of analyte values was estimated using a blind-audit program. An interlaboratory-comparison program was used to evaluate differences between analytical results and to estimate the analytical precision of five North American laboratories that routinely analyzed wet deposition. A collocated-sampler program estimated the precision of the overall precipitation collection and analysis system from initial sample collection through final storage of the data. Results of two intersite-comparison studies completed in 1995 indicated 94.6 and 94.4 percent of the onsite pH determinations met the NADP/NTN accuracy goals, whereas 97.2 and 98.3 percent of the specific-conductance determinations were within the established limits. The percentages of onsite determinations that met the accuracy goals in 1996 were slightly less for both pH and specific-conductance than in 1995. In 1996, 93.2 and 87.5 percent of onsite pH determinations met the accuracy goals, whereas the percentage of onsite specific-conductance measurements that met the goals was 93.9 and 94.9 percent.The blind audit program utilizes a paired sample design to evaluate the effects of routine sample handling, processing and shipping on the chemistry of weekly precipitation samples. The portion of the blind audit sample subject to all of the normal onsite handling and processing steps of a regular weekly precipitation sample is referred to as the bucket

  4. Quality Assurance and Foreign Languages--Reflecting on Oral Assessment Practices in Two University Spanish Language Programs in Australia

    Science.gov (United States)

    Díaz, Adriana R.; Hortiguera, Hugo; Espinoza Vera, Marcia

    2015-01-01

    In the era of quality assurance (QA), close scrutiny of assessment practices has been intensified worldwide across the board. However, in the Australian context, trends in QA efforts have not reached the field of modern/foreign languages. This has largely resulted in leaving the establishment of language proficiency benchmarking up to individual…

  5. The successful Chief Executive Officer understands quality assurance

    International Nuclear Information System (INIS)

    The successful Chief Executive Officer (CEO) will have recognized the benefits of, and have implemented, a total quality assurance program. The quality assurance program will be adequately defined in policies and procedures such that managers and supervisors of each organizational element understand their primary and supporting roles in carrying out an effective quality assurance program. The traditional practice of having all quality assurance activities reside in a quality assurance organization will have been cast aside. Instead, the quality assurance activities necessary to achieve and assure the quality of the desired end product will have been defined and assigned to responsible organization elements. The quality assurance organization's primary role will be to define the total quality assurance program, insure that the achieving and assuring functions are assigned in policies and procedures, conduct training necessary to have management and supervisors understand the total quality assurance program, measure the effectiveness of the program and feedback measurement data for improvements in the program. The successful CEO will have implemented a quality assurance program that provides for a graded approach for application of the program based upon the importance of the intended use of the product or service. The successful CEO will rely heavily on the scheduled progress reports and assessments to measure the pulse of his organization's successes and improvement needs. This paper will describe suggested approaches for the Quality Assurance Manager to implement a quality assurance program which results in his corporation's CEO being a supporter of and a driving force in the implementation of the quality assurance program

  6. 10 CFR 26.137 - Quality assurance and quality control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Quality assurance and quality control. 26.137 Section 26....137 Quality assurance and quality control. (a) Quality assurance program. Each licensee testing facility shall have a quality assurance program that encompasses all aspects of the testing...

  7. 10 CFR 26.167 - Quality assurance and quality control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Quality assurance and quality control. 26.167 Section 26... Department of Health and Human Services § 26.167 Quality assurance and quality control. (a) Quality assurance program. Each HHS-certified laboratory shall have a quality assurance program that encompasses all...

  8. 10 CFR 76.93 - Quality assurance.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance. 76.93 Section 76.93 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) CERTIFICATION OF GASEOUS DIFFUSION PLANTS Safety § 76.93 Quality assurance. The Corporation shall establish, maintain, and execute a quality assurance program satisfying each...

  9. Solar consumer assurance network briefing book

    Energy Technology Data Exchange (ETDEWEB)

    Connor, Lynda

    1980-06-01

    Background information is provided on the rationale and purpose of the Solar Consumer Assurance Network (SOLCAN) program. Mechanisms being instituted by states to meet solar consumer assurance needs are identified. Mechanisms being developed with Federal government support to encourage solar consumer assurance activities are described. The operation of the FY 80 SOLCAN effort is described. (MHR)

  10. Quality assurance

    International Nuclear Information System (INIS)

    Quality checks are essential to assure production of high quality plants and to have end-users confidence. Quality standards require the establishment of suitable tests to maintain quality control. The choice of explant source, freedom of the donor plant from viruses, disease causing fungi, bacteria, viroids, phytoplasmas, vigour and conformity of the variety, and elimination of somaclonal variants are critical for maintaining plant quality. Variety identification by proper labeling at all stages is essential to ensure varietal identity. (author)

  11. Measurement quality assurance

    International Nuclear Information System (INIS)

    The quality of a radiation protection program can be no better than the quality of the measurements made to support it. In many cases, that quality is unknown and is merely implied on the basis of a calibration of a measuring instrument. If that calibration is inappropriate or is performed improperly, the measurement result will be inaccurate and misleading. Assurance of measurement quality can be achieved if appropriate procedures are followed, including periodic quality control actions that demonstrate adequate performance. Several national measurement quality assurance (MQA) programs are operational or under development in specific areas. They employ secondary standards laboratories that provide a high-quality link between the National Bureau of Standards and measurements made at the field use level. The procedures followed by these secondary laboratories to achieve MQA will be described, as well as plans for similar future programs. A growing general national interest in quality assurance, combined with strong specific motivations for MQA in the area of ionizing radiation, will provide continued demand for appropriate national programs. Such programs must, however, employ procedures that are cost effective and must be developed with participation by all affected parties

  12. Directory of certificates of compliance for radioactive materials packages. Volume 3, revision 1. Summary report of NRC approved quality assurance programs for radioactive material packages

    International Nuclear Information System (INIS)

    The directory contains a Summary Report of NRC approved Packages (Volume 1), Certificates of Compliance (Volume 2), and a Summary Report of NRC Approved Quality Assurance Programs for Radioactive Material Packages (Volume 3). The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the U.S. Nuclear Regulatory Commission. To assist in identifying packaging, and index by Model Number and corresponding Certificate of Compliance number is included at the back of each volume of the directory. The Summary Report includes a listing of all users of each package design prior to the publication date of the directory

  13. Establishing a quality assurance program for in-core fuel management of the Dalat Nuclear Research Reactor using low enriched fuel

    International Nuclear Information System (INIS)

    Quality assurance program for calculating of in-core fuel management of research reactor plays very important role in safety operation and effective utilization. The main objective of the program is to ensure the safe, reliable and optimum use of nuclear fuel and to meet the reactor utilization, which remains reactor operation within the limits imposed by the design safety considerations and the operational limits and conditions (OLCs) on the basis of safety analysis. The management of reactor core and nuclear fuel must be organized in a coherent way and comply with safety requirements. After successfully converting from HEU to LEU fuel for Dalat Research Reactor, a work to be in place is to study and implement the management of reactor core and nuclear fuel. This not only helps to ensure safety operation and efficient utilization but also contributes to build the safety culture and to be valuable experience for other nuclear projects. In addition, the application of the quality assurance program for in-core fuel management will contribute to avoid subjective mistakes, to clearly define responsibilities and to ensure legacy of expertise, which is also an urgent requirement. The selected computer code systems, data libraries and computation models must be fully met the requirements for analyzing status and characteristics of reactor core as well as the requirements for selecting, verifying and evaluating according to the regulations of the IAEA. (author)

  14. Quality Assurance for Consumers of Private Training Programs. Findings and Recommendations from the Consultation on the Regulation and Support of Training Providers in New Brunswick = Assurance de la qualite pour les consommateurs de programmes de formation du secteur prive. Resultats et recommandations a la suite des consultations relativement a la reglementation et au soutien des fournisseurs de cours de formation au Nouveau-Brunswick.

    Science.gov (United States)

    New Brunswick Labour Force Development Board, Fredericton.

    Eighteen key individuals from the business, labor, and training sectors and other organizations concerned with the purchase of private training programs were consulted in an effort to determine the role of Canada's federal government and New Brunswick's provincial government in quality assurance for consumers of private training programs. There…

  15. QA (Quality Assurance) role in advanced energy activities: Towards an /open quotes/orthodox/close quotes/ Quality Program: Canonizing the traditions at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Bodnarczuk, M.W.

    1988-02-01

    After a brief description of the goal of Fermi National Accelerator Laboratory (Fermilab) this paper poses and answers three questions related to Quality Assurance (QA) at the Laboratory. First, what is the difference between 'orthodox' and 'unorthodox' QA and is there a place for 'orthodox' QA at a laboratory like Fermilab. Second, are the deeper philosophical and cultural frameworks of high-energy physics acommodating or antagonistic to an 'orthodox' QA Program. Finally, faced with the task of developing an institutional QA program for Fermilab where does one begin. The paper is based on experience with the on-going development and implementation of an institutional QA Program at Fermilab. 10 refs.

  16. Directory of Certificates of Compliance for Radioactive-Materials Packages. Summary report of NRC approved quality assurance programs for radioactive material packages

    International Nuclear Information System (INIS)

    This directory contains a Summary Report of the US Nuclear Regulatory Commission's Approved Packages (Volume I), all Certificates of Compliance (Volume 2), and Summary Report of NRC Approved Quality Assurance Programs (Volume 3) for Radioactive Material Packages effective December 31, 1982. The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the back of Volumes 1 and 2 of the directory. A listing by packaging types is included in the back of Volume 2. An alphabetical listing by Company name is included in the back of Volume 3 for approved QA programs. The Summary Reports include a listing of all users of each package design and approved QA programs prior to the publication date of the directory

  17. Teacher Reaction to ICP Quality Assurance Procedures.

    Science.gov (United States)

    Leonard, Ann

    An integral part of the Quality Assurance Manual developed by Southwest Regional Laboratory (SWRL) to accompany the Kindergarten Program is the end-of-program assessment of the Instructional Concepts Program (ICP). Following completion of ICP Quality Assurance assessment, four teachers were interviewed in order to gather information pertinent to…

  18. Commissioning quality assurance at Pickering NGS

    International Nuclear Information System (INIS)

    Ontario Hydro decided in 1978 to implement a formal quality assurance program applicable to commissioning and operation of nuclear generating stations. Pickering NGS is the first station to have the commissioning quality assurance (CQA) program applied to it. This paper outlines the scope, implementation, and evaluation of the CQA program as applied to Pickering Unit 5

  19. Quality assurance

    International Nuclear Information System (INIS)

    This compendium intends to give fast bibliographic information and to fill the visible gap between documentation and general bibliographic information. The reader is given an outline of quality assurance and some examples of techniques from the relevant literature. The practical engineer, who is always short of time, is thus offered a quick survey and a fast deepening of his understanding by means of literature dealing specifically with his unresolved problems. The mansucript has been kept in tis original form in order to speed up tis publication. The RKW technical department limited itself to checking its contents and the adherence to the established information goals. (orig.) 891 RW/orig. 892 MB

  20. Directory of certificates of compliance for radioactive materials packages. Summary report of NRC approved quality assurance programs for radioactive material packages. Volume 3, Revision 6

    International Nuclear Information System (INIS)

    This directory contains a Summary Report of NRC Approved Packages (Volumes 1), Certificates of Compliance (Volume 2), and a Summary Report of NRC Approved Quality Assurance Programs for Radioactive Material Packages (Volume 3). The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance number is included at the back of each volume of the directory. The Summary Report includes a listing of all users of each package design prior to the publication date of the directory. Shipments of radioactive material utilizing these packagings must be in accordance with the provisions of 49 CFR 173.471 and 10 CFR Part 71, as applicable. In satisfying the requirements of Section 71.12, it is the responsibility of the licensees to insure them that have a copy of the current approval and conduct their transportation activities in accordance with an NRC approved quality assurance program. Copies of the current approval may be obtained from the US Nuclear Regulatory Commission Public Document Room files (see Docket No. listed on each certificate) at 1717 H Street, Washington, DC 20555. Note that the general license of 10 CFR 71.12 does not authorize the receipt, possession, use of transfer of byproduct source, or special nuclear material; such authorization must be obtained pursuant to 10 CFR Parts 30 to 36, 40, 50, or 70

  1. Directory of certificates of compliance for radioactive materials packages: summary report of NRC approved quality-assurance programs for radioactive-material packages. Volume 3, Revision 3

    International Nuclear Information System (INIS)

    This directory contains a Summary Report of NRC Approved Packages (Volume 1), Certificates of Compliance (Volume 2), and a Summary Report of NRC Approved Quality Assurance Programs for Radioactive Material Packages (Volume 3). The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance number is included at the back of each volume of the directory. The Summary Report includes a listing of all users of each package design prior to the publication date of the directory. Shipments of radioactive material utilizing these packagings must be in accordance with the provisions of 49 CFR 173.471 and 10 CFR Part 71, as applicable. In satisfying the requirements of Section 71.12, it is the responsibility of the licensees to insure them in accordance with an NRC approved quality assurance program. Copies of the current approval may be obtained from the US Nuclear Regulatory Commission Public Document Room files (see Docket No. listed on each certificate) at 1717 H Street, Washington, DC 20555. Note that the general license of 10 CFR 71.12 does not authorize the receipt, possession, use or transfer of byproduct source, or special nuclear material; such authorization must be obtained pursuant to 10 CFR Parts 30 to 36, 40, 50, or 70

  2. Directory of certificates of compliance for radioactive materials packages. Summary report of NRC approved quality assurance programs for radioactive material packages. Volume 3, Revision 4

    International Nuclear Information System (INIS)

    This directory contains a Summary Report of NRC Approved Packages (Volume 1), Certificates of Compliance (Volume 2), and a Summary Report of NRC Approved Quality Assurance Programs for Radioactive Material Packages (Volume 3). The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance number is included at the back of each volume of the directory. The Summary Report includes a listing of all users of each package design prior to the publication date of the directory. Shipments of radioactive material utilizing these packagings must be in accordance with the provisions of 49 CFR 173.471 and 10 CFR Part 71, as applicable. In satisfying the requirements of Section 71.12, it is the responsibility of the licensees to insure they have a copy of the current approval and conduct their transportation activities in accordance with an NRC approved quality assurance program. Copies of the current approval may be obtained from the US Nuclear Regulatory Commission Public Document Room files (see Docket No. listed on each certificate) at 1717 H Street, Washington, DC 20555. Note that the general license of 10 CFR 71.12 does not authorize the receipt, possession, use or transfer of byproduct source, or special nuclear material; such authorization must be obtained pursuant to 10 CFR Parts 30 to 36, 40, 50, or 70

  3. Nova laser assurance-management system

    International Nuclear Information System (INIS)

    In a well managed project, Quality Assurance is an integral part of the management activities performed on a daily basis. Management assures successful performance within budget and on schedule by using all the good business, scientific, engineering, quality assurance, and safety practices available. Quality assurance and safety practices employed on Nova are put in perspective by integrating them into the overall function of good project management. The Nova assurance management system was developed using the quality assurance (QA) approach first implemented at LLNL in early 1978. The LLNL QA program is described as an introduction to the Nova assurance management system. The Nova system is described pictorially through the Nova configuration, subsystems and major components, interjecting the QA techniques which are being pragmatically used to assure the successful completion of the project

  4. Directory of Certificates of Compliance for Radioactive Materials Packages. Summary Report of NRC Approved Quality Assurance Programs for Radioactive Material Packages. Volume 3. Revision 5

    International Nuclear Information System (INIS)

    This directory contains a Summary Report of the US Nuclear Regulatory Commission's Approved Packages (Volume I), all Certificates of Compliance (Volume 2), and Summary Report of NRC Approved Quality Assurance Programs (Volume 3) for Radioactive Material Packages effective October 1, 1985. The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the back of Volumes 1 and 2 of the directory. A listing by packaging types is included in the back of Volume 2. An alphabetical listing by Company name is included in the back of Volume 3 for approved QA programs. The Summary Reports include a listing of all users of each package design and approved QA programs prior to the publication date of the directory. Shipments of radioactive material utilizing these packages must be in accordance with the provisions of 49 CFR Section 173.471 and 10 CFR Part 71, as applicable. In satisfying the requirements of Section 71.12, it is the responsibility of the licensees to insure themselves that they have a copy of the current approval and conduct their transportation activities in accordance with a Nuclear Regulatory Commission approved quality assurance program. Copies of the current approval may be obtained from the US Nuclear Regulatory Commission Public Document Room files (see Docket No. listed on each certificate) at 1717 H Street, Washington, DC 20555. Note that the general license of 10 CFR Section 71.12 does not authorize the receipt, possession, use or transfer of byproduct, source or special nuclear material; such authorization must be obtained pursuant to 10 CFR Parts 30 to 36, 40, or 70

  5. 10 CFR 72.142 - Quality assurance organization.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance organization. 72.142 Section 72.142... Assurance § 72.142 Quality assurance organization. (a) The licensee, applicant for a license, certificate... activities are performed, the organizational structure for executing the quality assurance program may...

  6. Quality assurance (QA) program in BNCT. RBE of 7 NCT beams for intestinal crypt regeneration in mice

    International Nuclear Information System (INIS)

    The epithermal neutron beams presently used for Neutron Capture Therapy (NCT) differ substantially in their composition (relative contribution of the different dose components to the total dose), in their dose rate (depending on the power of the reactor) as well as in their general feature (e.g. beam delivery system). Each of these elements might alter significantly the biological effectiveness of the beams. Therefore, the Relative Biological Effectiveness (RBE) of 7 NCT beams was intercompared, for a reference biological system (crypt regeneration in mice) and under well-defined irradiation conditions. This type of experiments - which should facilitate the exchange of radiobiological/clinical information - should take part of the Quality Assurance (QA) procedure of all NCT beams. (author)

  7. 10 CFR 63.142 - Quality assurance criteria.

    Science.gov (United States)

    2010-01-01

    ... portion of the quality assurance program at any location where activities subject to 10 CFR part 63 are... achieved and maintained. (4) DOE shall regularly review the status and adequacy of the quality assurance program. Management of other organizations participating in the quality assurance program shall...

  8. An Application Example Analysis of Quality Assurance Program for STELLA(Sodium Integral Effect Test Loop for Safety Simulation and Assessment) Project

    International Nuclear Information System (INIS)

    KAERI has been conducting various basic R and D activities in the field of nuclear technology. In addition, KAERI is now participating in the Generation IV International Forum (GIF), preparing for the development of key technologies for Generation IV nuclear energy system, including Sodium cooled Fast Reactor (SFR) development. All of the key technologies for SFR development need an appropriate level of QA activities to achieve the GIF safety and performance objectives. Therefore, QA activities have been conducted as an essential part of the national SFR project. As a result, QAM (Quality Assurance Manual) and QAP (Quality Assurance Procedures) have been developed for the SFR project, which are based on ASME NQA-1, KEPIC QAP and the GIF Quality Management System Guidelines. In this work, the introduction background and application examples of the QA program for the STELLA project were investigated. Application of the QA for the STELLA project has great significance because the QA has been mainly applied for the nuclear power plant area in operation, which helps ensure the reliability of the test data and completeness of the research performance. Nevertheless, developing more appropriate QA procedures remains a major task because some parts of them are not applicable to the Na-experiment

  9. An Application Example Analysis of Quality Assurance Program for STELLA(Sodium Integral Effect Test Loop for Safety Simulation and Assessment) Project

    Energy Technology Data Exchange (ETDEWEB)

    Jung, Minhwan; Gam, Dayoung; Eoh, Jae-Hyuk; Jeong, Ji-Young [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    KAERI has been conducting various basic R and D activities in the field of nuclear technology. In addition, KAERI is now participating in the Generation IV International Forum (GIF), preparing for the development of key technologies for Generation IV nuclear energy system, including Sodium cooled Fast Reactor (SFR) development. All of the key technologies for SFR development need an appropriate level of QA activities to achieve the GIF safety and performance objectives. Therefore, QA activities have been conducted as an essential part of the national SFR project. As a result, QAM (Quality Assurance Manual) and QAP (Quality Assurance Procedures) have been developed for the SFR project, which are based on ASME NQA-1, KEPIC QAP and the GIF Quality Management System Guidelines. In this work, the introduction background and application examples of the QA program for the STELLA project were investigated. Application of the QA for the STELLA project has great significance because the QA has been mainly applied for the nuclear power plant area in operation, which helps ensure the reliability of the test data and completeness of the research performance. Nevertheless, developing more appropriate QA procedures remains a major task because some parts of them are not applicable to the Na-experiment.

  10. Quality assurance considerations in nuclear waste management

    International Nuclear Information System (INIS)

    Proper use of quality assurance will provide the basis for an effective management control system for nuclear waste management programs. Control is essential for achieving successful programs free from costly losses and failures and for assuring the public and regulators that the environment and health and safety are being protected. The essence of quality assurance is the conscientious use of planned and systematic actions, based on selecting and applying appropriate requirements from an established quality assurance standard. Developing a quality assurance program consists of using knowledge of the technical and managerial aspects of a project to identify and evaluate risks of loss and failure and then to select appropriate quality assurance requirements that will minimize the risks. Those requirements are integrated into the project planning documents and are carried out as specific actions during the life of the project

  11. Quality assurance during site construction

    International Nuclear Information System (INIS)

    During the time of planing and construction of a nuclear power plant, the following proceeding is approved: - the deliverer of a nuclear power plant provides the reports fixing the quality assurance program, it means that he is responsible to write the safety analysis report, the specifications for the erection of the components, the working manuals and specifications for testing (eg nondestr. testing) - the manufacturing of components or systems will be controlled by an own independent quality assurance group, provided that this group was checked by the quality assurance group of the applicant - the TUeV with its independent assessors will fix the requirements relating to quality assurance in its assessment. On this basis the examination of the applicants specifications, working manuals, testing specifications will be done. The efficiency of quality assurance at the manufacturer and at the applicant will be checked by the TUeV specialists by considering specifications of modifications, repairs or tolerances. A mean point of the quality assurance in Germany is the dynamic adjustment, of an action on the latest state of engineering or science. If there exists a change of rules or guidelines, the quality assurance requirements have to be fit on this state in so far as it is feasible from the technical point of view. (orig./RW)

  12. Quality assurance plan, Westinghouse Water Reactor Divisions

    Energy Technology Data Exchange (ETDEWEB)

    1976-03-01

    The Quality Assurance Program used by Westinghouse Nuclear Energy Systems Water Reactor Divisions is described. The purpose of the program is to assure that the design, materials, and workmanship on Nuclear Steam Supply System (NSSS) equipment meet applicable safety requirements, fulfill the requirements of the contracts with the applicants, and satisfy the applicable codes, standards, and regulatory requirements.

  13. Letter of Intent for River Protection Project (RPP) Characterization Program: Process Engineering and Hanford Analytical Services and Characterization Project Operations and Quality Assurance

    International Nuclear Information System (INIS)

    The Characterization Project level of success achieved by the River Protection Project (RPP) is determined by the effectiveness of several organizations across RPP working together. The requirements, expectations, interrelationships, and performance criteria for each of these organizations were examined in order to understand the performances necessary to achieve characterization objectives. This Letter of Intent documents the results of the above examination. It formalizes the details of interfaces, working agreements, and requirements for obtaining and transferring tank waste samples from the Tank Farm System (RPP Process Engineering, Characterization Project Operations, and RPP Quality Assurance) to the characterization laboratory complex (222-S Laboratory, Waste Sampling and Characterization Facility, and the Hanford Analytical Service Program) and for the laboratory complex analysis and reporting of analytical results

  14. Waste Management Quality Assurance Plan

    International Nuclear Information System (INIS)

    Lawrence Berkeley Laboratory's Environment Department addresses its responsibilities through activities in a variety of areas. The need for a comprehensive management control system for these activities has been identified by the Department of Energy (DOE). The WM QA (Waste Management Quality Assurance) Plan is an integral part of a management system that provides controls necessary to ensure that the department's activities are planned, performed, documented, and verified. This WM QA Plan defines the requirements of the WM QA program. These requirements are derived from DOE Order 5700.6C, Quality Assurance, the LBL Operating and Assurance Program Plan (OAP, LBL PUB-3111), and other environmental compliance documents applicable to WM activities. The requirements presented herein, as well as the procedures and methodologies that direct the implementation of these requirements, will undergo review and revisions as necessary. The provisions of this QA Plan and its implementing documents apply to quality-affecting activities performed by and for WM. It is also applicable to WM contractors, vendors, and other LBL organizations associated with WM activities, except where such contractors, vendors, or organizations are governed by their own WM-approved QA programs. References used in the preparation of this document are (1) ASME NQA-1-1989, (2) ANSI/ASQC E4 (Draft), (3) Waste Management Quality Assurance Implementing Management Plan (LBL PUB-5352, Rev. 1), (4) LBL Operating and Assurance Program Plan (OAP), LBL PUB-3111, 2/3/93. A list of terms and definitions used throughout this document is included as Appendix A

  15. U.S. Geological Survey external quality-assurance project report to the National Atmospheric Deposition Program / National Trends Network and Mercury Deposition Network, 2007-08

    Science.gov (United States)

    Wetherbee, Gregory A.; Latysh, Natalie E.; Chesney, Tanya A.

    2010-01-01

    The U.S. Geological Survey (USGS) used six distinct programs to provide external quality-assurance monitoring for the National Atmospheric Deposition Program / National Trends Network (NTN) and Mercury Deposition Network (MDN) during 2007-08. The field-audit program assessed the effects of onsite exposure, sample handling, and shipping on the chemistry of NTN samples, and a system-blank program assessed the same effects for MDN. Two interlaboratory-comparison programs assessed the bias and variability of the chemical analysis data from the Central Analytical Laboratory (CAL), Mercury (Hg) Analytical Laboratory (HAL), and 12 other participating laboratories. A blind-audit program was also implemented for the MDN to evaluate analytical bias in HAL total Hg concentration data. A co-located-sampler program was used to identify and quantify potential shifts in NADP data resulting from replacement of original network instrumentation with new electronic recording rain gages (E-gages) and prototype precipitation collectors. The results indicate that NADP data continue to be of sufficient quality for the analysis of spatial distributions and time trends of chemical constituents in wet deposition across the U.S. NADP data-quality objectives continued to be achieved during 2007-08. Results also indicate that retrofit of the NADP networks with the new E-gages is not likely to create step-function type shifts in NADP precipitation-depth records, except for sites where annual precipitation depth is dominated by snow because the E-gages tend to catch more snow than the original NADP rain gages. Evaluation of prototype precipitation collectors revealed no difference in sample volumes and analyte concentrations between the original NADP collectors and modified, deep-bucket collectors, but the Yankee Environmental Systems, Inc. (YES) collector obtained samples of significantly higher volumes and analyte concentrations than the standard NADP collector.

  16. External quality-assurance project report for the National Atmospheric Deposition Program/National Trends Network and Mercury Deposition Network, 2009-2010

    Science.gov (United States)

    Wetherbee, Gregory A.; Martin, RoseAnn; Rhodes, Mark F.; Chesney, Tanya A.

    2014-01-01

    The U.S. Geological Survey operated six distinct programs to provide external quality-assurance monitoring for the National Atmospheric Deposition Program/National Trends Network (NTN) and Mercury Deposition Network (MDN) during 2009–2010. The field-audit program assessed the effects of onsite exposure, sample handling, and shipping on the chemistry of NTN samples; a system-blank program assessed the same effects for MDN. Two interlaboratory-comparison programs assessed the bias and variability of the chemical analysis data from the Central Analytical Laboratory (CAL) and Mercury (Hg) Analytical Laboratory (HAL). The blind-audit program was also implemented for the MDN to evaluate analytical bias in total Hg concentration data produced by the HAL. The co-located-sampler program was used to identify and quantify potential shifts in NADP data resulting from replacement of original network instrumentation with new electronic recording rain gages (E-gages) and precipitation collectors that use optical sensors. The results indicate that NADP data continue to be of sufficient quality for the analysis of spatial distributions and time trends of chemical constituents in wet deposition across the United States. Results also suggest that retrofit of the NADP networks with the new precipitation collectors could cause –8 to +14 percent shifts in NADP annual precipitation-weighted mean concentrations and total deposition values for ammonium, nitrate, sulfate, and hydrogen ion, and larger shifts (+13 to +74 percent) for calcium, magnesium, sodium, potassium, and chloride. The prototype N-CON Systems bucket collector is more efficient in the catch of precipitation in winter than Aerochem Metrics Model 301 collector, especially for light snowfall.

  17. A novel compound 6D-offset simulating phantom and quality assurance program for stereotactic image-guided radiation therapy system.

    Science.gov (United States)

    Yuen Kan Ngar, Dennis; Lok-Man Cheung, Michael; Koon-Ming Kam, Michael; Poon, Wai-Sang; Tak-Cheung Chan, Anthony

    2013-01-01

    A comprehensive quality assurance (QA) device cum program was developed for the commissioning and routine testing of the 6D IGRT systems. In this article, both the new QA system and the BrainLAB IGRT system which was added onto a Varian Clinac were evaluated. A novel compound 6D-offset simulating phantom was designed and fabricated in the Prince of Wales Hospital (PWH), Hong Kong. The QA program generated random compound 6D-offset values. The 6D phantom was simply set up and shifted accordingly. The BrainLAB ExacTrac X-ray IGRT system detected the offsets and then corrected the phantom position automatically through the robotic couch. Routine QA works facilitated data analyses of the detection errors, the correction errors, and the correlations. Fifty sets of data acquired in 2011 in PWH were thoroughly analyzed. The 6D component detection errors and correction errors of the IGRT system were all within ± 1 mm and ± 1° individually. Translational and rotational scalar resultant errors were found to be 0.50 ± 0.27 mm and 0.54 ± 0.23°, respectively. Most individual component errors were shown to be independent of their original offset values. The system characteristics were locally established. The BrainLAB 6D IGRT system added onto a regular linac is sufficiently precise for stereotactic RT. This new QA methodology is competent to assure the IGRT system overall integrity. Annual grand analyses are recommended to check local system consistency and for external cross comparison. The target expansion policy of 1.5 mm 3D margin from CTV to PTV is confirmed for this IGRT system currently in PWH. PMID:24257294

  18. Quality-assurance study of the special - purpose finite-element program - SPECTROM: I. Thermal, thermoelastic, and viscoelastic problems

    International Nuclear Information System (INIS)

    This comparison study involves a preliminary verification of finite element calculations. The methodology of the comparison study consists of solving four example problems with both the SPECTROM finite element program and the MARC-CDC general purpose finite element program. The results show close agreement for all example problems

  19. Program system SADKO-2 for assurance of high-energy radiation transport calculation by the group constant methods

    International Nuclear Information System (INIS)

    The structure of the SADKO-2 program system, providing for calculations of radiation transport by the group methods for protons, π-mesons within the energy range from 20 MeV to 10 TeV; for neutrons-from the thermal one to 10 TeV; for photons-from 0.01 up to 15 MeV. The SADKO system containing the program for calculation of complete and twice-differential cross section of inelastic hA-interaction, the program for calculation of group microcross sections for particles with energy above 20 MeV and the program for calculation of group microcross sections for isotope mixtures. The file of the group cross sections in a predetermined format, prepared with an account of the components composition of the shielding and detector substance, constitute the result of the SADKO-2 constant system operation. 25 refs., 7 figs

  20. GSFC Safety and Mission Assurance Organization

    Science.gov (United States)

    Kelly, Michael P.

    2010-01-01

    This viewgraph presentation reviews NASA Goddard Space Flight Center's approach to safety and mission assurance. The contents include: 1) NASA GSFC Background; 2) Safety and Mission Assurance Directorate; 3) The Role of SMA-D and the Technical Authority; 4) GSFC Mission assurance Requirements; 5) GSFC Systems Review Office (SRO); 6) GSFC Supply Chain Management Program; and 7) GSFC ISO9001/AS9100 Status Brief.

  1. Quality Assurance - Construction

    DEFF Research Database (Denmark)

    Gaarslev, Axel

    1996-01-01

    Gives contains three main chapters:1. Quality Assurance initiated by external demands2. Quality Assurance initiated by internal company goals3. Innovation strategies......Gives contains three main chapters:1. Quality Assurance initiated by external demands2. Quality Assurance initiated by internal company goals3. Innovation strategies...

  2. An analysis of current and former mathematics and science teacher education program participants' perceptions for quality assurance

    Science.gov (United States)

    Williams-Duncan, Omah Makebbe

    State curriculum and professional standards characterize the level of proficiency pre-service teachers must attain to be prepared to teach in Texas classrooms. Teacher education programs are being scrutinized for their ability to help pre-service teachers reach a level of proficiency commensurate with these state standards. This dissertation presents an understanding of a teacher education program's quality via analysis of its current student teacher and former student perceptions. There are two participant groups in this study - current student teachers (n=11) and former students (n=78) from one program called, aggieTEACH, a traditional baccalaureate secondary mathematics and science teacher education program. Of the current student teachers and former students participating in this study, 77.5% (n = 69) were female, 21.3% (n = 19) were male and 1.1% (n = 1) did not disclose their gender; additionally, 80.9% (n = 72) identify as white or Caucasian, 9% (n = 8) identify as Hispanic, 7.8% (n = 7) identifying as African American, Asian, or other, and 2.2% (n = 2) decided not to disclose their race. This mixed methods study reveals participant's agreement and confidence levels in mentoring, confidence, TEP quality, and program characteristics of aggieTEACH. The researcher used principal components analysis, exploratory factor analysis, and content analysis to review secondary data from administered web-based surveys. The surveys have Likert-scaled, single-response items and open-ended response items. Specific survey items were identified per categories called (a) mentoring, (b) confidence, (c) TEP quality, and (d) program characteristics. The mentoring scale yielded an alpha of .903. The confidence subscale yielded an alpha .951. The quality items yielded an alpha .881 and the characteristics items yielded an alpha of .919. Significant differences occurred between current student teacher and former student participants' agreement and confidence levels about the teacher

  3. Development of a postal dosimetric system for quality assurance programs in radiotherapy using fotons beams in non references conditions

    CERN Document Server

    Marin, A

    2003-01-01

    In radiotherapy, to cure the primary tumor, the absorbed dose delivered at the target volume should have an accuracy better than +- 5%. As the basic aim in radiotherapy is the eradication of the primary tumor with the smallest possible damage to the health tissues, it is necessary to guarantee that the dose delivered to the patient in different depths and treatment configurations has the right accuracy. For this reason, a quality control program should be carried out by regulatory and national standardization programs including postal evaluation of the beam dosimetry are also necessary. Since many years Brazil is running a postal quality control program in radiotherapy in reference conditions, Nevertheless it should be increased to include also measurements in non reference conditions. In this paper we present a new dosimetric postal system using thermoluminescent dosimeters (TLD-100 in powder) for photon beams quality control in radiotherapy, in non reference conditions. This system has been checked and appl...

  4. Implementation of a program of quality assurance of image in an imaging system of flat panel portal; Puesta en marcha de un programa de garantia de calidad de imagen en un sistema de imagen portal de panel plano

    Energy Technology Data Exchange (ETDEWEB)

    Gomez Barrado, A.; Sanchez Jimenez, E.; Benitez, J. A.; Sanchez-Reyes, A.

    2013-07-01

    (IGRT) image-guided radiation therapy is the one in which images are used to locate the area of treatment. Modern irradiation systems are equipped with different modalities for obtaining images, such as flat panel systems, systems conebeam, tomoimagen, etc. This paper describes the start-up and the experience of a quality assurance program based on a flat panel portal Imaging System. (Author)

  5. Directory of certificates of compliance for radioactive materials packages: Report of NRC approved quality assurance programs for radioactive materials packages

    International Nuclear Information System (INIS)

    The purpose of this directory is to make available a convenient source of information on packaging which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the front of Volume 2 of the directory. A listing by packaging types is included in the back of Volume 2. An alphabetical listing by Company name is included in the back of Volume 3 for approved QA programs. The Reports include a listing of all users of each package design and approved QA programs prior to the publication date of the directory

  6. Directory of certificates of compliance for radioactive materials packages: Report of NRC approved quality assurance programs for radioactive materials packages

    International Nuclear Information System (INIS)

    The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of compliance Number is included at the front of Volume 2 of the directory. A listing by packaging types is included in the back of Volume 2. An alphabetical listing by Company name is included in the back of Volume 3 for approved QA programs. The Reports include a listing of all users of each package design and approved QA programs prior to the publication date of the directory

  7. Training, Quality Assurance Factors, and Tools Investigation: a Work Report and Suggestions on Software Quality Assurance

    Science.gov (United States)

    Lee, Pen-Nan

    1991-01-01

    Previously, several research tasks have been conducted, some observations were obtained, and several possible suggestions have been contemplated involving software quality assurance engineering at NASA Johnson. These research tasks are briefly described. Also, a brief discussion is given on the role of software quality assurance in software engineering along with some observations and suggestions. A brief discussion on a training program for software quality assurance engineers is provided. A list of assurance factors as well as quality factors are also included. Finally, a process model which can be used for searching and collecting software quality assurance tools is presented.

  8. Introduction to quality assurance

    International Nuclear Information System (INIS)

    In today's interpretation 'quality assurance' means 'good management'. Quality assurance has to cover all phases of a work, but all quality assurance measures must be adapted to the relevance and complexity of the actual task. Examples are given for the preparation of quality classes, the organization of quality assurance during design and manufacturing and for auditing. Finally, efficiency and limits of quality assurance systems are described. (orig.)

  9. 7 CFR 90.102 - Quality assurance review.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) COMMODITY LABORATORY TESTING PROGRAMS INTRODUCTION Quality Assurance § 90.102 Quality assurance review. (a) Each laboratory performing tests...

  10. Quality assurance in radiation oncology. A study of feasibility and impact on radiation levels of an in vivo dosimetry program during breast cancer irradiation

    International Nuclear Information System (INIS)

    The study was aimed at investigating the feasibility and accuracy of an in vivo quality assurance program in radiotherapy. Breast irradiation was found to be a relevant clinical model due to the fairly good uniformity of the irradiated tissue. The investigation was based on an extension of the method described by Leunens et al. Determining the absorbed dose at any point on the central axis from a measurement of entrance and exit doses with individually corrected diodes. Treatment accuracy was quantified as the ratio of the measured and the expected isocentre dose from the treatment planning system (TPS). A preliminary study was carried out on a Plexiglas slab phantom to test the method ending with a frequency distribution of treatment accuracy with a mean of 0.04 ± 0.05% and a standard deviation (SD) of 0.83 ± 0.04%. In the in vivo study, 101 patients irradiated with two fields were included in the protocol over a 1-year period. The total number of patient set-ups analyzed was 421 giving a distribution of treatment planning with a mean of -1.3 ± 0.2% and an SD of 2.7 ± 0.1% without any correction. Taking into account temperature effects and errors as SSD accuracy and diodes positioning it was possible to implement an off-line correction method leading to a final distribution with a mean of - 1.9 ± 0.2% and an SD of 2.4 ± 0.1%. Individual cases with large deviations were detected and evaluated and actions were undertaken whenever possible. The study showed that diodes can be easily used by radiographers in an accurate in vivo quality assurance (QA) program and that an accuracy level of 3% at 1 SD can be reached on average. Attention and action levels can also be identified and careful evaluation of positioning and morphological variations during treatment should be part of a comprehensive QA program. (author)

  11. Maintenance Of The EPS 3000 Electron Beam Machine As Part Of Quality Assurance Program For Irradiation Service At ALURTRON, Nuclear Malaysia

    International Nuclear Information System (INIS)

    The EPS 3000 electron beam machine is the first of its kind in the country and was installed in Nuclear Malaysia in 1991. It was manufactured by Nissin High Voltage having variable energies from 0.5 to 3.0 MeV and maximum power of 90 kW. The machine is currently used for commercial irradiation that serves local industries. The Alurtron facility where the EPS is housed is an ISO 9000 certified plant. Maintenance program for the EPS is an essential part of Alurtron's Quality Assurance program. This is to ensure that the machine is in good condition and can serve the customer as the demand requires. Preventive maintenance is carried out at scheduled period based on recommendation of the machine's manufacturer. Corrective maintenance and repairs are carried out in-house by Alurtron's technical staff. Assistance may be sought from the manufacturer if necessary. Over the years, Alurtron had built its own capabilities in term of operation and maintenance of Cockcroft Walton type electron beam machine. (author)

  12. Software Assurance Using Structured Assurance Case Models

    OpenAIRE

    Rhodes, Thomas; Boland, Frederick; Fong, Elizabeth; Kass, Michael

    2010-01-01

    Software assurance is an important part of the software development process to reduce risks and ensure that the software is dependable and trustworthy. Software defects and weaknesses can often lead to software errors and failures and to exploitation by malicious users. Testing, certification and accreditation have been traditionally used in the software assurance process to attempt to improve software trustworthiness. In this paper, we examine a methodology known as a structured assurance mo...

  13. Quality assurance in individual monitoring

    International Nuclear Information System (INIS)

    Measurement and assessment of radiation dose to the individual radiation worker, called 'Individual monitoring', is one of the most important aspects of radiation protection. International Commission on Radiation Protection (ICRP-75) has outlined three main objectives of personal monitoring viz assessment of the effectively equivalent dose to demonstrate compliance with managerial and regulatory requirements; to contribute to control of operation and design of facilities and in case of accidental overexposure, to provide valuable information for the initiation and support of any health surveillance and treatment. To meet these objectives, it is essential that the measurements are reliable and accurate as defined by National and International Standards. This requires setting up of well defined internal as well as external quality assurance protocol in the individual monitoring program. External quality assurance program is meant to provide a reliable and qualitative as well as quantitative assessment of the service provided by the service provider. In India, individual monitoring is based on CaSO4:Dy based TLD badge and the task of conducting external quality assurance (QA) is being performed by RP and AD, Bhabha Atomic Research Centre. The paper presents the methodology of Quality assurance, Performance evaluation standards and criteria. It discusses the results and important observations of last few QA cycles conducted for all the TLD Labs. The quality assurance check has indicated that the performance of all the Labs is satisfactory in accordance with ANSI as well as Trumpet curve methodology. It provided feedback on further improvements in the quality

  14. Implementing combined assurance: insights from multiple case studies

    OpenAIRE

    Loic Decaux; Gerrit Sarens

    2015-01-01

    Purpose –This purpose of this paper is to investigate how to implement a combined assurance program. Design/methodology/approach –This paper uses qualitative data obtained through semi-structured interviews with six multinationals at different stages of combined assurance implementation maturity. Findings -The paper finds that organizations are still learning through combined assurance implementation because no organization seems to have attained a mature combined assurance program. Neverthel...

  15. Implementation of Good Clinical Laboratory Practice (GCLP) guidelines within the External Quality Assurance Program Oversight Laboratory (EQAPOL)

    OpenAIRE

    Todd, Christopher A.; Sanchez, Ana M.; Garcia, Ambrosia; Thomas N Denny; Sarzotti-Kelsoe, Marcella

    2013-01-01

    The EQAPOL contract was awarded to Duke University to develop and manage global proficiency testing programs for flow cytometry-, ELISpot-, and Luminex bead-based assays (cytokine analytes), as well as create a genetically diverse panel of HIV-1 viral cultures to be made available to National Institutes of Health (NIH) researchers. As a part of this contract, EQAPOL was required to operate under Good Clinical Laboratory Practices (GCLP) that are traditionally used for laboratories conducting ...

  16. Development of a postal dosimetric system for quality assurance programs in radiotherapy using fotons beams in non references conditions

    International Nuclear Information System (INIS)

    In radiotherapy, to cure the primary tumor, the absorbed dose delivered at the target volume should have an accuracy better than ± 5%. As the basic aim in radiotherapy is the eradication of the primary tumor with the smallest possible damage to the health tissues, it is necessary to guarantee that the dose delivered to the patient in different depths and treatment configurations has the right accuracy. For this reason, a quality control program should be carried out by regulatory authorities and national standardization programs including postal evaluation of the beam dosimetry are also necessary. Since many years Brazil is running a postal quality control program in radiotherapy in reference conditions, Nevertheless it should be increased to include also measurements in non reference conditions. In this paper we present a new dosimetric postal system using thermoluminescent dosimeters (TLD-100 in powder) for photon beams quality control in radiotherapy, in non reference conditions. This system has been checked and applied in different units, confirming its adequacy to the proposed measurements. (author)

  17. 78 FR 5813 - 2013 Assuring Radiation Protection

    Science.gov (United States)

    2013-01-28

    ... HUMAN SERVICES Food and Drug Administration 2013 Assuring Radiation Protection AGENCY: Food and Drug... protection program. The goal of the 2013 Assuring Radiation Protection will be to coordinate Federal, State... radiation protection. The recipient will establish committees, in accordance with Federal statutes...

  18. Quality assurance for image-guided radiotherapy

    International Nuclear Information System (INIS)

    The topics discussed include, among others, the following: Quality assurance program; Image guided radiotherapy; Commissioning and quality assurance; Check of agreement between visual and displayed scales; quality controls: electronic portal imaging device (EPID), MV-kV and kV-kV, cone-beam CT (CBCT), patient doses. (P.A.)

  19. Separation Assurance and Collision Avoidance

    Science.gov (United States)

    Lauderdale, Todd

    2010-01-01

    Objective SACA-1: Determine the level of safety provided by tactical separation assurance safety monitoring systems for UAS missions. a) Rationale: Continuous mission-risk monitoring can provide equivalent levels of safety for UAS operations possibly reducing the burden on other safety systems. b) Approach: Utilize and adapt algorithms and approaches developed for the NextGen Airspace Systems Program for UAS applications.

  20. Westinghouse Water Reactor Divisions quality assurance plan

    International Nuclear Information System (INIS)

    The Quality Assurance Program used by Westinghouse Water Reactor Divisions is described. The purpose of the program is to assure that the design, materials, and workmanship on Nuclear Steam Supply System (NSSS) equipment meet applicable safety requirements, fulfill the requirements of the contracts with the applicants, and satisfy the applicable codes, standards, and regulatory requirements. This program satisfies the NRC Quality Assurance Criteria, 10CFR50 Appendix B, to the extent that these criteria apply to safety related NSSS equipment. Also, it follows the regulatory position provided in NRC regulatory guides and the requirements of ANSI Standard N45.2.12 as identified in this Topical Report

  1. Waste Management Quality Assurance Plan

    International Nuclear Information System (INIS)

    The WMG QAP is an integral part of a management system designed to ensure that WMG activities are planned, performed, documented, and verified in a manner that assures a quality product. A quality product is one that meets all waste acceptance criteria, conforms to all permit and regulatory requirements, and is accepted at the offsite treatment, storage, and disposal facility. In addition to internal processes, this QA Plan identifies WMG processes providing oversight and assurance to line management that waste is managed according to all federal, state, and local requirements for waste generator areas. A variety of quality assurance activities are integral to managing waste. These QA functions have been identified in the relevant procedures and in subsequent sections of this plan. The WMG QAP defines the requirements of the WMG quality assurance program. These requirements are derived from Department of Energy (DOE) Order 414.1C, Quality Assurance, Contractor Requirements Document, the LBNL Operating and Assurance Program Plan (OAP), and other applicable environmental compliance documents. The QAP and all associated WMG policies and procedures are periodically reviewed and revised, as necessary, to implement corrective actions, and to reflect changes that have occurred in regulations, requirements, or practices as a result of feedback on work performed or lessons learned from other organizations. The provisions of this QAP and its implementing documents apply to quality-affecting activities performed by the WMG; WMG personnel, contractors, and vendors; and personnel from other associated LBNL organizations, except where such contractors, vendors, or organizations are governed by their own WMG-approved QA programs

  2. Quality assurance in a large research and development laboratory

    International Nuclear Information System (INIS)

    Developing a quality assurance program for a large research and development laboratory provided a unique opportunity for innovative planning. The quality assurance program that emerged has been tailored to meet the requirements of several sponsoring organizations and contains the flexibility for experimental programs ranging from large engineering-scale development projects to bench-scale basic research programs

  3. Quality assurance programs developed and implemented by the US Department of Energy's Analytical Services Program for environmental restoration and waste management activities

    International Nuclear Information System (INIS)

    The U.S. Department of Energy's (DOE's) Office of Environmental Restoration and Waste Management (EM) has been tasked with addressing environmental contamination and waste problems facing the Department. A key element of any environmental restoration or waste management program is environmental data. An effective and efficient sampling and analysis program is required to generate credible environmental data. The bases for DOE's EM Analytical Services Program (ASP) are contained in the charter and commitments in Secretary of Energy Notice SEN-13-89, EM program policies and requirements, and commitments to Congress and the Office of Inspector General (IG). The Congressional commitment by DOE to develop and implement an ASP was in response to concerns raised by the Chairman of the Congressional Environment, Energy, and Natural Resources Subcommittee, and the Chairman of the Congressional Oversight and Investigations Subcommittee of the Committee on Energy and Commerce, regarding the production of analytical data. The development and implementation of an ASP also satisfies the IG's audit report recommendations on environmental analytical support, including development and implementation of a national strategy for acquisition of quality sampling and analytical services. These recommendations were endorsed in Departmental positions, which further emphasize the importance of the ASP to EM's programs. In September 1990, EM formed the Laboratory Management Division (LMD) in the Office of Technology Development to provide the programmatic direction needed to establish and operate an EM-wide ASP program. In January 1992, LMD issued the open-quotes Analytical Services Program Five-Year Plan.close quotes This document described LMD's strategy to ensure the production of timely, cost-effective, and credible environmental data. This presentation describes the overall LMD Analytical Services Program and, specifically, the various QA programs

  4. Quality assurance programs developed and implemented by the US Department of Energy`s Analytical Services Program for environmental restoration and waste management activities

    Energy Technology Data Exchange (ETDEWEB)

    Lillian, D.; Bottrell, D. [Dept. of Energy, Germntown, MD (United States)

    1993-12-31

    The U.S. Department of Energy`s (DOE`s) Office of Environmental Restoration and Waste Management (EM) has been tasked with addressing environmental contamination and waste problems facing the Department. A key element of any environmental restoration or waste management program is environmental data. An effective and efficient sampling and analysis program is required to generate credible environmental data. The bases for DOE`s EM Analytical Services Program (ASP) are contained in the charter and commitments in Secretary of Energy Notice SEN-13-89, EM program policies and requirements, and commitments to Congress and the Office of Inspector General (IG). The Congressional commitment by DOE to develop and implement an ASP was in response to concerns raised by the Chairman of the Congressional Environment, Energy, and Natural Resources Subcommittee, and the Chairman of the Congressional Oversight and Investigations Subcommittee of the Committee on Energy and Commerce, regarding the production of analytical data. The development and implementation of an ASP also satisfies the IG`s audit report recommendations on environmental analytical support, including development and implementation of a national strategy for acquisition of quality sampling and analytical services. These recommendations were endorsed in Departmental positions, which further emphasize the importance of the ASP to EM`s programs. In September 1990, EM formed the Laboratory Management Division (LMD) in the Office of Technology Development to provide the programmatic direction needed to establish and operate an EM-wide ASP program. In January 1992, LMD issued the {open_quotes}Analytical Services Program Five-Year Plan.{close_quotes} This document described LMD`s strategy to ensure the production of timely, cost-effective, and credible environmental data. This presentation describes the overall LMD Analytical Services Program and, specifically, the various QA programs.

  5. Multinational Quality Assurance

    Science.gov (United States)

    Kinser, Kevin

    2011-01-01

    Multinational colleges and universities pose numerous challenges to the traditional models of quality assurance that are designed to validate domestic higher education. When institutions cross international borders, at least two quality assurance protocols are involved. To guard against fraud and abuse, quality assurance in the host country is…

  6. Computer software quality assurance

    International Nuclear Information System (INIS)

    The author defines some criteria for the evaluation of software quality assurance elements for applicability to the regulation of the nuclear industry. The author then analyses a number of software quality assurance (SQA) standards. The major extracted SQA elements are then discussed, and finally specific software quality assurance recommendations are made for the nuclear industry

  7. Design quality assurance for nuclear power plants

    International Nuclear Information System (INIS)

    This Standard contains the requirements for the quality assurance program applicable to the design phase of a nuclear plant, and is applicable to the design of safety-related equipment, systems, and structures, as identified by the owner. 1 fig

  8. Quality Assurance Project Plan for the Environmental Monitoring Program in Waste Area Grouping 6 at Oak Ridge National Laboratory, Oak Ridge, Tennessee. Environmental Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    1993-12-01

    Waste Area Grouping (WAG) 6 is a hazardous and low-level radioactive waste disposal site at Oak Ridge National Laboratory (ORNL). Extensive site investigations have revealed contaminated surface water, sediments, groundwater, and soils. Based on the results of the Resource Conservation and Recovery Act (RCRA) Facility Investigation (RFI) conducted from 1989--1991 and on recent interactions with the US Environmental Protection Agency (EPA) and the Tennessee Department of Environment and Conservation (TDEC), a decision was made to defer implementing source control remedial measures at the WAG. The information shows WAG 6 contributes < 2% of the total off-site contaminant risk released over White Oak Dam (WOD). The alternative selected to address hazards at WAG 6 involves maintenance of site access controls to prevent public exposure to on-site contaminants, continued monitoring of contaminant releases to determine if source control measures will be required in the future, and development of technologies to support final remediation of WAG 6. This Quality Assurance Project Plan (QAPjP) has been developed as part of the Environmental Monitoring Plan for Waste Area Grouping 6 at Oak Ridge National Laboratory, Oak Ridge, Tennessee (DOE/OR/01-1192&D1). Environmental monitoring will be conducted in two phases: the baseline monitoring phase and the routine annual monitoring phase. The baseline monitoring phase will be conducted to establish the baseline contaminant release conditions at the Waste Area Grouping (WAG), to confirm the site-related chemicals of concern (COC), and to gather data to confirm the site hydrologic model. The baseline monitoring phase is expected to begin in 1994 and continue for 12-18 months. The routine annual monitoring phase will consist of continued sampling and analyses of COC to determine off-WAG contaminant flux, to identify trends in releases, and to confirm the COC. The routine annual monitoring phase will continue for {approximately}4 years.

  9. 44 CFR 7.9 - Assurances from institutions.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Assurances from institutions...) Nondiscrimination in FEMA-Assisted Programs-General § 7.9 Assurances from institutions. (a) In the case of any application for Federal financial assistance to an institution of higher education, the assurance required...

  10. 42 CFR 441.474 - Quality assurance and improvement plan.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Quality assurance and improvement plan. 441.474... pursue opportunities for system improvement. (b) The quality assurance and improvement plan shall also... SERVICES Optional Self-Directed Personal Assistance Services Program § 441.474 Quality assurance...

  11. New techniques in quality assurance

    International Nuclear Information System (INIS)

    GPU Nuclear Corp. has a multifaceted quality assurance (QA) program. This program includes a comprehensive QA organization to help ensure its implementation. The QA organization employs various techniques in assuring quality at GPU Nuclear. These techniques not only include the typical QA/quality-control verification activities, i.e., QA engineering, quality control, and audits, but also include some new innovative techniques. Several new techniques have been developed for verifying activities. These techniques include monitoring and functional audits of safety systems. Several new techniques for assessing performance and adequacy and effectiveness of plant and QA programs, such as plant assessments and QA systems engineering evaluations, have also been developed. This paper provides an overview of these and other new techniques being employed by GPU Nuclear's QA organization

  12. Quality assurance for health and environmental chemistry: 1986

    International Nuclear Information System (INIS)

    This report documents the continuing quality assurance efforts of the Health and Environmental Chemistry Group at the Los Alamos National Laboratory. The philosophy, methodology, and computing resources used by the quality assurance program to encompass the diversity of analytical chemistry practiced in the group are described. Included in the report are all quality assurance reference materials used, along with their certified or consensus concentrations, and all analytical chemistry quality assurance measurements made by HSE-9 during 1986. 27 refs., 3 figs

  13. Prototype international quality assurance program

    International Nuclear Information System (INIS)

    The international community presently lacks the ability to determine the quality and credibility of environmental measurements that is required to make sound decisions in matters related to international security, public health, and investment-related considerations. The ultimate goal of the work described in this article is to develop a credible information base including measurement capability for determination of environmental contamination and the potential for proliferation of material components of chemical or nuclear weapons. This study compared the accuracy obtained by six Russian and six U.S. laboratories for samples representative of classes of trace metals, dioxing-furans, and radioactive substances. The results obtained in this work indicate that current estimates for laboratory accuracy are likely overly optimistic. The weaknesses discovered by this prototype U.S. - Russia study also exist within the broader international community of laboratories. Further work is proposed to address the urgent need for the international community to improve performance evaluations for analytical measurements. (author)

  14. High assurance SPIRAL

    Science.gov (United States)

    Franchetti, Franz; Sandryhaila, Aliaksei; Johnson, Jeremy R.

    2014-06-01

    In this paper we introduce High Assurance SPIRAL to solve the last mile problem for the synthesis of high assurance implementations of controllers for vehicular systems that are executed in today's and future embedded and high performance embedded system processors. High Assurance SPIRAL is a scalable methodology to translate a high level specification of a high assurance controller into a highly resource-efficient, platform-adapted, verified control software implementation for a given platform in a language like C or C++. High Assurance SPIRAL proves that the implementation is equivalent to the specification written in the control engineer's domain language. Our approach scales to problems involving floating-point calculations and provides highly optimized synthesized code. It is possible to estimate the available headroom to enable assurance/performance trade-offs under real-time constraints, and enables the synthesis of multiple implementation variants to make attacks harder. At the core of High Assurance SPIRAL is the Hybrid Control Operator Language (HCOL) that leverages advanced mathematical constructs expressing the controller specification to provide high quality translation capabilities. Combined with a verified/certified compiler, High Assurance SPIRAL provides a comprehensive complete solution to the efficient synthesis of verifiable high assurance controllers. We demonstrate High Assurance SPIRALs capability by co-synthesizing proofs and implementations for attack detection and sensor spoofing algorithms and deploy the code as ROS nodes on the Landshark unmanned ground vehicle and on a Synthetic Car in a real-time simulator.

  15. SWiFT Software Quality Assurance Plan.

    Energy Technology Data Exchange (ETDEWEB)

    Berg, Jonathan Charles [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2016-01-01

    This document describes the software development practice areas and processes which contribute to the ability of SWiFT software developers to provide quality software. These processes are designed to satisfy the requirements set forth by the Sandia Software Quality Assurance Program (SSQAP). APPROVALS SWiFT Software Quality Assurance Plan (SAND2016-0765) approved by: Department Manager SWiFT Site Lead Dave Minster (6121) Date Jonathan White (6121) Date SWiFT Controls Engineer Jonathan Berg (6121) Date CHANGE HISTORY Issue Date Originator(s) Description A 2016/01/27 Jon Berg (06121) Initial release of the SWiFT Software Quality Assurance Plan

  16. Commissioning quality assurance for nuclear power plants

    International Nuclear Information System (INIS)

    This standard contains the requirements for the quality assurance program applicable to the commissioning phase of a nuclear power plant. This standard embodies the relevant quality assurance requirements of CSA Standard CAN3-N286.0, and is the governing Standard for commissioning quality assurance activities in the event of any conflicting requirements. This Standard applies to the commissioning of safety-related equipment, systems, and structures as identified by the owner. It may be applied to other equipment, systems, and structures at the discretion of the owner. 1 fig

  17. SAPHIRE 8 Software Quality Assurance Oversight

    Energy Technology Data Exchange (ETDEWEB)

    Kurt G. Vedros

    2011-09-01

    The software quality assurance oversight consists of updating and maintaining revision control of the SAPHIRE 8 quality assurance program documentation and of monitoring revision control of the SAPHIRE 8 source code. This report summarizes the oversight efforts through description of the revision control system (RCS) setup, operation and contents. Documents maintained under revision control include the Acceptance Test Plan (ATP), Configuration Management Plan, Quality Assurance Plan, Software Project Plan, Requirements Traceability Matrix (RTM), System Test Plan, SDP Interface Training Manual, and the SAPHIRE 8, 'New Features and Capabilities Overview'.

  18. Modality-dependent dose requirements in the Austrian breast cancer early detection program. First results from technical quality assurance; Geraeteabhaengiger Dosisbedarf im Oesterreichischen Brustkrebsfrueherkennungsprogramm. Erste Ergebnisse aus der technischen Qualitaetssicherung

    Energy Technology Data Exchange (ETDEWEB)

    Osanna-Elliott, A.; Semturs, F.; Menhart, S.; Schloegl, C.; Wildner, S.; Zwettler, G. [AGES, Wien (Austria). Referenzzentrum fuer technische Qualitaetssicherung im Brustkrebsfrueherkennungsprogramm

    2015-07-01

    The Austrian Breast Cancer Early Detection Program (BKFP) has officially started in January 2014. In order to ensure that all participating women can rely on a sufficient cancer detection rate while at the same time the required dose is as low as reasonably achievable, all participating radiology institutes (approx. 200) have to fulfill strict quality assurance requirements. The control and certification is performed by the Reference Center for Technical Quality Assurance (RefZQS), which has been developing the methods and tolerances in a pilot project since 2007. The limits are defined in the EUREF-Oeprotocol which is based on the European EPQC guidelines. From the requirement for optimized image quality while simultaneously following the ALARA principle, we found modality-dependent dose requirements, which we had expected but which have now been compiled for the first time for Austria.

  19. Quality assurance and organizational effectiveness in hospitals.

    OpenAIRE

    Hetherington, R W

    1982-01-01

    The purpose of this paper is to explore some aspects of a general theoretical model within which research on the organizational impacts of quality assurance programs in hospitals may be examined. Quality assurance is conceptualized as an organizational control mechanism, operating primarily through increased formalization of structures and specification of procedures. Organizational effectiveness is discussed from the perspective of the problem-solving theory of organizations, wherein effecti...

  20. High assurance services computing

    CERN Document Server

    2009-01-01

    Covers service-oriented technologies in different domains including high assurance systemsAssists software engineers from industry and government laboratories who develop mission-critical software, and simultaneously provides academia with a practitioner's outlook on the problems of high-assurance software development

  1. Authentication Assurance Levels

    International Nuclear Information System (INIS)

    This Common Criteria approach has been applied to create a definition of Authentication Assurance Levels that can quantify the level of assurance reached for a system subject to a set of authentication procedures. The arms-control authentication application of the Common Criteria expands on more typical information security evaluations in that it must contend with information barriers and preclude sophisticated intentional subversion attempts.

  2. Quality Assurance for Operation of Nuclear Facilities

    International Nuclear Information System (INIS)

    This report describes QA activities performed within 'Quality Assurance for Nuclear facility project' and results thereof. Efforts were made to maintain and improve quality system of nuclear facilities. Varification activities whether quality system was implemented in compliance with requirements. QA department assisted KOLAS accredited testing and calibration laboratories, ISO 9001 quality system, establishment of QA programs for R and D, and carried out reviews and surveys for development of quality assurance technologies. Major items of this report are as follows : - Development and Improvement of QA Programs - QA Activities - Assessment of Effectiveness and Adequacy for QA Programs

  3. MCNP trademark Software Quality Assurance plan

    International Nuclear Information System (INIS)

    MCNP is a computer code that models the interaction of radiation with matter. MCNP is developed and maintained by the Transport Methods Group (XTM) of the Los Alamos National Laboratory (LANL). This plan describes the Software Quality Assurance (SQA) program applied to the code. The SQA program is consistent with the requirements of IEEE-730.1 and the guiding principles of ISO 900

  4. DOE financial assurance presentation

    International Nuclear Information System (INIS)

    The presentation topic is California's approach to license application review in meeting financial assurances for the proposed Ward Valley site. The purpose of the presentation is to provide information on specific financial assurance provisions contained in 10 CFR Part 61 and how California intends to satisfy those requirements. Also, as rate setter, California intends to demonstrate how it will assure allowable costs to the rate base though a financial prudency review. The key provisions of financial assurance are: 10 CFR Section 61.61 - This provision requires an applicant to demonstrate its ability to finance licensed activities; 10 CFR Section 61.62 - This provision requires an applicant to provide assurance that sufficient funds will be available for site closure and stabilization; and 10 CFR Section 61.63 - This provision requires an applicant to provide 'a copy of a binding arrangement, such as a lease, between the applicant and the disposal site owner, so that sufficient funds will be available to cover the costs of the institutional control period.' To assist California in its determination of financial assurance compliance to be demonstrated by the applicant for Part 61 requirements, is NUREG guidance document 1199 'Standard Format and Content of a License Application for a Low-Level Radioactive Waste (LLRW) Disposal Facility.' The detailed financial assurance provisions of NUREG 1199 are then embodied in NUREG 1200, 'Standard Review Plant for the Review of a License Application for a LLRW Disposal Facility.'

  5. Software quality assurance handbook

    Energy Technology Data Exchange (ETDEWEB)

    1990-09-01

    There are two important reasons for Software Quality Assurance (SQA) at Allied-Signal Inc., Kansas City Division (KCD): First, the benefits from SQA make good business sense. Second, the Department of Energy has requested SQA. This handbook is one of the first steps in a plant-wide implementation of Software Quality Assurance at KCD. The handbook has two main purposes. The first is to provide information that you will need to perform software quality assurance activities. The second is to provide a common thread to unify the approach to SQA at KCD. 2 figs.

  6. Quality Assurance in Radiotherapy

    Science.gov (United States)

    Mckenzie, Alan

    A common feature of the Radiotherapy Centres where there have been major accidents involving incorrect radiotherapy treatment is that they did not operate good Quality Assurance systems. A Quality Assurance system is sometimes called a Quality Management system, and it is designed to give assurance that quality standards are being met. One of the "spin offs" from operating a Quality Management system is that it reduces the likelihood of a radiotherapy accident. A detailed account of how to set up a quality system in radiotherapy has been given in an ESTRO booklet.2

  7. Healthcare Software Assurance

    OpenAIRE

    Cooper, Jason G.; Pauley, Keith A.

    2006-01-01

    Software assurance is a rigorous, lifecycle phase-independent set of activities which ensure completeness, safety, and reliability of software processes and products. This is accomplished by guaranteeing conformance to all requirements, standards, procedures, and regulations. These assurance processes are even more important when coupled with healthcare software systems, embedded software in medical instrumentation, and other healthcare-oriented life-critical systems. The current Food and Dru...

  8. RAVEN Quality Assurance Activities

    International Nuclear Information System (INIS)

    This report discusses the quality assurance activities needed to raise the Quality Level of Risk Analysis in a Virtual Environment (RAVEN) from Quality Level 3 to Quality Level 2. This report also describes the general RAVEN quality assurance activities. For improving the quality, reviews of code changes have been instituted, more parts of testing have been automated, and improved packaging has been created. For upgrading the quality level, requirements have been created and the workflow has been improved.

  9. RAVEN Quality Assurance Activities

    Energy Technology Data Exchange (ETDEWEB)

    Cogliati, Joshua Joseph [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-01

    This report discusses the quality assurance activities needed to raise the Quality Level of Risk Analysis in a Virtual Environment (RAVEN) from Quality Level 3 to Quality Level 2. This report also describes the general RAVEN quality assurance activities. For improving the quality, reviews of code changes have been instituted, more parts of testing have been automated, and improved packaging has been created. For upgrading the quality level, requirements have been created and the workflow has been improved.

  10. Quality assurance in radiotherapy

    International Nuclear Information System (INIS)

    Quality assurance in the management of a patient receiving radiation therapy and the role of the radiation oncologist and medical physicist in this process is described. The constraints on available personnel are recognised and the need for further education resources and IAEA activities in education for both groups described. IAEA activities in the clinical and dosimetric aspects and the resultant publications and education have contributed to a culture of quality assurance. (author)

  11. Operation assurance strategy and experience for N Reactor plant systems

    International Nuclear Information System (INIS)

    A strategy and program to assure continued productive, safe and reliable N Reactor plant system operation has been developed. It is currently in the process of implementation. The program provides a surveillance-based predictive maintenance program and a definition of plant modifications for the purpose of assuring plant system operation. The major strategy elements are program development, technical issue definition, equipment performance baseline development, equipment performance prediction, and equipment performance degradation corrective action implementation

  12. Next Generation CANDU Performance Assurance

    International Nuclear Information System (INIS)

    AECL is developing a next generation CANDU design to meet market requirements for low cost, reliable energy supplies. The primary product development objective is to achieve a capital cost substantially lower than the current nuclear plant costs, such that the next generation plant will be competitive with alternative options for large-scale base-load electricity supply. However, other customer requirements, including safety, low-operating costs and reliable performance, are being addressed as equally important design requirements. The main focus of this paper is to address the development directions that will provide performance assurance. The next generation CANDU is an evolutionary extension of the proven CANDU 6 design. There are eight CANDU 6 units in operation in four countries around the world and further three units are under construction. These units provide a sound basis for projecting highly reliable performance for the next generation CANDU. In addition, the next generation CANDU program includes development and qualification activities that will address the new features and design extensions in the advanced plant. To limit product development risk and to enhance performance assurance, the next generation CANDU design features and performance parameters have been carefully reviewed during the concept development phase and have been deliberately selected so as to be well founded on the existing CANDU knowledge base. Planned research and development activities are required only to provide confirmation of the projected performance within a modest extension of the established database. Necessary qualification tests will be carried out within the time frame of the development program, to establish a proven design prior to the start of a construction project. This development support work coupled with ongoing AECL programs to support and enhance the performance and reliability of the existing CANDU plants will provide sound assurance that the next generation

  13. Repository construction management and quality assurance

    International Nuclear Information System (INIS)

    An emphasis on preventive rather than reactive management is key to an efficient construction management operation. Development of contingency plans to deal with unexpected adverse conditions, e.g., brine pockets during mining operations, are an integral part of the management program to ensure project safety, quality, cost, schedule and environmental objectives are met. A viable quality assurance program with active management support will optimize management effectiveness in reaching project goals. With adequate planning and perceptive application of the proper management controls, Quality Assurance becomes an essential ingredient for efficiently managing a job because it has been built into the management system rather than being an uninvolved peripheral entity. 6 references, 3 figures

  14. Quality assurance program guidelines for application to and use by manufacturers of rail/guideway vehicles, buses, automatic train control systems, and their major subsystems

    Science.gov (United States)

    Witkin, S. A.

    1976-01-01

    Guidelines are presented for a quality assurance system to be implemented by the manufacturer in support of designing, developing, fabricating, assembling, inspecting, testing, handling, and delivery of equipment being procured for use in public urban mass transit systems. The guidelines apply to this equipment when being procured for: (1) use in revenue service; (2) demonstration of systems that will be revenue producing or used by the public; (3) use as a prototype for follow-on operational/revenue producing equipment procurements; and (4) qualification tests.

  15. Assuring structural integrity in Army systems

    Science.gov (United States)

    1985-01-01

    The object of this study was to recommend possible improvements in the manner in which structural integrity of Army systems is assured. The elements of a structural integrity program are described, and relevant practices used in various industries and government organizations are reviewed. Some case histories of Army weapon systems are examined. The mandatory imposition of a structural integrity program patterned after the Air Force Aircraft Structural Integrity Program is recommended and the benefits of such an action are identified.

  16. Quality assurance requirements for an institution with diverse technical activities at the Nevada test site (NTS)

    International Nuclear Information System (INIS)

    The author describes the Nevada test site's restructuring of its approach to quality assurance. Basic requirements are being expanded and augmented. The nature of the quality assurance program is discussed

  17. Quality assurance in design

    International Nuclear Information System (INIS)

    Full text: Safety of the nuclear power plant depends on design, manufacturing, construction, commissioning and operation of plant. To ensure that all the constituent phases are performed as per intent, quality assurance is extremely important. NPCIL has developed a quality assurance programme for all above constituent phases for ensuring safety of public and site personnel. A topical quality assurance document at corporate level gives broad based policy document on quality assurance programme of NPCIL. For design and engineering services, a quality assurance programme has been developed based on ISO 9001 and AERB Code No. SC/QA. To ensure nuclear reactor safety, the design activities are carried out under controlled conditions which include: (i) establishment and maintenance of procedures describing how the design activities are to be carried out, (ii) assignment of design tasks to appropriately qualified and experienced personnel, (iii) compliance with codes, standards and regulatory requirements, (iv) incorporation of customer feedbacks/corrective and preventative actions, (v) compliance with quality plans and procedures., (vi) design control, (vii) proper document and data control, (viii) use of validated soft wares, (ix) review of consultants design, design documents at appropriate stages, (x) preparation, review and approval of designs and design documents by competent persons, (xi) AERB review of safety related design basis reports (DBRs), (xii) periodic internal quality audits for verifying the compliance to QA system, (xiii) periodic external audits by ISO 9001 certifying agency and NPCIL QA directorate, (xiv) Nonconformance control

  18. Rastreabilidade das referências metrológicas em dose absorvida na água do Programa de Qualidade em Dosimetria Traceability of metrologic references of dose absorbed to water used in a Dosimetry Quality Assurance Program

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo de Almeida

    2005-06-01

    Full Text Available OBJETIVO: Este trabalho tem por objetivo apresentar a estrutura solidamente estabelecida de rastreabilidade dos padrões ionométricos e do sistema de medidas com dosímetros termoluminescentes, como parte da confiabilidade do Programa de Qualidade em Dosimetria (PQD, que visa a garantir o mais elevado nível de exatidão às suas medidas. MATERIAIS E MÉTODOS: A exemplo de outros programas, usaram-se dosímetros termoluminescentes (DTL 937 na forma de pó, colocados em uma cápsula de plástico, em "kits" específicos para cada aplicação, os quais foram enviados, por via postal, aos centros participantes. RESULTADOS: Os resultados da intercomparação realizada entre o Laboratório de Ciências Radiológicas da Universidade do Estado do Rio de Janeiro e o EQUAL-ESTRO para o feixe de raios gama de 60Co, expressos para (1sigma, e os resultados das medidas de dose absorvida, obtidos com as câmaras dp Programa EQUAL e as câmaras do PQD, apresentaram discordância menor que 0,5%. CONCLUSÃO: Dos resultados conclui-se que o PQD alcançou o nível desejado de confiabilidade, necessário à implementação do Programa.OBJECTIVE: To present the solidly established traceability structure for ionometric standards and for thermoluminescent dosimetry system that ensures reliability of the Dosimetry Quality Assurance Program and is aimed to certify the highest level of accuracy of the measurements. MATERIALS AND METHODS: Thermoluminescent powder dosimeters (DTL 937 placed into plastic capsules and packed in specific kits for each intended application were mailed to the participant centers. RESULTS: The results of the intercomparisons performed between "Laboratório de Ciências Radiológicas da Universidade do Estado do Rio de Janeiro" and EQUAL-ESTRO for the beam of 60Co gamma rays, expressed for (1sigma, and the results of the dose absorbed measurements obtained with the chambers of the Program EQUAL and the chambers of the Dosimetry Quality Assurance

  19. Vega flow assurance system

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Marit; Munaweera, Sampath

    2010-07-01

    Vega is a gas condensate field located at the west coast of Norway and developed as a tie-in to the Gjoea platform. Operator is Statoil, production startup is estimated to the end of 2010. Flow assurance challenges are high reservoir pressure and temperature, hydrate and wax control, liquid accumulation and monitoring the well/template production rates. The Vega Flow Assurance System (FAS) is a software that supports monitoring and operation of the field. The FAS is based FlowManagerTM designed for real time systems. This is a flexible tool with its own steady state multiphase- and flow assurance models. Due to the long flowlines lines and the dynamic behavior, the multiphase flow simulator OLGA is also integrated in the system. Vega FAS will be used as: - An online monitoring tool - An offline what-if simulation and validation tool - An advisory control system for well production allocation. (Author)

  20. Quality assurance for health and environmental chemistry: 1989

    International Nuclear Information System (INIS)

    This report documents the continuing quality assurance efforts of the Health and Environmental Chemistry Group (HSE-9) at the Los Alamos National Laboratory. The philosophy, methodology, computing resources, and laboratory information management system used by the quality assurance program to encompass the diversity of analytical chemistry practiced in the group are described. Included in the report are all quality assurance reference materials used, along with their certified or consensus concentrations, and all analytical chemistry quality assurance measurements made by HSE-9 during 1989. 38 refs., 8 figs., 3 tabs

  1. REGIONAL AIR POLLUTION STUDY, QUALITY ASSURANCE AUDITS

    Science.gov (United States)

    RAPS Quality Assurance audits were conducted under this Task Order in continuation of the audit program previously conducted under Task Order No. 58. Quantitative field audits were conducted of the Regional Air Monitoring System (RAMS) Air Monitoring Stations, Local Air Monitorin...

  2. 222-S Laboratory Quality Assurance Plan. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Meznarich, H.K.

    1995-07-31

    This Quality Assurance Plan provides,quality assurance (QA) guidance, regulatory QA requirements (e.g., 10 CFR 830.120), and quality control (QC) specifications for analytical service. This document follows the U.S Department of Energy (DOE) issued Hanford Analytical Services Quality Assurance Plan (HASQAP). In addition, this document meets the objectives of the Quality Assurance Program provided in the WHC-CM-4-2, Section 2.1. Quality assurance elements required in the Guidelines and Specifications for Preparing Quality Assurance Program Plans (QAMS-004) and Interim Guidelines and Specifications for Preparing Quality Assurance Project Plans (QAMS-005) from the US Environmental Protection Agency (EPA) are covered throughout this document. A quality assurance index is provided in the Appendix A. This document also provides and/or identifies the procedural information that governs laboratory operations. The personnel of the 222-S Laboratory and the Standards Laboratory including managers, analysts, QA/QC staff, auditors, and support staff shall use this document as guidance and instructions for their operational and quality assurance activities. Other organizations that conduct activities described in this document for the 222-S Laboratory shall follow this QA/QC document.

  3. 222-S Laboratory Quality Assurance Plan. Revision 1

    International Nuclear Information System (INIS)

    This Quality Assurance Plan provides,quality assurance (QA) guidance, regulatory QA requirements (e.g., 10 CFR 830.120), and quality control (QC) specifications for analytical service. This document follows the U.S Department of Energy (DOE) issued Hanford Analytical Services Quality Assurance Plan (HASQAP). In addition, this document meets the objectives of the Quality Assurance Program provided in the WHC-CM-4-2, Section 2.1. Quality assurance elements required in the Guidelines and Specifications for Preparing Quality Assurance Program Plans (QAMS-004) and Interim Guidelines and Specifications for Preparing Quality Assurance Project Plans (QAMS-005) from the US Environmental Protection Agency (EPA) are covered throughout this document. A quality assurance index is provided in the Appendix A. This document also provides and/or identifies the procedural information that governs laboratory operations. The personnel of the 222-S Laboratory and the Standards Laboratory including managers, analysts, QA/QC staff, auditors, and support staff shall use this document as guidance and instructions for their operational and quality assurance activities. Other organizations that conduct activities described in this document for the 222-S Laboratory shall follow this QA/QC document

  4. Basic Study of Establishment of Quality Assurance Processes to Develop an Integrated Quality Assurance System for Nuclear Power Plant Construction

    International Nuclear Information System (INIS)

    An integrated quality assurance system has necessitated carrying out quality assurance programs in a systematic manner because the opportunities to expand business in overseas markets have increased since the export of a nuclear power plant to UAE in 2009. In this study, we use PDCA method to systematically analyze the quality assurance procedures that were used in previous projects for constructing nuclear power plants. We reached a classification system of quality assurance processes at each phase of nuclear power plant construction by integrating similar work related to quality such as planning, design, equipment manufacturing, construction and start-up. We also established a hierarchy of quality assurance processes to develop an integrated quality assurance system as a technology goal to be developed later. To obtain most updated quality assurance activities, a quality assurance process is structured by integrating similar works analyzed from quality assurance procedures through PDCA cycle method. At the implementation phase of Hierarchy of quality processes and sequence of processes for constructing nuclear power plant are established in this study. Integrated quality assurance system is to be developed by connecting organizations as well as stakeholders such as owners, Architect engineering, suppliers, contractors, and sub-contractors to carry out assigned work efficiently

  5. Quality Assurance Source Requirements Traceability Database

    International Nuclear Information System (INIS)

    At the Yucca Mountain Project the Project Requirements Processing System assists in the management of relationships between regulatory and national/industry standards source criteria, and Quality Assurance Requirements and Description document (DOE/R W-0333P) requirements to create compliance matrices representing respective relationships. The matrices are submitted to the U.S. Nuclear Regulatory Commission to assist in the commission's review, interpretation, and concurrence with the Yucca Mountain Project QA program document. The tool is highly customized to meet the needs of the Office of Civilian Radioactive Waste Management Office of Quality Assurance

  6. Quality Assurance for All

    Science.gov (United States)

    Cheung, Peter P. T.; Tsui, Cecilia B. S.

    2010-01-01

    For higher education reform, most decision-makers aspire to achieving a higher participation rate and a respectable degree of excellence with diversity at the same time. But very few know exactly how. External quality assurance is a fair basis for differentiation but there can be doubt and resistance in some quarters. Stakeholder interests differ…

  7. Mission Operations Assurance

    Science.gov (United States)

    Faris, Grant

    2012-01-01

    Integrate the mission operations assurance function into the flight team providing: (1) value added support in identifying, mitigating, and communicating the project's risks and, (2) being an essential member of the team during the test activities, training exercises and critical flight operations.

  8. Quality assurance in radiochemical/radiopharmaceutical manufacturing

    International Nuclear Information System (INIS)

    A general overview of a good Quality Assurance program will be presented with specific references to Nordion International Inc.'s QA program. Topics to be covered will include: facilities, equipment, training, raw material testing, manufacturing control, finished product testing, records and archives. Nordion's audit procedures with resulting corrective actions and documentation procedures will be outlined. Examples will be given of statistical process control and the use of teams as a means of moving responsibility down the ladder

  9. Hanford Tanks Initiative quality assurance implementation plan

    International Nuclear Information System (INIS)

    Hanford Tanks Initiative (HTI) Quality Assurance Implementation Plan for Nuclear Facilities defines the controls for the products and activities developed by HTI. Project Hanford Management Contract (PHMC) Quality Assurance Program Description (QAPD)(HNF-PRO599) is the document that defines the quality requirements for Nuclear Facilities. The QAPD provides direction for compliance to 10 CFR 830.120 Nuclear Safety Management, Quality Assurance Requirements. Hanford Tanks Initiative (HTI) is a five-year activity resulting from the technical and financial partnership of the US Department of Energy's Office of Waste Management (EM-30), and Office of Science and Technology Development (EM-50). HTI will develop and demonstrate technologies and processes for characterization and retrieval of single shell tank waste. Activities and products associated with HTI consist of engineering, construction, procurement, closure, retrieval, characterization, and safety and licensing

  10. Assuring quality in high-consequence engineering

    Energy Technology Data Exchange (ETDEWEB)

    Hoover, Marcey L. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Kolb, Rachel R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2014-03-01

    In high-consequence engineering organizations, such as Sandia, quality assurance may be heavily dependent on staff competency. Competency-dependent quality assurance models are at risk when the environment changes, as it has with increasing attrition rates, budget and schedule cuts, and competing program priorities. Risks in Sandia's competency-dependent culture can be mitigated through changes to hiring, training, and customer engagement approaches to manage people, partners, and products. Sandia's technical quality engineering organization has been able to mitigate corporate-level risks by driving changes that benefit all departments, and in doing so has assured Sandia's commitment to excellence in high-consequence engineering and national service.

  11. Quality assurance and protecting the environment

    International Nuclear Information System (INIS)

    The author discusses how the difficulties which inhibit the wider use of nuclear power as an environmentally attractive energy option are attributable in important measure to insufficient attention to quality assurance and related engineering standards. While significant advances have been made in both areas, they have contributed most to systems and components defined as important to safety, where they are mandatory, and less to the Balance of Plant, which has an important influence on reliability. Taking full advantage of the environmental benefits of nuclear power implies bringing the reliability of plants generally up to the levels of the best performers among them. This implies more effective application of quality assurance to the Balance of plant. It also requires that the development of plants of advanced design take advantage of the experience of earlier reactor development programs as regards quality assurance and engineering standards

  12. Quality assurance during site construction. Pt. 1

    International Nuclear Information System (INIS)

    The first part of the lecture deals with the Quality Assurance system on the construction site in general. Basic site-related problems during contract implementation and the QA system requirements resulting from them are presented. The compilation of these requirements in a QA program and its inclusion in the site manual in written form are explained. Site organization, personnel qualification and procedures are referred to. Whereas the first part shows what is to be done, the second part shows how it can be put into practice on the site. All the essential points for the assurance of quality are addressed. They include, e.g., review of documents, incoming goods control, in-process surveillance, store controls, identification of components and systems, dealing with changes and deviations, documentation control and audits. By means of examples taken form practice the necessity of a well-functioning QA system, and the importance of quality-assuring measures on the site are pointed out. (orig.)

  13. Quality assurance standards for purchasing and inventory control.

    Science.gov (United States)

    Soares, D P

    1985-03-01

    A process is described for quality assurance in pharmaceutical purchasing and inventory control. A quality assurance program should ensure that quality drugs are purchased at the lowest price, drug products are available when needed, the system is managed efficiently, internal controls are provided, drug products are stored under appropriate conditions, and laws, regulations, accreditation standards, and procedures are followed. To meet these objectives, product quality, vendor performance, the department's system of internal controls, purchasing data, and storage conditions should be monitored. A checklist for evaluating purchasing and inventory practices and a sample audit form listing quality assurance criteria, standards, procedures, and recommended actions are provided. A quality assurance program for pharmaceutical purchasing and inventory control should define institution-specific criteria and standards and use these standards for continual evaluation of all aspects of the purchasing and inventory control system. Documentation of quality assurance activities should be provided for use by the purchasing department, hospital administration, and regulatory bodies. PMID:3985026

  14. Quality assurance for gamma knives

    Energy Technology Data Exchange (ETDEWEB)

    Jones, E.D.; Banks, W.W.; Fischer, L.E. [Lawrence Livermore National Lab., CA (United States)

    1995-09-01

    This report describes and summarizes the results of a quality assurance (QA) study of the Gamma Knife, a nuclear medical device used for the gamma irradiation of intracranial lesions. Focus was on the physical aspects of QA and did not address issues that are essentially medical, such as patient selection or prescription of dose. A risk-based QA assessment approach was used. Sample programs for quality control and assurance are included. The use of the Gamma Knife was found to conform to existing standards and guidelines concerning radiation safety and quality control of external beam therapies (shielding, safety reviews, radiation surveys, interlock systems, exposure monitoring, good medical physics practices, etc.) and to be compliant with NRC teletherapy regulations. There are, however, current practices for the Gamma Knife not covered by existing, formalized regulations, standards, or guidelines. These practices have been adopted by Gamma Knife users and continue to be developed with further experience. Some of these have appeared in publications or presentations and are slowly finding their way into recommendations of professional organizations.

  15. Quality assurance for gamma knives

    International Nuclear Information System (INIS)

    This report describes and summarizes the results of a quality assurance (QA) study of the Gamma Knife, a nuclear medical device used for the gamma irradiation of intracranial lesions. Focus was on the physical aspects of QA and did not address issues that are essentially medical, such as patient selection or prescription of dose. A risk-based QA assessment approach was used. Sample programs for quality control and assurance are included. The use of the Gamma Knife was found to conform to existing standards and guidelines concerning radiation safety and quality control of external beam therapies (shielding, safety reviews, radiation surveys, interlock systems, exposure monitoring, good medical physics practices, etc.) and to be compliant with NRC teletherapy regulations. There are, however, current practices for the Gamma Knife not covered by existing, formalized regulations, standards, or guidelines. These practices have been adopted by Gamma Knife users and continue to be developed with further experience. Some of these have appeared in publications or presentations and are slowly finding their way into recommendations of professional organizations

  16. Quality assurance of BNCT dosimetry

    International Nuclear Information System (INIS)

    The Phase I clinical trials for boron neutron capture therapy (BNCT) started in May 1999 in Otaniemi, Espoo. For BNCT no uniform international guidance for the quality assurance of dosimetry exists, so far. Because of the complex dose distribution with several different dose components, the international recommendations on conventional radiotherapy dosimetry are not applicable in every part. Therefore, special guidance specifically for BNCT is needed. To obtain such guidelines a European collaboration project has been defined. The aim of the project is a generally accepted Code of Practice for use by all European BNCT centres. This code will introduce the traceability of the dosimetric methods to the international measurement system. It will also ensure the comparability of the results in various BNCT beams and form the basis for the comparison of the treatment results with the conventional radiotherapy or other treatment modalities. The quality assurance of the dosimetry in BNCT in Finland covers each step of the BNCT treatment, which include dose planning imaging, dose planning, boron infusion, boron kinetics, patient positioning, monitoring of the treatment beam, characterising the radiation spectrum, calibration of the beam model and the dosimetric measurements both in patients (in viva measurements) and in various phantoms. The dose planning images are obtained using a MR scanner with MRI sensitive markers and the dose distribution is computed with a dose planning software BNCTRtpe. The program and the treatment beam (DORT) model used have been verified with measurements and validated with MCNP calculations in phantom. Dosimetric intercomparison has been done with the Brookhaven BNCT beam (BMRR). Before every patient irradiation the relationship between the beam monitor pulse rate and neutron fluence rate in the beam is checked by activation measurements. Kinetic models used to estimate the time-behavior of the blood boron concentration have been verified

  17. Education for All in South Africa: Developing a National System for Quality Assurance.

    Science.gov (United States)

    Smith, William J.; Ngoma-Maema, Wendy Yolisa

    2003-01-01

    Draws on international research, policy, and practice relevant to quality assurance systems to analyze the development of a national framework for educational quality assurance in South Africa. Describes an emerging framework for quality assurance that encompasses evaluation of student achievement, quality audits and reviews, program and service…

  18. Quality Assurance Techniques in OpenUP (Open Unified Process)

    OpenAIRE

    Sardar, Raham; Fazal, Usman

    2011-01-01

    Agile methods change the software processes. Agile processes such as Scrum, ExtremeProgramming (XP), Open Unified Process (OpenUP) etc. have techniques that improve softwarequality. No doubt that the purpose of these techniques is to inject quality assurance into theproject under development. This thesis presents quality assurance techniques in Open UnifiedProcess (OpenUP) along with comparative study to extreme programming (XP) for agilesoftware development. OpenUP is an agile and unified pr...

  19. Revenue assurance in utilities

    OpenAIRE

    Rihar, Miha

    2010-01-01

    In recent times utility companies have to orient to effective business due to hard market conditions. Thus, companies want to diminish business expenses and increase the revenues. Effective revenue capture is, after all, the aim of revenue assurance. Actually the revenue capture is usually not perfect and without losses. A part of revenues are always lost on the way from a service to payment, which is called revenue leakage and causes a financial loss. The revenue leakage is above all the ...

  20. Quality assurance in radiotherapy

    International Nuclear Information System (INIS)

    Good radiotherapy results and safety of treatment require the radiation to be optimally applied to a specified target area and the correct dose. According to international recommendations, the average uncertainty in therapeutic dose should not exceed 5%. The need for high precision in therapeutic dose requires quality assurance covering the entire radiotherapy process. Besides the physical and technical characteristics of the therapy equipment, quality assurance must include all radiotherapy equipment and procedures that are significant for the correct magnitude and precision of application of the therapeutic dose. The duties and responsibilities pertaining to various stages of treatment must also be precisely defined. These requirements may be best implemented through a quality system. The general requirements for supervision and quality assurance of medical radiation apparatus are prescribed in section 40 of the Radiation Act (592/1991, amendment 1142/1998) and in sections 18 and 32 of the Decree of the Ministry of Social Affairs and Health on the medical use of radiation (423/2000). Guide ST 2.2 imposes requirements on structural radiation shielding of radiotherapy equipment and the premises in which it is used, and on warning and safety arrangements. Guide ST 1.1 sets out the general safety principles for radiation practices and regulatory control procedure for the use of radiation. Guide ST 1.6 provides general requirements for operational measures in the use of radiation. This Guide sets out the duties of responsible parties (the party running a radiation practice) in respect of arranging and maintaining radiotherapy quality assurance. The principles set out in this Guide and Guide ST 6.3 may be applied to radionuclide therapy

  1. Power transformers quality assurance

    CERN Document Server

    Dasgupta, Indrajit

    2009-01-01

    About the Book: With the view to attain higher reliability in power system operation, the quality assurance in the field of distribution and power transformers has claimed growing attention. Besides new developments in the material technology and manufacturing processes of transformers, regular diagnostic testing and maintenance of any engineering product may be ascertained by ensuring: right selection of materials and components and their quality checks. application of correct manufacturing processes any systems engineering. the user`s awareness towards preventive maintenance. The

  2. Introduction to quality assurance

    International Nuclear Information System (INIS)

    Safety requirements set forth in the regulatory requirement, codes, standards as well as other requirements for various aspects of nuclear power plant design and operation are strictly implemented through QA activities. The overall QA aim is to assure that the plant is soundly and correctly designed and that it is built, tested and operated in accordance with stringent quality standards and conservative engineering practices. In this way a high degree of freedom from faults and errors can be achieved. (orig.)

  3. Quality Assurance Project Plan for the Environmental Monitoring Program in Waste Area Grouping 6 at Oak Ridge National Laboratory, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    Waste Area Grouping (WAG) 6 is a hazardous and low-level radioactive waste disposal site at Oak Ridge National Laboratory (ORNL). Extensive site investigations have revealed contaminated surface water, sediments, groundwater, and soils. Based on the results of the Resource Conservation and Recovery Act (RCRA) Facility Investigation (RFI) conducted from 1989--1991 and on recent interactions with the US Environmental Protection Agency (EPA) and the Tennessee Department of Environment and Conservation (TDEC), a decision was made to defer implementing source control remedial measures at the WAG. The information shows WAG 6 contributes < 2% of the total off-site contaminant risk released over White Oak Dam (WOD). The alternative selected to address hazards at WAG 6 involves maintenance of site access controls to prevent public exposure to on-site contaminants, continued monitoring of contaminant releases to determine if source control measures will be required in the future, and development of technologies to support final remediation of WAG 6. This Quality Assurance Project Plan (QAPjP) has been developed as part of the Environmental Monitoring Plan for Waste Area Grouping 6 at Oak Ridge National Laboratory, Oak Ridge, Tennessee (DOE/OR/01-1192 ampersand D1). Environmental monitoring will be conducted in two phases: the baseline monitoring phase and the routine annual monitoring phase. The baseline monitoring phase will be conducted to establish the baseline contaminant release conditions at the Waste Area Grouping (WAG), to confirm the site-related chemicals of concern (COC), and to gather data to confirm the site hydrologic model. The baseline monitoring phase is expected to begin in 1994 and continue for 12-18 months. The routine annual monitoring phase will consist of continued sampling and analyses of COC to determine off-WAG contaminant flux, to identify trends in releases, and to confirm the COC. The routine annual monitoring phase will continue for ∼4 years

  4. Revenue assurance methodology

    OpenAIRE

    Filipová, Michaela

    2006-01-01

    Práce se zabývá návrhem uceleného teoreticko-metodologického rámce nové podnikové funkce revenue assurance pro telekomunikační společnosti, které usilují o systematický a koncepční přístup k zajištění a maximalizaci příjmů. Popsány jsou role revenue assurance funkce v podniku, cíle, vývojová stádia. Dále jsou popsány hrozby a konkrétní podoby úniků a nadhodnocení příjmů. Podrobně je rozebrána metodika pro plnění úkolů revenue assurance a techniky pro eliminaci úniků a nadhodnocení příjmů. Prá...

  5. Mammography quality assurance in Morocco

    International Nuclear Information System (INIS)

    The 'Centre National de l'Energie, des Sciences et des Techniques Nucleaires' (CNESTEN) realised, from February 1999 to March 2000, a quality control of 41 mammography facilities in Morocco. The protocol and standards adopted for achieving the control of elements constituting the mammography chain are those elaborated by GIM and Qualix association. Statistics and conformities results are presented. The program was performed in order to demonstrate to the practitioners in mammography field, the utility and necessity to have a national quality assurance policy. The main objective of CNESTEN is to be accredited by the Moroccan government as a reference laboratory in quality control and dose evaluation in medical imaging and radiotherapy. To achieve this goal the CNESTEN has set up Medical Physic Unit well trained and equipped with the necessary instruments. (author)

  6. Quality assurance and radiofrequency heating

    International Nuclear Information System (INIS)

    One pf the potential problems and limitations of scanning at high field strength is the deposition or radiofrequency (RF) power into the body. This paper proposes an inexpensive means of assessing radiofrequency power deposition in a magnet. This is particularly important at 3T where sequences approach Food and Drug Administration approved RF limits. It will also be of interest to operators at 1.5 T as part of their ongoing quality assurance programs. At 3T, we found that the RF power deposited in the magnet was less than that read by the MR power monitor. All measurements were performed with a 2.51 perspex spherical phantom. Copyright (2002) Blackwell Science Pty Ltd

  7. Specified assurance level sampling procedure

    International Nuclear Information System (INIS)

    In the nuclear industry design specifications for certain quality characteristics require that the final product be inspected by a sampling plan which can demonstrate product conformance to stated assurance levels. The Specified Assurance Level (SAL) Sampling Procedure has been developed to permit the direct selection of attribute sampling plans which can meet commonly used assurance levels. The SAL procedure contains sampling plans which yield the minimum sample size at stated assurance levels. The SAL procedure also provides sampling plans with acceptance numbers ranging from 0 to 10, thus, making available to the user a wide choice of plans all designed to comply with a stated assurance level

  8. Quality Assurance of Ultrasonic Diagnosis in Breast

    International Nuclear Information System (INIS)

    Sonography is a subjective diagnostic method which is highly dependent on the experience of the operator and the equipment quality which requires real-time adjustments. Breast screening examination currently consists of clinical examination and mammography. Breast sonography, either supplementary to mammography or independently, is indicated for the dense breast, especially in younger women. Breast sonography is especially applicable for Korean women because of the denser breast parenchyma and the approximately 10-year younger incidence rate of breast cancer of Korean women compared to western women. To avoid unnecessary breast biopsy because of the high rate of false positive lesions in breast parenchyma, which is different from other body organs such as the liver or the kidney, a quality assurance program for breast sonography is essential. The quality assurance of breast ultrasound involves quality assurance of the equipment, imaging display and acquisition of clinical images, personnel qualifications and other aspects such as unification of lexicon, guideline of diagnostic examination and reporting system; US BI-RAD reporting system, assessment items and organization, education program, medical audit, certification issues, and medicolegal issues. A breast sonographic quality assurance system should be established before a scheme to initiate governmental medical insurance for breast sonography

  9. Quality Assurance of Ultrasonic Diagnosis in Breast

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Soo Young; Kim, Hong Dae [Hallym University, Kangnam Sacred Heart Hospital, Seoul (Korea, Republic of)

    2006-06-15

    Sonography is a subjective diagnostic method which is highly dependent on the experience of the operator and the equipment quality which requires real-time adjustments. Breast screening examination currently consists of clinical examination and mammography. Breast sonography, either supplementary to mammography or independently, is indicated for the dense breast, especially in younger women. Breast sonography is especially applicable for Korean women because of the denser breast parenchyma and the approximately 10-year younger incidence rate of breast cancer of Korean women compared to western women. To avoid unnecessary breast biopsy because of the high rate of false positive lesions in breast parenchyma, which is different from other body organs such as the liver or the kidney, a quality assurance program for breast sonography is essential. The quality assurance of breast ultrasound involves quality assurance of the equipment, imaging display and acquisition of clinical images, personnel qualifications and other aspects such as unification of lexicon, guideline of diagnostic examination and reporting system; US BI-RAD reporting system, assessment items and organization, education program, medical audit, certification issues, and medicolegal issues. A breast sonographic quality assurance system should be established before a scheme to initiate governmental medical insurance for breast sonography

  10. Quality assurance through the implementation of a maintenance program developed at the cryogenic pilot installation for tritium and deuterium separation (ISTD)

    International Nuclear Information System (INIS)

    The exploitation of the Installation ISTD in safe and security conditions and economical efficiency assumes that the entire ensemble of the maintenance activities is realized in an QA regime according to the maintenance program. The Program of Maintenance is described like a matrix of integrated activities of ISTD, defined in the Manual of QA. A systematic approach of the Maintenance Program, imposes taking into account of the entire technical system of ISTD, namely, the so-called ISTD Installation in which the basic technological processes are carried on as well as, the main building, the annexes and utilities. The Program of Maintenance has an internal and external strategy both of them realized depending on the following objectives and quality indicators: - reduction of the number of stops in installation; - maximizing the availability of the security system; - reduction of the number of serious failures of operation process which affect the function of the special system of security; - reduction of the rate of accidents; - reduction the radiological exposure; - reduction of the activities by required by maintenance; - maximize of the productivity; - reduction of the radioactivity wastes produced especially when the activity is interrupted. The maintenance systems includes activities of: CORMENT (corrective maintenance ); PREMENT ( preventive maintenance ( diagnosis )); PREDICMENT (continually monitoring maintenance ); PROACTIVMENT (performances corresponding with requirement and restrictions ). These activities constitute an internal strategy and are realized in an efficient balance depending on static and dynamic nature of the equipment of ISTD. The external strategy is constituted the activity of the laboratories involved in producing test and design equipment corresponding to the restrictions and required performances. The stages of achievement of the program are presented systematic through the QA based procedure where maintenance of diagnosis and

  11. Directory of Certificates of Compliance for radioactive materials packages: Report of NRC approved quality assurance programs for radioactive materials packages. Volume 3, Revision 15

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the front of Volumes 1 and 2. An alphabetical listing by user name is included in the back of Volume 3 of approved QA programs. The reports include a listing of all users of each package design and approved QA programs prior to the publication date.

  12. Directory of Certificates of Compliance for radioactive materials packages: Report of NRC approved quality assurance programs for radioactive materials packages. Volume 3, Revision 15

    International Nuclear Information System (INIS)

    The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the front of Volumes 1 and 2. An alphabetical listing by user name is included in the back of Volume 3 of approved QA programs. The reports include a listing of all users of each package design and approved QA programs prior to the publication date

  13. Quality assurance of radiation therapy machines

    International Nuclear Information System (INIS)

    Due to the modifications of components, to unexpected breakage of elements or to electronic dysfunctions, the performance of radiotherapy machines may decrease with age. Quality Assurance procedures and maintenance program are necessary to guarantee the performances. For linear accelerators, modus operandi of control tests and their frequency are based on regulations and recommendations widely published, that are presented here. Concerning accessories, especially those recently developed (multi-leaf collimators, dynamic wedges,...), recommendations remains to be defined. Simple tests are proposed. Concerning numerical imaging systems, widely used for three dimensional dosimetry, image quality and geometry controls must be performed with fantom tests. For portal imaging, a quality assurance program is proposed. A strict and complete Quality Assurance program is essential to guarantee quality and safety of the treatment. A regular control of linear accelerator is one of the important component of this program. It suppose the implementation of permanent tests procedures, periodically modified following technological progresses and treatment techniques. Measurements must be sensible to variations below the tolerance level defined during the installation process. The analysis of the variations of measurements with time are an objective criterion of quality. (author)

  14. Instructional Effects of a Systematically Developed Educational Product: Advanced Release of Quality Assurance Data for SWRL/Ginn Kindergarten Program Installation 1972-73.

    Science.gov (United States)

    Hanson, Ralph A.; Doherty, William J.

    The installation of the SWRL/Ginn Kindergarten Program on a wide-scale national basis provided an occasion to test the claim that important instructional outcomes may be attained reliably in a variety of school settings with a wide variety of pupils through the use of a systematically developed educational product. Characteristics of the…

  15. AVLIS Production Plant Preliminary Quality Assurance Plan and Assessment

    International Nuclear Information System (INIS)

    This preliminary Quality Assurance Plan and Assessment establishes the Quality Assurance requirements for the AVLIS Production Plant Project. The Quality Assurance Plan defines the management approach, organization, interfaces, and controls that will be used in order to provide adequate confidence that the AVLIS Production Plant design, procurement, construction, fabrication, installation, start-up, and operation are accomplished within established goals and objectives. The Quality Assurance Program defined in this document includes a system for assessing those elements of the project whose failure would have a significant impact on safety, environment, schedule, cost, or overall plant objectives. As elements of the project are assessed, classifications are provided to establish and assure that special actions are defined which will eliminate or reduce the probability of occurrence or control the consequences of failure. 8 figures, 18 tables

  16. Nuclear quality assurance operating philosophy: A quality-oriented approach

    International Nuclear Information System (INIS)

    Quality assurance programs have been part of the nuclear utility management process since the publication of the draft of 10CFR50 Appendix B in the late 1960s. The unwritten operational philosophy of nuclear quality assurance organizations focused on compliance with federal regulations. Adverse experiences, including operational events and extended shutdowns, prompted the gradual adoption of isolated practices extending beyond compliance orientation. These practices have an orientation that accommodates a definition of quality, a perspective of the role of nuclear quality assurance organizations in the overall concept of defense-in-depth, a definition of the segments of the nuclear quality assurance mission, and recent advances in the understanding of self-assessment. Observation of these practices at various nuclear utilities resulted in a syntheses of practices and approaches into a coherent quality-oriented nuclear quality assurance operating philosophy that is not totally adopted at any one utility

  17. Application of software quality assurance to a specific scientific code development task

    International Nuclear Information System (INIS)

    This paper describes an application of software quality assurance to a specific scientific code development program. The software quality assurance program consists of three major components: administrative control, configuration management, and user documentation. The program attempts to be consistent with existing local traditions of scientific code development while at the same time providing a controlled process of development

  18. Reactor system safety assurance

    International Nuclear Information System (INIS)

    The philosophy of reactor safety is that design should follow established and conservative engineering practices, there should be safety margins in all modes of plant operation, special systems should be provided for accidents, and safety systems should have redundant components. This philosophy provides ''defense in depth.'' Additionally, the safety of nuclear power plants relies on ''safety systems'' to assure acceptable response to design basis events. Operating experience has shown the need to study plant response to more frequent upset conditions and to account for the influence of operators and non-safety systems on overall performance. Defense in depth is being supplemented by risk and reliability assessment

  19. Quality assurance services

    International Nuclear Information System (INIS)

    For over 20 years the quality assurance services at the Springfields Laboratories have been concerned with manufacturing both simple and complex engineering products to the highest standard. The scientists working there have considerable expertise in the practical application of quality control and the development and design of inspection and non-destructive testing equipment. The folder contains six sheets or leaflets illustrating the work and equipment. The subjects are the mechanical standards laboratory, non-destructive testing, the digitising table, the peripheral camera, automated measurement, data handling and presentation, and the computer controlled three axis co-ordinate measuring machine. (U.K.)

  20. Radiological environmental monitoring program for Angra I: basis and methodology proposed for executing the requirements of the regulatory member and to assure the population safety

    International Nuclear Information System (INIS)

    It is presented, applyed to Angra-1, a methodology for implanting the monitoring program of the vicinity level radiation exposure to the installation. The method considers two kinds of radioactive effluents in the environment: gaseous (in the atmosphere) and liquid (in the marine aquatic environment). It is based on the generation and ordering of the important relation: radiation exposure pathway/radionuclide group. (M.C.K.)

  1. Assurance of U.S. Allies

    OpenAIRE

    Center on Contemporary Conflict

    2013-01-01

    FY 2013-2014. Project Lead: Ralph Cossa & Brad Glosserman Japan and South Korea_s (ROK) concerns about the reliability of the U.S. deterrent are increased by Chinese nuclear modernization and the North Korea nuclear weapons development program. As the United States embraces defense realignment and moves to reduce its nuclear stockpile, Japanese and South Korean thinking about extended deterrence is profoundly affected. It is increasingly important for the United States to assure its allian...

  2. Quality assurance of the computer code INDAR

    International Nuclear Information System (INIS)

    Detailed aquatic dispersion and radiation exposure models are required in order to assess the radiological impact of routine aquatic discharges from nuclear power stations in the United Kingdom. Such models have been developed and incorporated in the computer program INDAR. This report describes the quality assurance procedures adopted in producing and testing the first release of the code, which was complied in November 1988 and is currently stored in the production load module PROD.INDAR.V10. (author)

  3. Quality assurance records system

    International Nuclear Information System (INIS)

    This Safety Guide was prepared as part of the Agency's programme, referred to as the NUSS programme, for establishing Codes of Practice and Safety Guides relating to nuclear power plants. It supplements the IAEA Code of Practice on Quality Assurance for Safety in Nuclear Power Plants (IAEA Safety Series No.50-C-QA), which requires that for each nuclear power plant a system for the generation, identification, collection, indexing, filing, storing, maintenance and disposition of quality assurance records shall be established and executed in accordance with written procedures and instructions. The purpose of this Safety Guide is to provide assistance in the establishment and operation of such a system. An orderly established and maintained records system is considered to be part of the means of providing a basis for an appropriate level of confidence that the activities which affect the quality of a nuclear power plant have been performed in accordance with the specific requirements and that the required quality has been achieved and is maintained

  4. The case of sustainability assurance: constructing a new assurance service

    NARCIS (Netherlands)

    B. O'Dwyer

    2011-01-01

    This paper presents an in-depth longitudinal case study examining the processes through which practitioners in two Big 4 professional services firms have attempted to construct sustainability assurance (independent assurance on sustainability reports). Power’s (1996, 1997, 1999, 2003) theorization o

  5. Revision of Krsko NPP Quality Assurance Plan

    International Nuclear Information System (INIS)

    International standards from nuclear power plant operation area are being frequently upgraded and revised in accordance with the continuous improvement philosophy. This philosophy applies also to the area of Quality Assurance, which has also undergone significant improvement since the early 1950s. Besides just nuclear industry, there are also other international quality standards that are being continuously developed and revised, bringing needs for upgrades also in the nuclear application. Since the beginning of Krsko NPP construction, the overall Quality Assurance program and its applicable procedures were in place to assure that all planned and systematic actions necessary to provide adequate confidence that an item or service will satisfy given requirements to quality, are in place. The overall requirements for quality as one of the major objectives for Krsko NPP operation are also set forth in the Updated Safety Analyses Report, the document that serves as a base for operating license. During more than 30 years of Krsko NPP operation, the quality requirements and related documents were revised and upgraded in several attempts. The latest revision 6 of QD-1, Quality Assurance Plan was issued during the year 2011. The bases for the revision were: Changes of the Slovenian regulatory requirements (ZVISJV, JV5, JV9?), Changes of Krsko NPP licensing documents (USAR section 13?), SNSA inspection requirements, Changes of international standards (IAEA, ISO?), Conclusions of first PSR, Implementation of ISO standards in Krsko NPP (ISO14001, ISO17025), Changes of plant procedures, etc. One of the most obvious changes was the enlargement of the QA Plan scope to cover interdisciplinary areas defined in the plant management program MD-1, such as Safety culture, Self-assessment, Human performance, Industrial Safety etc. The attachment of the QA Plan defining relationships between certain standards was also updated to provide matrix for better correlation of requirements of

  6. Quality Assurance in a Computer-Based Outpatient Record

    OpenAIRE

    Colloff, Edwin; Morgan, Mary; Beaman, Peter; Justice, Norma; Kunstaetter, Robert; Barnett, G. Octo

    1980-01-01

    COSTAR, a COmputer-STored Ambulatory Record system, was developed at the Massachusetts General Hospital Laboratory of Computer Science. It can supplement or entirely replace the paper medical record with a highly encoded record. Although a computer-stored medical record provides a unique opportunity for quality assurance activities, it requires programming skills to examine the data. We have taken the dual approach of writing pre-specified quality assurance packages and developing a high leve...

  7. Quality assurance as a managerial innovation: a research perspective.

    Science.gov (United States)

    Kaluzny, A D

    1982-01-01

    Quality assurance is defined and concepts from innovation theory are applied to the study of quality assurance programs. Two distinct although not mutually exclusive perspectives on innovation are considered--the diffusion perspective, focusing on the innovation itself and its implementation, and the adoption perspective, highlighting factors characteristic of the adoption unit (i.e., the organization or individuals within it) that facilitate or impede the adoption process. Directions for future research are suggested. PMID:7118545

  8. Quality assurance as a managerial innovation: a research perspective.

    OpenAIRE

    Kaluzny, A D

    1982-01-01

    Quality assurance is defined and concepts from innovation theory are applied to the study of quality assurance programs. Two distinct although not mutually exclusive perspectives on innovation are considered--the diffusion perspective, focusing on the innovation itself and its implementation, and the adoption perspective, highlighting factors characteristic of the adoption unit (i.e., the organization or individuals within it) that facilitate or impede the adoption process. Directions for fut...

  9. Quality assurance plan, Westinghouse Nuclear Energy Systems Divisions

    International Nuclear Information System (INIS)

    The Quality Assurance Plan used by Westinghouse Nuclear Energy Systems Water Reactor Divisions is described. The purpose of the program is to assure that the design, materials, and workmanship on Nuclear Steam Supply System (NSSS) equipment meet applicable safety requirements, fulfill the requirements of the contracts with the applicants, and satisfy the applicable codes, standards, and regulatory requirements. This document replaces the contents of Chapter 17 Safety Analysis Reports, except for any special or unique requirements. (auth)

  10. DOE standard: Quality assurance inspection and testing of HEPA filters

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-02-01

    This standard establishes essential elements for the quality assurance inspection and testing of HEPA filters by US Department of Energy (DOE)-accepted Filter Test Facilities (FTF). The standard specifies HEPA filter quality assurance inspection and testing practices established in DOE-STD-3022-98, DOE HEPA Filter Test Program, and provides a basis for the preparation of written operating procedures for primary FTF functions.

  11. Subsurface quality assurance practices

    International Nuclear Information System (INIS)

    This report addresses only the concept of applying Nuclear Quality Assurance (NQA) practices to repository shaft and subsurface design and construction; how NQA will be applied; and the level of detail required in the documentation for construction of a shaft and subsurface repository in contrast to the level of detail required in the documentation for construction of a traditional mine. This study determined that NQA practices are viable, attainable, as well as required. The study identified the appropriate NQA criteria and the repository's major structures, systems, items, and activities to which the criteria are applicable. A QA plan, for design and construction, and a list of documentation, for construction, are presented. 7 refs., 1 fig., 18 tabs

  12. Construction quality assurance report

    Energy Technology Data Exchange (ETDEWEB)

    Roscha, V.

    1994-09-08

    This report provides a summary of the construction quality assurance (CQA) observation and test results, including: The results of the geosynthetic and soil materials conformance testing. The observation and testing results associates with the installation of the soil liners. The observation and testing results associated with the installation of the HDPE geomembrane liner systems. The observation and testing results associated with the installation of the leachate collection and removal systems. The observation and testing results associated with the installation of the working surfaces. The observation and testing results associated with in-plant manufacturing process. Summary of submittal reviews by Golder Construction Services, Inc. The submittal and certification of the piping material specifications. The observation and verification associated of the Acceptance Test Procedure results of the operational equipment functions. Summary of the ECNs which are incorporated into the project.

  13. Concrete quality assurance

    Energy Technology Data Exchange (ETDEWEB)

    Holz, N. [Harza Engineering Company, Chicago, IL (United States)

    2000-08-01

    This short article reports on progress at the world's largest civil construction project, namely China's Three Gorges hydro project. Work goes on around the clock to put in place nearly 28 M m{sup 3} of concrete. At every stage of the work there is strong emphasis on quality assurance (QA) and concrete is no exception. The US company Harza Engineering has been providing QA since the mid-1980s and concrete QA has been based on international standards. Harza personnel work in the field with supervisors developing educational tools for supervising concrete construction and quality, as well as providing training courses in concrete technology. Some details on flood control, capacity, water quality and environmental aspects are given..

  14. Construction quality assurance report

    International Nuclear Information System (INIS)

    This report provides a summary of the construction quality assurance (CQA) observation and test results, including: The results of the geosynthetic and soil materials conformance testing. The observation and testing results associates with the installation of the soil liners. The observation and testing results associated with the installation of the HDPE geomembrane liner systems. The observation and testing results associated with the installation of the leachate collection and removal systems. The observation and testing results associated with the installation of the working surfaces. The observation and testing results associated with in-plant manufacturing process. Summary of submittal reviews by Golder Construction Services, Inc. The submittal and certification of the piping material specifications. The observation and verification associated of the Acceptance Test Procedure results of the operational equipment functions. Summary of the ECNs which are incorporated into the project

  15. FESA Quality Assurance

    CERN Document Server

    CERN. Geneva

    2015-01-01

    FESA is a framework used by 100+ developers at CERN to design and implement the real-time software used to control the accelerators. Each new version must be tested and qualified to ensure that no backward compatibility issues have been introduced and that there is no major bug which might prevent accelerator operations. Our quality assurance approach is based on code review and a two-level testing process. The first level is made of unit-test (Python unittest & Google tests for C++). The second level consists of integration tests running on an isolated test environment. We also use a continuous integration service (Bamboo) to ensure the tests are executed periodically and the bugs caught early. In the presentation, we will explain the reasons why we took this approach, the results and some thoughts on the pros and cons.

  16. Measurement quality assurance for radioassay laboratories

    Energy Technology Data Exchange (ETDEWEB)

    McCurdy, D.E. [Yankee Atomic Environmental Laboratory, Boston, MA (United States)

    1993-12-31

    Until recently, the quality of U.S. radioassay laboratory services has been evaluated by a limited number of governmental measurement assurance programs (MAPs). The major programs have been limited to the U.S. Department of Energy (DOE), the U.S. Environmental Protection Agency (EPA) and the U.S. Nuclear Regulatory Commission (NRC). In 1988, an industry MAP was established for the nuclear power utility industry through the U.S. Council for Energy Awareness/National Institute of Standards and Technology (USCEA/NIST). This program functions as both a MAP for utility laboratories and/or their commercial contractor laboratories, and as a traceability program for the U.S. radioactive source manufacturers and the utility laboratories. Each of these generic MAPs has been initiated and is maintained to serve the specific needs of the sponsoring agency or organization. As a result, there is diversification in their approach, scope, requirements, and degree of traceability to NIST. In 1987, a writing committee was formed under the American National Standards Institute (ANSI) N42.2 committee to develop a standard to serve as the basis document for the creation of a national measurement quality assurance (MQA) program for radioassay laboratories in the U.S. The standard is entitled, {open_quotes}Measurement Quality Assurance For Radioassay Laboratories.{open_quotes} The document was developed to serve as a guide for MQA programs maintained for the specialized sectors of the radioassay community, such as bioassay, routine environmental monitoring, environmental restoration and waste management, radiopharmaceuticals, and nuclear facilities. It was the intent of the writing committee to develop a guidance document that could be utilized to establish a laboratory`s specific data quality objectives (DQOs) that govern the operational requirements of the radioassay process, including mandated protocols and recommendations.

  17. Implementation of a Quality Assurance Program in a new Radiotherapy Center taking as base the TG-40; Implementacion del programa de Garantia de Calidad en un Centro nuevo de Radioterapia tomando como base el TG-40

    Energy Technology Data Exchange (ETDEWEB)

    Marles, A.; Besa, P.; Hecht, P.; Arriagada, L.; Ruz, A.; Garay, C. [Pontificia Universidad Catolica de Chile, Centro de Cancer. Diagonal Paraguay, 319. Santiago (Chile)

    1998-12-31

    The recommended principles in the `Comprehensive QA for radiation oncology: Report of AAPM Radiation Therapy Committee Task Group 40`, TG-40, have been the base for implementation of the Quality Assurance Program of a modern Radiotherapy service. During its application has been necessary: to initiate its implementation before the equipment installation, assuming the costs of the contracts of the qualified personnel, realizing an initial investment adequate for equipment acquisition necessary for acceptation, commissioning and routinary control, the experienced formation of the personnel in the protocol philosophy, establishing procedures for day by day process which would allow the retrofeeding, the elaboration of templates and opening to changes and adjustments according to the necessities. The experience of two years had been demonstrated that the TG-40: a) It is feasible to be implemented but sometimes no strict totally and it is essential to have qualified personnel and the necessary material resources; b) It does not contains all the necessary for its practical implementation and must be completing with procedures and routine formats which facilitate their application; c) It allows the detection and opportune failure correction in the process; d) It is a continuous process that does not finishes. (Author)

  18. Recent Trends in Quality Assurance

    Science.gov (United States)

    Amaral, Alberto; Rosa, Maria Joao

    2010-01-01

    In this paper we present a brief description of the evolution of quality assurance in Europe, paying particular attention to its relationship to the rising loss of trust in higher education institutions. We finalise by analysing the role of the European Commission in the setting up of new quality assurance mechanisms that tend to promote…

  19. Towards improvement in quality assurance

    International Nuclear Information System (INIS)

    This first document in the series of the International Nuclear Safety Advisory Group (INSAG) Technical Notes is a general guideline for the establishment of effective quality assurance procedures at nuclear facilities. It sets out primary requirements such as quality objectives, methods for measuring the effectiveness of the quality assurance programme, priority of activities in relation to importance of safety of items, motivation of personnel

  20. Quality assurance in the Antares laser fusion construction project

    International Nuclear Information System (INIS)

    The Antares CO2 laser facility came on line in November 1983 as an experimental physics facility; it is the world's largest CO2 laser fusion system. Antares is a major component of the Department of Energy's Inertial Confinement Fusion Program. Antares is a one-of-a-kind laser system that is used in an experimental environment. Given limited project funds and tight schedules, the quality assurance program was tailored to achieve project goals without imposing oppressive constraints. The discussion will review the Antares quality assurance program and the utility of various portions to completion of the project

  1. 10 CFR 72.140 - Quality assurance requirements.

    Science.gov (United States)

    2010-01-01

    ..., and testing of a spent fuel storage cask until possession of the spent fuel storage cask is... development of the spent fuel storage cask design through termination of the CoC. (c) Approval of program. (1... quality assurance program before commencing fabrication or testing of a spent fuel storage cask. (3)......

  2. Quality assurance for environmental analytical chemistry at Los Alamos

    International Nuclear Information System (INIS)

    The basic structure philosophy of the program as it has evolved over the past five years is discussed with particular emphasis on traceability and use of certified reference materials. Typical summary results of the program and interactive computerized quality assurance system are presented

  3. Workshop on measurement quality assurance for ionizing radiation: Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Heath, J.A.; Swinth, K.L. [comps.

    1993-12-31

    This workshop was held to review the status of secondary level calibration accreditation programs, review related measurement accreditation programs, document lessons learned, and to present changes in programs due to new national priorities involving radioactivity measurements. Contents include: fundamentals of measurement quality assurance (MQA), standards for MQA programs; perspectives and policies; complete MQA programs; future MQA programs; QA/QC programs--radioactivity; QA/QC programs--dosimetry; laboratory procedures for QA/QC; in-house control of reference dosimetry laboratories; in-house controls of radioactivity laboratories; and poster session. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database.

  4. Workshop on measurement quality assurance for ionizing radiation: Proceedings

    International Nuclear Information System (INIS)

    This workshop was held to review the status of secondary level calibration accreditation programs, review related measurement accreditation programs, document lessons learned, and to present changes in programs due to new national priorities involving radioactivity measurements. Contents include: fundamentals of measurement quality assurance (MQA), standards for MQA programs; perspectives and policies; complete MQA programs; future MQA programs; QA/QC programs--radioactivity; QA/QC programs--dosimetry; laboratory procedures for QA/QC; in-house control of reference dosimetry laboratories; in-house controls of radioactivity laboratories; and poster session. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database

  5. Ballistic quality assurance

    International Nuclear Information System (INIS)

    This review describes the ballistic quality assurance for stereotactic intracranial irradiation treatments delivered with Gamma KnifeR either dedicated or adapted medical linear accelerators. Specific and periodic controls should be performed in order to check the mechanical stability for both irradiation and collimation systems. If this step remains under the responsibility of the medical physicist, it should be done in agreement with the manufacturer's technical support. At this time, there are no recent published guidelines. With technological developments, both frequency and accuracy should be assessed in each institution according to the treatment mode: single versus hypo-fractionated dose, circular collimator versus micro-multi-leaf collimators. In addition, 'end-to-end' techniques are mandatory to find the origin of potential discrepancies and to estimate the global ballistic accuracy of the delivered treatment. Indeed, they include frames, non-invasive immobilization devices, localizers, multimodal imaging for delineation and in-room positioning imaging systems. The final precision that could be reasonably achieved is more or less 1 mm. (authors)

  6. High-Assurance Software: LDRD Report.

    Energy Technology Data Exchange (ETDEWEB)

    Hulette, Geoffrey Compton

    2014-06-01

    This report summarizes our work on methods for developing high-assurance digital systems. We present an approach for understanding and evaluating trust issues in digital systems, and for us- ing computer-checked proofs as a means for realizing this approach. We describe the theoretical background for programming with proofs based on the Curry-Howard correspondence, connect- ing the field of logic and proof theory to programs. We then describe a series of case studies, intended to demonstrate how this approach might be adopted in practice. In particular, our stud- ies elucidate some of the challenges that arise with this style of certified programming, including induction principles, generic programming, termination requirements, and reasoning over infinite state spaces.

  7. Quality assurance of reactor operation by computer methods

    International Nuclear Information System (INIS)

    The necessity and value of computer auditing has been proven at N Reactor. During a recent audit, discrepancies were noted when temperature calculations did not agree within +- 10F upon comparison of Quality Assurance and Reactor Operations calculations. Input data was checked and no discrepancies noted. Quality Assurance and Reactor Operations programs were executed again, using new data, and all calculations agreed within the required accuracy. A subsequent diagnostics test was performed on the Quality Assurance computer system, revealing hard (gross) computer memory failures, although further routine computer operation did not reveal this. The incident demonstrates that errors in operating limits could occur, undetected, if reliability were based solely on limits calculated by the Reactor Operations computer, without verification by means of the Quality Assurance computer. This type of incident is similarly possible at Commercial nuclear facilities which rely on one computer system only, without verification (auditing) of input parameters, subsequent calculation of operating parameters (limits), and computer operation

  8. Mission Assurance Modeling and Simulation: A Cyber Security Roadmap

    Science.gov (United States)

    Gendron, Gerald; Roberts, David; Poole, Donold; Aquino, Anna

    2012-01-01

    This paper proposes a cyber security modeling and simulation roadmap to enhance mission assurance governance and establish risk reduction processes within constrained budgets. The term mission assurance stems from risk management work by Carnegie Mellon's Software Engineering Institute in the late 19905. By 2010, the Defense Information Systems Agency revised its cyber strategy and established the Program Executive Officer-Mission Assurance. This highlights a shift from simply protecting data to balancing risk and begins a necessary dialogue to establish a cyber security roadmap. The Military Operations Research Society has recommended a cyber community of practice, recognizing there are too few professionals having both cyber and analytic experience. The authors characterize the limited body of knowledge in this symbiotic relationship. This paper identifies operational and research requirements for mission assurance M&S supporting defense and homeland security. M&S techniques are needed for enterprise oversight of cyber investments, test and evaluation, policy, training, and analysis.

  9. Creating quality assurance and international transparency for quality assurance agencies

    DEFF Research Database (Denmark)

    Lindeberg, Tobias Høygaard; Kristoffersen, Dorte

    2004-01-01

    , on the one hand, to advance internationalisation of quality assurance of higher education, and on the other hand, allow for the differences in the national approaches to quality assurance. The paper will focus on two issues: first, the strength and weaknesses of the method employed and of the use of...... the ENQA‐membership provision as a basis for the evaluative procedure; and second, the pros and cons of using mutual recognition as international evaluative procedure compared with other approaches....

  10. Quality assurance for radiochemical measurements and monitoring

    International Nuclear Information System (INIS)

    Since 1954, the Environmental Protection Agency (EPA) and its predecessor, the US Public Health Service, has operated an environmental radiation monitoring program in a 100,000 square mile region surrounding the Nevada Test Site and at former nuclear test sites in Alaska, Colorado, New Mexico, and Mississippi. This program is designed to measure levels and trends of radioactivity in the environment surrounding test areas, determine compliance with existing regulations, and protect the health and well-being of the public in the event of any accidental release of radioactive contaminants. Levels of radiation and radioactivity are assessed by sampling water, milk, and air; deploying thermoluminescent dosimeters (TLDs); measurements using pressurized ion chambers (PICs); and biological monitoring of both animals and humans. To ensure that all decisions and actions are supported by environmental measurement of known quality, the EPA requires a locally implemented quality assurance program. Elements of this program include: a quality assurance plan for each of the sampling networks; standard operating procedures for field monitors and analysts; and a routine review of all data by network auditors. To further test the validity of data, the radioanalytical laboratory regularly participates in EPA, Department of Energy (DOE), and World Health Organization (WHO) intercomparison studies

  11. Implementation of a quality assurance program for computerized treatment planning systems according to TRS 430; Implantacao de um programa de controle de qualidade para sistemas de planejamento de tratamento computadorizados de acordo com o TRS 430

    Energy Technology Data Exchange (ETDEWEB)

    Camargo, Priscilla Roberta Tavares Leite

    2006-07-01

    This work presents the guidelines and necessary tests tom implement a quality assurance program for Eclipse 7.3.10 from Varian at Hospital das Clinicas, Sao Paulo University School of Medicine - Brazil, in accordance with the new IAEA publication TRS 430. The recommended tests for the TRS 430 air mainly classified into acceptance tests, commissioning (dosimetric and non-dosimetric tests), and routine tests. The IAEA document's recommendations are being implemented at the hospital for two Varian linear accelerators - Clinac 600C e Clinac 2100C. The acceptance tests verified 'hardware', integration of network systems, data transfer and 'software' parameters. The results obtained are in a good agreement with the manufacturer's specifications. Measurements of absolute dose in several set-ups were made for the commissioning dosimetric tests. These data were compared to the absolute doses determined by the TPS. The great majority of the tests showed 90% to 80% of the analyzed data in acceptance levels, with a good agreement between the experimental data and the data determined by the TPS. Only settings with asymmetric fields presented significant discords, showing the need for a more detailed inquiry for these settings. The non-dosimetric commissioning tests have also presented excellent results, with virtually all the system tools and general performance in compliance with TRS 430. The acceptance criteria have been applied for a comparison between the values of MUs generated by TPS and the calculated manually ones. The beams have been characterized for Eclipse with data transferred from CadPlan and with data from recommissioning of accelerators, so for these tests it was found a difference of at least 3% for the conformal field shape for the data originated in the beams of recommissioning and at least 4% for the data proceeded from CadPlan. The tolerance level established by TRS 430 for this setting was 3%. (author)

  12. Use of EORTC Target Definition Guidelines for Dose-Intensified Salvage Radiation Therapy for Recurrent Prostate Cancer: Results of the Quality Assurance Program of the Randomized Trial SAKK 09/10

    International Nuclear Information System (INIS)

    Purpose: Different international target volume delineation guidelines exist and different treatment techniques are available for salvage radiation therapy (RT) for recurrent prostate cancer, but less is known regarding their respective applicability in clinical practice. Methods and Materials: A randomized phase III trial testing 64 Gy vs 70 Gy salvage RT was accompanied by an intense quality assurance program including a site-specific and study-specific questionnaire and a dummy run (DR). Target volume delineation was performed according to the European Organisation for the Research and Treatment of Cancer guidelines, and a DR-based treatment plan was established for 70 Gy. Major and minor protocol deviations were noted, interobserver agreement of delineated target contours was assessed, and dose-volume histogram (DVH) parameters of different treatment techniques were compared. Results: Thirty European centers participated, 43% of which were using 3-dimensional conformal RT (3D-CRT), with the remaining centers using intensity modulated RT (IMRT) or volumetric modulated arc technique (VMAT). The first submitted version of the DR contained major deviations in 21 of 30 (70%) centers, mostly caused by inappropriately defined or lack of prostate bed (PB). All but 5 centers completed the DR successfully with their second submitted version. The interobserver agreement of the PB was moderate and was improved by the DR review, as indicated by an increased κ value (0.59 vs 0.55), mean sensitivity (0.64 vs 0.58), volume of total agreement (3.9 vs 3.3 cm3), and decrease in the union volume (79.3 vs 84.2 cm3). Rectal and bladder wall DVH parameters of IMRT and VMAT vs 3D-CRT plans were not significantly different. Conclusions: The interobserver agreement of PB delineation was moderate but was improved by the DR. Major deviations could be identified for the majority of centers. The DR has improved the acquaintance of the participating centers with the trial protocol

  13. Comprehensive quality assurance for stereotactic radiosurgery treatments

    Energy Technology Data Exchange (ETDEWEB)

    Ramaseshan, R [Radiation Physics Department, Princess Margaret Hospital, University Health Network, 610 University Avenue, Toronto, ON, M5G 2M9 (Canada); Heydarian, M [Department of Radiation Oncology, University of Toronto, Toronto, ON, M5G 2M9 (Canada)

    2003-07-21

    We have used a commercially available high precision Lucy{sup TM} phantom to perform comprehensive quality assurance for stereotactic radiosurgery treatments. The quantitative evaluation of system uncertainties included imaging, planning and treatment delivery systems. The quality assurance tests showed that the well-defined targets were identified to within {+-}1 mm in all the imaging modalities. The pre-known target volumes were reproduced within 2 cm{sup 3} in both MR and CT. The planned target was delivered within 2% of the prescribed dose and to within 2 mm accuracy. The inaccuracy in the isocentre position at the Linac was less than 1.2 mm. The maximum error observed in the depth helmet was 0.5 mm and the overall uncertainty was within 0.23 mm. We have also established a quality assurance program based on the study and proposed the tolerance and the frequency of the tests required to be carried out. The tests were carried out using a Radionics planning system and delivered on a Varian Clinac 2100 linear accelerator machine. These tests also established a base line for future comparisons. (note)

  14. Quality assurance within regulatory bodies

    International Nuclear Information System (INIS)

    The IAEA directed extensive efforts during the years 1991 to 1995 to the integral revision of all NUSS quality assurance publications, which were approved and issued as Safety Series No.50-C/SG-Q, Quality Assurance for Safety in Nuclear Power Plants and other Nuclear Installations (1996). When these quality assurance publications were developed, their prime focus was on requirements against which work performed by the licensees could be measured and assessed by the regulatory bodies. In this way, they only helped to facilitate the functions of regulators. No requirements or recommendations were provided on how the regulators should ensure the effective implementation of their own activities. The present publication is a first attempt to collect, integrate and offer available experience to directly support performance of regulatory activities. It presents a comprehensive compilation on the application of quality assurance principles and methods by regulatory bodies to their activities. The aim is consistent good performance of regulatory activities through a systematic approach

  15. Quality Assurance: A Balancing Act

    OpenAIRE

    Žváčková Jitka

    2015-01-01

    Language Centre Quality Assurance can be used for a wide range of purposes, from audits of services and procedures to reflection on best practices and improvements of language education. Quality Assurance systems across Europe differ considerably. The Czech Republic, unlike the UK or Spain, applies no unified national standards, therefore, the Masaryk University Language Centre (CJV MU), in compliance with the Masaryk University strategic plan, is obliged to set its own standards and procedur...

  16. Proactive quality assurance in environmental research

    International Nuclear Information System (INIS)

    The Quality Assurance policy of the US Environmental Protection Agency (EPA) stipulates that every project involving environmentally related monitoring, measurements, and data collection activities must have a written and approved quality assurance project plan (QAPjP). A QAPjP is a written document which presents, in specific terms, the policies, organizations, objectives, functional activities, and the quality assurance/quality control activities designed to achieve the quality goals for data collection. In the research studies involving novel or non-routine measurements that use unvalidated methods, measurement quality goals are often difficult or impossible to specify at the beginning of the project for which a QAPjP must be written. Furthermore, it may not be possible for the QAPjP reviewers to evaluate the reasonableness of these goals without initial information about the system under study. For the project to evaluate chlorofluorocarbon for recycling from domestic refrigerators, the QAPjP incorporated standard analytical techniques used by industry. These techniques did not provide accuracy and precision or other validation information. For the initial version of the QAPjP, measurement quality goals were assigned based on limited experience. Quality assurance support was called upon to evaluate the performance of the measurement system for this project through a series of audits. The performance evaluation audits necessitated designing novel audit materials and sample delivery techniques. Continued interaction is necessary between the project and QA teams to permit evolution of reasonable data quality indicators for meaningful assessment of data quality. By treating the QAPjP as a living document that is updated and amended as more knowledge of a system is obtained, AQ becomes an integral part of the research program. This results in a greater understanding of the system under study

  17. 2011 SAPHIRE 8 Software Quality Assurance Status Report

    Energy Technology Data Exchange (ETDEWEB)

    Kurt G. Vedros

    2011-09-01

    The Software Quality Assurance engineer position was created in fiscal year 2011 to better maintain and improve the quality of the SAPHIRE 8 development program. This year's Software Quality Assurance tasks concentrated on developing the framework of the SQA program. This report reviews the accomplishments and recommendations for each of the subtasks set forth for JCN V6059: (1) Reviews, Tests, and Code Walkthroughs; (2) Data Dictionary; (3) Metrics; (4) Requirements Traceability Matrix; (5) Provide Oversight on SAPHIRE QA Activities; and (6) Support NRC Presentations and Meetings.

  18. Construction quality assurance for nuclear power plants

    International Nuclear Information System (INIS)

    This Standard contains the requirements for the quality assurance program applicable to the construction phase of a nuclear power plant. This Standard covers all activities carried out for and by the owner from the receipt of components or materials on the site to their incorporation in systems or structures as required by drawings or other formal engineering information. It also covers the provision of required support activities and equipment and applies at all stages on the site as far as the testing of components or systems before they are submitted for commissioning. 2 figs

  19. Quality assurance in production and use of special form radioactive material - focal points in BAM approvals

    International Nuclear Information System (INIS)

    BAM as the competent authority for approval of special form radioactive material attaches great importance to a detailed audit of the required quality assurance programs for design, manufacture, testing, documentation, use, maintenance and inspection. Applicants have to submit, together with application documentation information on general arrangements for quality assurance, as well as on quality assurance in production and in operation. Fields where BAM has often found deficiencies are leak test methods, weld seam quality and the safety level after use

  20. Thoughts on Internal and External Quality Assurance

    Science.gov (United States)

    Zhang, Jianxin

    2012-01-01

    Quality assurance of higher education is made up of two parts: internal quality assurance (IQA) and external quality assurance (EQA). Both belong to a union of the coexistence and balance of yin and yang. But in reality there exists a paradox of "confusion of quality assurance (QA) subject consciousness, singularity of social QA and lack of QA…

  1. Legacy Management CERCLA Sites. Quality Assurance Project Plan

    International Nuclear Information System (INIS)

    S.M. Stoller Corporation is the contractor for the Technical Assistance Contract (TAC) for the U.S. Department of Energy (DOE) Office of Legacy Management (LM) operations. Stoller employs a management system that applies to all programs, projects, and business management systems funded through DOE-LM task orders. The management system incorporates the philosophy, policies, and requirements of health and safety, environmental compliance, and quality assurance (QA) in all aspects of project planning and implementation. Health and safety requirements are documented in the Health and Safety Manual (STO 2), the Radiological Control Manual (STO 3), the Integrated Safety Management System Description (STO 10), and the Drilling Health and Safety Requirements (STO 14). Environmental compliance policy and requirements are documented in the Environmental Management Program Implementation Manual (STO 11). The QA Program is documented in the Quality Assurance Manual (STO 1). The QA Manual (STO 1) implements the specific requirements and philosophy of DOE Order 414.1C, Quality Assurance. This manual also includes the requirements of other standards that are regularly imposed by customers, regulators, or other DOE orders. Title 10 Code of Federal Regulations Part 830, 'Quality Assurance Requirements', ANSI/ASQC E4-2004, 'Quality Systems for Environmental Data and Technology Programs - Requirements with Guidance for Use', and ISO 14001-2004, 'Environmental Management Systems', have been included. These standards are similar in content. The intent of the QA Manual (STO 1) is to provide a QA management system that incorporates the requirements and philosophy of DOE and other customers within the QA Manual. Criterion 1, 'Quality Assurance Program', identifies the fundamental requirements for establishing and implementing the QA management system; QA Instruction (QAI) 1.1, 'QA Program Implementation', identifies the TAC organizations that have responsibility for implementing the QA

  2. Concepts of nuclear quality assurance

    International Nuclear Information System (INIS)

    While the safety record of the nuclear industry continues to be excellent, the forced outage rates for recent years continue to be 15% or more. Quality assurance, therefore, needs to be applied not only to nuclear safety matters, but to the goals of increased productivity and reduced construction and operating costs. Broadening the application of the general concept of quality assurance in this way leads to the introduction of reliability technology. The total activity might better be called reliability assurance. That effective quality assurance systems do pay off is described by examples from the utility industry, from a manufacturer of instruments and systems and from the experience of Westinghouse Electric Company's manufacturing divisions. The special situation of applying quality assurance to nuclear fuel is discussed. Problems include the lack of a fully developed regulatory policy in this area, incomplete understanding of the mechanism for pellet-clad interaction failures, incomplete access to manufacturers design and process information, inability to make desirable changes on a timely basis and inadequate feedback of irradiation experience. (author)

  3. Highly Integrated Quality Assurance – An Empirical Case

    Energy Technology Data Exchange (ETDEWEB)

    Drake Kirkham; Amy Powell; Lucas Rich

    2011-02-01

    Highly Integrated Quality Assurance – An Empirical Case Drake Kirkham1, Amy Powell2, Lucas Rich3 1Quality Manager, Radioisotope Power Systems (RPS) Program, Idaho National Laboratory, P.O. Box 1625 M/S 6122, Idaho Falls, ID 83415-6122 2Quality Engineer, RPS Program, Idaho National Laboratory 3Quality Engineer, RPS Program, Idaho National Laboratory Contact: Voice: (208) 533-7550 Email: Drake.Kirkham@inl.gov Abstract. The Radioisotope Power Systems Program of the Idaho National Laboratory makes an empirical case for a highly integrated Quality Assurance function pertaining to the preparation, assembly, testing, storage and transportation of 238Pu fueled radioisotope thermoelectric generators. Case data represents multiple campaigns including the Pluto/New Horizons mission, the Mars Science Laboratory mission in progress, and other related projects. Traditional Quality Assurance models would attempt to reduce cost by minimizing the role of dedicated Quality Assurance personnel in favor of either functional tasking or peer-based implementations. Highly integrated Quality Assurance adds value by placing trained quality inspectors on the production floor side-by-side with nuclear facility operators to enhance team dynamics, reduce inspection wait time, and provide for immediate, independent feedback. Value is also added by maintaining dedicated Quality Engineers to provide for rapid identification and resolution of corrective action, enhanced and expedited supply chain interfaces, improved bonded storage capabilities, and technical resources for requirements management including data package development and Certificates of Inspection. A broad examination of cost-benefit indicates highly integrated Quality Assurance can reduce cost through the mitigation of risk and reducing administrative burden thereby allowing engineers to be engineers, nuclear operators to be nuclear operators, and the cross-functional team to operate more efficiently. Applicability of this case

  4. Quality assurance inspections for shipping and storage containers

    Energy Technology Data Exchange (ETDEWEB)

    Stromberg, H.M.; Roberts, G.D.; Bryce, J.H. [Lockheed Idaho Technologies Co., Idaho Falls, ID (United States)

    1996-04-01

    This is a guide for conducting quality assurance inspections of transportation packaging and dry spent fuel storage system suppliers. (Suppliers are defined as designers, fabricators, distributors, users or owners of those packaging and storage systems.) This guide may be used during inspection to determine regulatory compliance with 10 CFR, Part 71, Subpart H; 10 CFR, Part 72, Subpart G; 10 CFR, Part 21; and supplier`s quality assurance program commitments. It was developed to provide a structured, consistent approach to inspections. The guidance therein provides a framework for evaluation of transportation packaging and dry spent fuel storage systems quality assurance programs. Inspectors are provided with the flexibility to adapt the methods and concepts to meet inspection requirements for the particular facility. The method used in the guide treats each activity at a facility as a separate performance element and combines the activities within the framework of an ``inspection tree.``The method separates each performance element into several areas for inspection and identifies guidelines, based on regulatory requirements, to qualitatively evaluate each area. This guide also serves as a field manual to facilitate quality assurance inspection activities. This guide replaces an earlier one, NUREG/CR-5717 (Packing Supplier Inspection Guide). This replacement guide enhances the inspection activities for transportation packagings and adds the dry spent fuel storage system quality assurance inspection activities.

  5. Quality assurance inspections for shipping and storage containers

    International Nuclear Information System (INIS)

    This is a guide for conducting quality assurance inspections of transportation packaging and dry spent fuel storage system suppliers. (Suppliers are defined as designers, fabricators, distributors, users or owners of those packaging and storage systems.) This guide may be used during inspection to determine regulatory compliance with 10 CFR, Part 71, Subpart H; 10 CFR, Part 72, Subpart G; 10 CFR, Part 21; and supplier's quality assurance program commitments. It was developed to provide a structured, consistent approach to inspections. The guidance therein provides a framework for evaluation of transportation packaging and dry spent fuel storage systems quality assurance programs. Inspectors are provided with the flexibility to adapt the methods and concepts to meet inspection requirements for the particular facility. The method used in the guide treats each activity at a facility as a separate performance element and combines the activities within the framework of an ''inspection tree.''The method separates each performance element into several areas for inspection and identifies guidelines, based on regulatory requirements, to qualitatively evaluate each area. This guide also serves as a field manual to facilitate quality assurance inspection activities. This guide replaces an earlier one, NUREG/CR-5717 (Packing Supplier Inspection Guide). This replacement guide enhances the inspection activities for transportation packagings and adds the dry spent fuel storage system quality assurance inspection activities

  6. Grading of quality assurance requirements

    International Nuclear Information System (INIS)

    The present Manual provides guidance and illustrative examples for applying a method by which graded quality assurance requirements may be determined and adapted to the items and services of a nuclear power plant in conformance with the requirements of the IAEA Nuclear Safety Standards (NUSS) Code and Safety Guides on quality assurance. The Manual replaces the previous publication IAEA-TECDOC-303 on the same subject. Various methods of grading quality assurance are available in a number of Member States. During the development of the present Manual it was not considered practical to attempt to resolve the differences between those methods and it was preferred to identify and benefit from the good practices available in all the methods. The method presented in this Manual deals with the aspects of management, documentation, control, verification and administration which affect quality. 1 fig., 4 tabs

  7. Final Hanford Site Transuranic (TRU) Waste Characterization Qualit Assurance Project Plan

    International Nuclear Information System (INIS)

    The Transuranic Waste Characterization Quality Assurance Program Plan required each U.S. Department of Energy (DOE) site that characterizes transuranic waste to be sent the Waste Isolation Pilot Plan that addresses applicable requirements specified in the quality assurance project plan (QAPP)

  8. 40 CFR 75.21 - Quality assurance and quality control requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Quality assurance and quality control... PROGRAMS (CONTINUED) CONTINUOUS EMISSION MONITORING Operation and Maintenance Requirements § 75.21 Quality assurance and quality control requirements. (a) Continuous emission monitoring systems. The owner...

  9. NATIONAL SURFACE WATER SURVEY: EASTERN LAKE SURVEY (PHASE 1 - SYNOPTIC CHEMISTRY). QUALITY ASSURANCE REPORT

    Science.gov (United States)

    The report provides an overview of the quality assurance activities and results of the Eastern Lake Survey - Phase I. The quality assurance program used a combination of blank, duplicate, and audit samples to provide an external check on the data quality of 32 physiochemical para...

  10. Operating the plant, quality assurance, and the job of the operating staff, Volume Twelve

    International Nuclear Information System (INIS)

    Subject matter includes operating the plant (the role of the operator, the control room, plant technical specifications, plant operating procedures, initial startup program, BWR/PWR plant startup, BWR/PWR steady state power operation, BWR/PWR transient operation, emergency operation), quality assurance (what is quality, what is quality control, quality assurance includes quality control, government regulation and quality assurance, administrative controls for nuclear power plants, the necessity of reviews and audits, practical quality assurance), and the job of the operating staff (the plant operating staff, plant safety, first aid and resuscitation, general plant hazards, personnel protective equipment, handling chemicals, handling compressed gas, equipment repair and maintenance, communicating with others

  11. The Science of Mission Assurance

    Directory of Open Access Journals (Sweden)

    Kamal Jabbour

    2011-01-01

    Full Text Available The intent of this article is to describe—and prescribe—a scientific framework for assuring mission essential functions in a contested cyber environment. Such a framework has profound national security implications as the American military increasingly depends on cyberspace to execute critical mission sets. In setting forth this prescribed course of action, the article will first decompose information systems into atomic processes that manipulate information at all six phases of the information lifecycle, then systematically define the mathematical rules that govern mission assurance.

  12. Fuel assurance and supply security

    International Nuclear Information System (INIS)

    Differences between uncertainties relating to uranium and to petroleum supplies are analyzed. Uranium is linked simultaneously to energy and to non-proliferation policies. The differences between the countries from which supplies are obtained are also discussed. Efforts of various international organizations to secure assured supplies are considered. The discussions at INFCE (International Nuclear Fuel Cycle Evaluation) are referred to. The part played by USA is outlined: U.S. fuel assurance proposals; analysis of the U.S. proposal. The relationship between petroleum and uranium supplies is examined, and new trends in the petroleum and uranium industries are discussed. (U.K.)

  13. Quality assurance of endoscopy units.

    Science.gov (United States)

    Stebbing, John F

    2011-06-01

    This chapter reflects on how England has led the world in service development and quality assurance of endoscopy. It draws out themes of leadership, strategic vision and organisational culture. It emphasises the pivotal importance of focussing service improvement on enhancing the quality of a patient's experience of endoscopy. It describes the processes used here for quality assurance of endoscopy units and how these have dovetailed with other strands of work in transforming the English endoscopy service. The chapter presents discussion of the responses to accreditation processes and how the design of the JAG Accreditation process maximises its effectiveness. PMID:21764004

  14. Assessing Faculty Bias in Rating Embedded Assurance of Learning Assignments

    Science.gov (United States)

    Kim, Dong-gook; Helms, Marilyn M.

    2016-01-01

    Assurance of learning (AoL) processes for continuous improvement and accreditation require business schools to assess program goals. Findings from the process can lead to changes in course design or curriculum. Often AoL assignments are embedded into existing courses and assessed at regular intervals. Faculty members may evaluate an assignment in…

  15. Life Assurance Strategy for CANDU NPP

    International Nuclear Information System (INIS)

    Nuclear Plants have a nominal 'design life' that forms the basis of equipment specification, economic evaluations and licensing for some jurisdictions. Some component in the plant may require replacement, refurbishing and or rehabilitation during the plant 'design life'. Components which are extremely difficult or economically impossible to replace will place a limit on plant life. Rehabilitation programs completed to date on older CANDU plants to improve reliability of plant components, coupled with R and D programs, experimental data and advanced analytical methods form the basis for CANDU plant component life assurance. Life assurance is verified during plant operation by comprehensive in-service inspection programs and laboratory examinations. The paper provides an overview of the experiences to date on Refurbishment and Rehabilitation programs and some Canadian approaches on the main activities involved in scoping and managing nuclear plant life assurance. A number of proactive programs are underway to anticipate, detect and mitigate potential aging degradation at an early stage to ensure plant safety and reliability. Some of these programs include; systematic plant condition assessment, refurbishment and upgrading programs, environmental qualification programs and a program of examination of components from decommissioned reactors. These programs are part of an overall nuclear power plant maintenance strategy. Beyond life assurance, a longer term approach would be geared towards life extension as a viable option for the future. Recent CANDU designs have benefited from the early CANDU experience and are expected to require less rehabilitation. Examples of changes in CANDU 6 include fuel channel design and adopting a closed component cooling water system. New designs are based on 'design life' longer than that used for economic evaluations. The approach is to design for easy replace ability for components that can be economically replaced. Specific examples

  16. Quality Assurance. Summary Report of a Project to Develop and Evaluate a Quality Assurance Package. FEU/PICKUP Project Report.

    Science.gov (United States)

    Further Education Unit, London (England).

    A curriculum development project began with a market survey to investigate the demand for training in quality assurance (QA). The project objective was to develop a final study program that would cater to a broad range of employees, from operative to senior management; enable employees to appreciate their potential role within a QA system; and…

  17. Quality Assurance Systems in Education and Training in Europe

    Science.gov (United States)

    Voinia, Claudiu Sorin; Tuşa, Ana; Simion, Carmen

    2014-11-01

    Member States have a duty to compare and learn more about the national education and professional training. The objectives of this paper were to identify specific characteristics, developments and highlighting key priorities in coordinating the development of specific quality assurance processes in the European Union. The aim of this work was to present the quality assurance systems in vocational education and training systems in the Member States of the European Union. The results were to identify the extent to which national initiatives of EU member States show interest in the quality of education. Data from research can be useful in developing strategic sector development programs, and local schools

  18. Development of a quality assurance system for radiotherapy

    International Nuclear Information System (INIS)

    Due to 1996 legislation in the Netherlands, every health care facility should have a quality assurance program. Because it is difficult to measure the quality of the product of care, a choice is made to focus on the process of care. For this purpose PACE was founded. (PACE is a Dutch acronym for Project ACcreditation) with as founding members: Public Health Insurance Council, TNO health research, 4 university hospitals and 4 large general hospitals. For in total 19 services and disciplines quality assurance standards where developed by groups in six of the hospitals. (author)

  19. Quality assurance manual: Volume 1

    International Nuclear Information System (INIS)

    Stanford Linear Accelerator Center (SLAC) is a DOE-supported research facility that carries out experimental and theoretical research in high energy physics and developmental work in new techniques for particle acceleration and experimental instrumentation. The purpose of this manual is to describe SLAC quality assurance policies and practices in various parts of the Laboratory

  20. Quality Assurance 1992-2012

    Science.gov (United States)

    Brown, Roger

    2012-01-01

    As the author's contribution to a series marking the Golden Jubilee of the Association of University Administrators, he reflects on changes in quality assurance over the past twenty years and speculates on what the future may hold for quality as the association moves into a new and very different competitive regime. He begins by discussing the…

  1. Redefining and expanding quality assurance.

    Science.gov (United States)

    Robins, J L

    1992-12-01

    To meet the current standards of excellence necessary for blood establishments, we have learned from industry that a movement toward organization-wide quality assurance/total quality management must be made. Everyone in the organization must accept responsibility for participating in providing the highest quality products and services. Quality must be built into processes and design systems to support these quality processes. Quality assurance has been redefined to include a quality planning function described as the most effective way of designing quality into processes. A formalized quality planning process must be part of quality assurance. Continuous quality improvement has been identified as the strategy every blood establishment must support while striving for error-free processing as the long-term objective. The auditing process has been realigned to support and facilitate this same objective. Implementing organization-wide quality assurance/total quality management is one proven plan for guaranteeing the quality of the 20 million products that are transfused into 4 million patients each year and for moving toward the new order. PMID:1286566

  2. Quality assurance and statistical control

    DEFF Research Database (Denmark)

    Heydorn, K.

    In scientific research laboratories it is rarely possible to use quality assurance schemes, developed for large-scale analysis. Instead methods have been developed to control the quality of modest numbers of analytical results by relying on statistical control: Analysis of precision serves to...

  3. Quality assurance in computing software

    International Nuclear Information System (INIS)

    The paper concerns quality assurance in computing software as applied to the nuclear industry. The emergence of Software Quality Management in systems procurement over the last decade is discussed, as are some of the underlying reasons for its important role in modern procurement practice. Some of the typical aspects of control are highlighted and discussed. (author)

  4. Quality assurance during site construction

    International Nuclear Information System (INIS)

    Quality Assurance for Nuclear Power Plants under consideration of pipe assembling. Flow of Quality Requirements during: - Desing - Construction - Procurement - Prefabrication - Site. Organizational Requirements and Measurements during Erection: - Incoming Control - Material Storage - Surveillance of Tools - Weld Surveillance - Nondestructive Testing - Cleaning - Final Documentation. Qualification and Training of QA Personnel. (orig.)

  5. Quality assurance manual: Volume 2, Appendices

    International Nuclear Information System (INIS)

    This paper contains quality assurance information on departments of the Stanford Linear Accelerator Center. Particular quality assurance policies and standards discussed are on: Mechanical Systems; Klystron and Microwave Department; Electronics Department; Plant Engineering; Accelerator Department; Purchasing; and Experimental Facilities Department

  6. Chemical identification and its quality assurance

    CERN Document Server

    Milman, Boris L

    2013-01-01

    Chemical Identification and its Quality Assurance shows how to apply the principles of quality assurance for qualitative chemical analysis. The principles of identification and metrological basics are presented, in addition to the reliability and errors involved with chemical identification.

  7. Quality assurance - how to involve the employees

    DEFF Research Database (Denmark)

    Jørgensen, Michael Søgaard

    1996-01-01

    An overview of strategies for involvement of employees in quality assurance developement and implementation.......An overview of strategies for involvement of employees in quality assurance developement and implementation....

  8. Quality assurance for environmental analytical chemistry: 1980

    International Nuclear Information System (INIS)

    The continuing quality assurance effort by the Environmental Surveillance Group is presented. Included are all standard materials now in use, their consensus or certified concentrations, quality control charts, and all quality assurance measurements made by H-8 during 1980

  9. Process chemistry {ampersand} statistics quality assurance plan

    Energy Technology Data Exchange (ETDEWEB)

    Meznarich, H.K.

    1996-08-01

    This document provides quality assurance guidelines and quality control requirements for Process Chemistry and Statistics. This document is designed on the basis of Hanford Analytical Services Quality Assurance Plan (HASQAP) technical guidelines and is used for governing process chemistry activities.

  10. Quality assurance for environmental analytical chemistry: 1980

    Energy Technology Data Exchange (ETDEWEB)

    Gladney, E.S.; Goode, W.E.; Perrin, D.R.; Burns, C.E.

    1981-09-01

    The continuing quality assurance effort by the Environmental Surveillance Group is presented. Included are all standard materials now in use, their consensus or certified concentrations, quality control charts, and all quality assurance measurements made by H-8 during 1980.

  11. NIF Projects Controls and Information Systems Software Quality Assurance Plan

    International Nuclear Information System (INIS)

    Quality achievement for the National Ignition Facility (NIF) and the National Ignition Campaign (NIC) is the responsibility of the NIF Projects line organization as described in the NIF and Photon Science Directorate Quality Assurance Plan (NIF QA Plan). This Software Quality Assurance Plan (SQAP) is subordinate to the NIF QA Plan and establishes quality assurance (QA) activities for the software subsystems within Controls and Information Systems (CIS). This SQAP implements an activity level software quality assurance plan for NIF Projects as required by the LLNL Institutional Software Quality Assurance Program (ISQAP). Planned QA activities help achieve, assess, and maintain appropriate quality of software developed and/or acquired for control systems, shot data systems, laser performance modeling systems, business applications, industrial control and safety systems, and information technology systems. The objective of this SQAP is to ensure that appropriate controls are developed and implemented for management planning, work execution, and quality assessment of the CIS organization's software activities. The CIS line organization places special QA emphasis on rigorous configuration control, change management, testing, and issue tracking to help achieve its quality goals.

  12. NIF Projects Controls and Information Systems Software Quality Assurance Plan

    Energy Technology Data Exchange (ETDEWEB)

    Fishler, B

    2011-03-18

    Quality achievement for the National Ignition Facility (NIF) and the National Ignition Campaign (NIC) is the responsibility of the NIF Projects line organization as described in the NIF and Photon Science Directorate Quality Assurance Plan (NIF QA Plan). This Software Quality Assurance Plan (SQAP) is subordinate to the NIF QA Plan and establishes quality assurance (QA) activities for the software subsystems within Controls and Information Systems (CIS). This SQAP implements an activity level software quality assurance plan for NIF Projects as required by the LLNL Institutional Software Quality Assurance Program (ISQAP). Planned QA activities help achieve, assess, and maintain appropriate quality of software developed and/or acquired for control systems, shot data systems, laser performance modeling systems, business applications, industrial control and safety systems, and information technology systems. The objective of this SQAP is to ensure that appropriate controls are developed and implemented for management planning, work execution, and quality assessment of the CIS organization's software activities. The CIS line organization places special QA emphasis on rigorous configuration control, change management, testing, and issue tracking to help achieve its quality goals.

  13. quality assurance systems in nuclear fuel procurement and manufacturing

    International Nuclear Information System (INIS)

    Quality is the totality of features and characteristics of a product or service that bear on its ability to satisfy stated or implied needs. Quality control is activities and techniques used to fulfill the requirements of quality. Quality assurance is a system and its main components are requirements. QA program, organization and responsibilities, design and verification, material and its control, manufacturing and process control, inspections, audits and documents: manuals, specifications, instructions. Quality assurance systems are largely based on ISO 9000 series of the International Standards Organization. ISO 9000 series has been adopted and published by Turkish Standards Institute as TS-ISO 9000. International Atomic Energy Agency also published a guide (50-SG-QA11) ''Quality Assurance in the Procurement, Design and Manufacture of Nuclear Fuel Assemblies'' in the safety guide series. In this study the role of quality control in quality assurance systems, inspection and test plans and acceptance and nonconformance quality levels will be explained in relation to nuclear fuel production. Examples of applications in quality assurance systems based on ISO 9000 will be given

  14. Automating linear accelerator quality assurance

    Energy Technology Data Exchange (ETDEWEB)

    Eckhause, Tobias; Thorwarth, Ryan; Moran, Jean M., E-mail: jmmoran@med.umich.edu [Department of Radiation Oncology, University of Michigan, Ann Arbor, Michigan 48109-5010 (United States); Al-Hallaq, Hania; Farrey, Karl [Department of Radiation Oncology and Cellular Oncology, The University of Chicago, Chicago, Illinois 60637 (United States); Ritter, Timothy [Ann Arbor VA Medical Center, Ann Arbor, Michigan 48109 (United States); DeMarco, John [Department of Radiation Oncology, Cedars-Sinai Medical Center, Los Angeles, California, 90048 (United States); Pawlicki, Todd; Kim, Gwe-Ya [UCSD Medical Center, La Jolla, California 92093 (United States); Popple, Richard [Department of Radiation Oncology, University of Alabama Birmingham, Birmingham, Alabama 35249 (United States); Sharma, Vijeshwar; Park, SungYong [Karmanos Cancer Institute, McLaren-Flint, Flint, Michigan 48532 (United States); Perez, Mario; Booth, Jeremy T. [Royal North Shore Hospital, Sydney, NSW 2065 (Australia)

    2015-10-15

    Purpose: The purpose of this study was 2-fold. One purpose was to develop an automated, streamlined quality assurance (QA) program for use by multiple centers. The second purpose was to evaluate machine performance over time for multiple centers using linear accelerator (Linac) log files and electronic portal images. The authors sought to evaluate variations in Linac performance to establish as a reference for other centers. Methods: The authors developed analytical software tools for a QA program using both log files and electronic portal imaging device (EPID) measurements. The first tool is a general analysis tool which can read and visually represent data in the log file. This tool, which can be used to automatically analyze patient treatment or QA log files, examines the files for Linac deviations which exceed thresholds. The second set of tools consists of a test suite of QA fields, a standard phantom, and software to collect information from the log files on deviations from the expected values. The test suite was designed to focus on the mechanical tests of the Linac to include jaw, MLC, and collimator positions during static, IMRT, and volumetric modulated arc therapy delivery. A consortium of eight institutions delivered the test suite at monthly or weekly intervals on each Linac using a standard phantom. The behavior of various components was analyzed for eight TrueBeam Linacs. Results: For the EPID and trajectory log file analysis, all observed deviations which exceeded established thresholds for Linac behavior resulted in a beam hold off. In the absence of an interlock-triggering event, the maximum observed log file deviations between the expected and actual component positions (such as MLC leaves) varied from less than 1% to 26% of published tolerance thresholds. The maximum and standard deviations of the variations due to gantry sag, collimator angle, jaw position, and MLC positions are presented. Gantry sag among Linacs was 0.336 ± 0.072 mm. The

  15. Automating linear accelerator quality assurance

    International Nuclear Information System (INIS)

    Purpose: The purpose of this study was 2-fold. One purpose was to develop an automated, streamlined quality assurance (QA) program for use by multiple centers. The second purpose was to evaluate machine performance over time for multiple centers using linear accelerator (Linac) log files and electronic portal images. The authors sought to evaluate variations in Linac performance to establish as a reference for other centers. Methods: The authors developed analytical software tools for a QA program using both log files and electronic portal imaging device (EPID) measurements. The first tool is a general analysis tool which can read and visually represent data in the log file. This tool, which can be used to automatically analyze patient treatment or QA log files, examines the files for Linac deviations which exceed thresholds. The second set of tools consists of a test suite of QA fields, a standard phantom, and software to collect information from the log files on deviations from the expected values. The test suite was designed to focus on the mechanical tests of the Linac to include jaw, MLC, and collimator positions during static, IMRT, and volumetric modulated arc therapy delivery. A consortium of eight institutions delivered the test suite at monthly or weekly intervals on each Linac using a standard phantom. The behavior of various components was analyzed for eight TrueBeam Linacs. Results: For the EPID and trajectory log file analysis, all observed deviations which exceeded established thresholds for Linac behavior resulted in a beam hold off. In the absence of an interlock-triggering event, the maximum observed log file deviations between the expected and actual component positions (such as MLC leaves) varied from less than 1% to 26% of published tolerance thresholds. The maximum and standard deviations of the variations due to gantry sag, collimator angle, jaw position, and MLC positions are presented. Gantry sag among Linacs was 0.336 ± 0.072 mm. The

  16. An approach to total quality assurance

    International Nuclear Information System (INIS)

    Total Quality Assurance must be based on amalgamating three quality functions: effective quality control, competent inspection, and regularly audited Quality Assurance programmes. In applying these functions the fuel supplier must regard each of his sub-contractors as part of his own works and ensure a common policy of motivated Quality Assurance throughout his own works and those of his suppliers. (author)

  17. 40 CFR 31.45 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Quality assurance. 31.45 Section 31.45... Requirements Reports, Records, Retention, and Enforcement § 31.45 Quality assurance. If the grantee's project... quality assurance practices consisting of policies, procedures, specifications, standards,...

  18. 40 CFR 30.54 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Quality assurance. 30.54 Section 30.54... NON-PROFIT ORGANIZATIONS Post-Award Requirements Reports and Records § 30.54 Quality assurance. If the... data generation, the grantee shall develop and implement quality assurance practices consisting...

  19. Final Hanford Site Transuranic (TRU) Waste Characterization Quality Assurance Project Plan

    International Nuclear Information System (INIS)

    The Transuranic Waste Characterization Quality Assurance Program Plan required each US Department of Energy (DOE) site that characterizes transuranic waste to be sent the Waste Isolation Pilot Plan that addresses applicable requirements specified in the QAPP

  20. Tank waste remediation system privatization phase I infrastructure, project W-519, Quality Assurance implementation plan

    International Nuclear Information System (INIS)

    This document has been prepared to identify the quality requirements for all products/activities developed by or for Project W-519. This plan is responsive to the Numatec Hanford Corporation, Quality Assurance Program Plan, NHC-MP-001