WorldWideScience

Sample records for assurance program fcap

  1. Quality assurance program

    International Nuclear Information System (INIS)

    This topical report describes the Gibbs and Hill Quality Assurance Program and sets forth the methods to be followed in controlling quality-related activities performed by Gibbs and Hill and its contractors. The program is based on company experience in nuclear power and related work, and defines a system found effective in providing independent control of quality-related functions and documentation. The scope of the report covers activities involving nuclear safety-related structures, systems, and components covered by Gibbs and Hill' contractual obligation to the Utility Owner for each project

  2. Quality-Assurance Program Plan

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) is provided to describe the Quality Assurance Program which is applied to the waste management activities conducted by AESD-Nevada Operations at the E-MAD Facility located in Area 25 of the Nevada Test Site. The AESD-Nevada Operations QAPP provides the necessary systematic and administrative controls to assure activities that affect quality, safety, reliability, and maintainability during design, procurement, fabrication, inspection, shipments, tests, and storage are conducted in accordance with established requirements

  3. Quality assurance program

    International Nuclear Information System (INIS)

    The concept of levels of quality assurance as applied to CANDU-type nuclear power plant components, i.e. maintaining an appropriate cost/benefit ratio, is introduced. The design process itself has quality assurance features by virtue of multi-level review. (E.C.B.)

  4. Dicty_cDB: FC-AP01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP01 (Link to dictyBase) - - - Contig-U15092-1 FC-AP01Z (Li...nk to Original site) - - FC-AP01Z 591 - - - - Show FC-AP01 Library FC (Link to library) Clone ID FC-AP01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP01Q.Seq.d/ Representative seq. ID FC-AP...01Z (Link to Original site) Representative DNA sequence >FC-AP01 (FC-AP01Q) /CSM/FC/FC-AP/FC-AP01Q.Seq....EELNISGPLSRNKLKWADFLNLTMNTNHARG HRHGRSPSKIFWRAVRGMLPHKTPRGQAALDNMKVFEGVPAPYDKVKRVVVPSALRVVKL NTTRKYTVLSRLSQE

  5. Dicty_cDB: FC-AP10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP10 (Link to dictyBase) - - - Contig-U15819-1 FC-AP10Z (Li...nk to Original site) - - FC-AP10Z 497 - - - - Show FC-AP10 Library FC (Link to library) Clone ID FC-AP10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP10Q.Seq.d/ Representative seq. ID FC-AP...10Z (Link to Original site) Representative DNA sequence >FC-AP10 (FC-AP10Q) /CSM/FC/FC-AP/FC-AP10Q.Seq....SGDWWDAELKGRRGKVPSNYLQLIKNAAPPRAGGPPVPTGNRA PTTTTTSGGSTRGGFNNGPSTAPSGRGAAPPSSRGGMAPRGGSVAPPSSRGGIAPRGGIA PRGGMAPRGGMAP

  6. Dicty_cDB: FC-AP07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP07 (Link to dictyBase) - - - Contig-U15932-1 FC-AP07P (Li...nk to Original site) FC-AP07F 546 FC-AP07Z 446 FC-AP07P 992 - - Show FC-AP07 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP07Q.Seq.d/ Representative seq. ID FC-AP...07P (Link to Original site) Representative DNA sequence >FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP...ificant alignments: (bits) Value FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP07Q.Seq.d/ 1148 0.0 SSM404 (SSM404Q)

  7. Dicty_cDB: FC-AP08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP08 (Link to dictyBase) - - - Contig-U16116-1 FC-AP08P (Li...nk to Original site) FC-AP08F 125 FC-AP08Z 352 FC-AP08P 477 - - Show FC-AP08 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP08Q.Seq.d/ Representative seq. ID FC-AP...08P (Link to Original site) Representative DNA sequence >FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP... (VSA612Q) /CSM/VS/VSA6-A/VSA612Q.Seq.d/ 624 e-178 FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP

  8. Quality Assurance Program and Brain Drain

    Science.gov (United States)

    Lien, Donald

    2008-01-01

    The number of colleges and universities in most developing countries has increased drastically over the past decades. The quality variation of these institutions is an alarming concern. Quality assurance programs are proposed and implemented. This paper evaluates the effects of quality assurance on the demand for college education, study abroad,…

  9. Good manufacturing practice - quality assurance programs

    International Nuclear Information System (INIS)

    The concept of good manufacturing practice (GMP) in the medical device industry requires the use of controlled methods and equipment in performing each step in the device manufacturing process. Quality assurance programs are used to maintain compliance with GMP requirements by prescribing the operating and control procedures to be used. The specific elements of a quality assurance program for the radiation sterilization of medical devices are described. (author)

  10. Dicty_cDB: FC-AP24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP24 (Link to dictyBase) - - - Contig-U16528-1 FC-AP24F (Li...nk to Original site) FC-AP24F 525 - - - - - - Show FC-AP24 Library FC (Link to library) Clone ID FC-AP24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP24Q.Seq.d/ Representative seq. ID FC-AP...24F (Link to Original site) Representative DNA sequence >FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq....C-BE24Q.Seq.d/ 1041 0.0 FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq.d/ 1041 0.0

  11. Dicty_cDB: FC-AP13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP13 (Link to dictyBase) - - - Contig-U15374-1 FC-AP13P (Li...nk to Original site) FC-AP13F 550 FC-AP13Z 184 FC-AP13P 734 - - Show FC-AP13 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP13Q.Seq.d/ Representative seq. ID FC-AP...13P (Link to Original site) Representative DNA sequence >FC-AP13 (FC-AP13Q) /CSM/FC/FC-AP/FC-AP...KKRKLNILIIII*fnnhqvmekkikkkiknkkn f*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP

  12. Dicty_cDB: FC-AP21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP21 (Link to dictyBase) - - - Contig-U15099-1 FC-AP21Z (Li...nk to Original site) - - FC-AP21Z 511 - - - - Show FC-AP21 Library FC (Link to library) Clone ID FC-AP21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP21Q.Seq.d/ Representative seq. ID FC-AP...21Z (Link to Original site) Representative DNA sequence >FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP21Q.Seq....14Q.Seq.d/ 1013 0.0 SLE553 (SLE553Q) /CSM/SL/SLE5-C/SLE553Q.Seq.d/ 1013 0.0 FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP

  13. Dicty_cDB: FC-AP22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP22 (Link to dictyBase) - G24045 DDB0232387 Contig-U15141-1 FC-AP...22F (Link to Original site) FC-AP22F 317 - - - - - - Show FC-AP22 Library FC (Link to library) Clone ID FC-AP...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP22Q.Se...q.d/ Representative seq. ID FC-AP22F (Link to Original site) Representative DNA sequence >FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP...KKKKKKK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP

  14. National Program of Quality Assurance in Radiotherapy in Cuba

    International Nuclear Information System (INIS)

    It tries on the establishment of a Quality Assurance Nacional System, a Quality Assurance Committee implemented in Cuba, and a Quality Auditory National Program implemented in Cuba to control and assure radiotherapy quality

  15. Dicty_cDB: FC-AP23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP23 (Link to dictyBase) - G03230 DDB0190153 Contig-U16094-1 FC-AP...23P (Link to Original site) FC-AP23F 515 FC-AP23Z 472 FC-AP23P 987 - - Show FC-AP23 Library FC (Link ...ontig Contig-U16094-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...23Q.Seq.d/ Representative seq. ID FC-AP23P (Link to Original site) Representative DNA sequence >FC-AP23 (FC-AP...23Q) /CSM/FC/FC-AP/FC-AP23Q.Seq.d/ CAAATACATAATCTCTTTTTTGAAAATGTCCGAAAATAACGAAATTGAAATGGAACTCC

  16. Dicty_cDB: FC-AP12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP12 (Link to dictyBase) - G01739 DDB0232214 Contig-U15924-1 FC-AP...12P (Link to Original site) FC-AP12F 323 FC-AP12Z 613 FC-AP12P 936 - - Show FC-AP12 Library FC (Link ...ontig Contig-U15924-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...12Q.Seq.d/ Representative seq. ID FC-AP12P (Link to Original site) Representative DNA sequence >FC-AP12 (FC-AP...12Q) /CSM/FC/FC-AP/FC-AP12Q.Seq.d/ CATATTATTTTAAATTTCAGATGTTCCCAAAATAACACATTAATTTGCTTTTTTTGTTG

  17. The quality assurance program at K & S

    Energy Technology Data Exchange (ETDEWEB)

    Slowey, T.W. [AAPM Accredited Dosimetry Calibration Laboratory, Nashville, TN (United States)

    1993-12-31

    K & S operates the largest and one of the most comprehensive Accredited Dosimetry Calibration Laboratories (ADCLs) in the American Association of Physicists in Medicine (AAPM) secondary laboratory system. It offers calibrations covering energies from Grenz-Ray (0.03-mm Al) to cesium-137 and cobalt-60, brachytherapy source and well chamber calibrations for low-activity sources, and, recently, high-dose-rate iridium-192. The present Quality Assurance (QA) program at K & S began with the AAPM Guidelines for Accreditation (Task Group No. 22 and No. 3, 1989) and grew over the past 10 years to include all aspects of providing a private, self-supporting calibration service from a free-standing independent facility. Some aspects of the QA program were prompted by the requirements of the nuclear power industry while other parts were from national consensus standards or the experiences of staff. Redundancy and teamwork are the most important characteristics of this QA program. K & S has participated in a National Institute of Standards and Technology (NIST) measurement quality assurance (MQA) program since 1982, and, in recent years, an ADCL intralaboratory intercomparison was conducted by Task Group 3 of the Radiation Therapy Committee of the AAPM. One measure of the credibility of a QA program is consistent performance on the MQA program and the ADCL intercomparisons over the past 10 years. An equally important measure of the ability of a program to assure quality results is the frequency of reported errors.

  18. Nuclear medicine quality assurance program in Argentina

    International Nuclear Information System (INIS)

    A two steps program has been implemented: the first one is the quality control of the equipment and the second one the development of standard procedures for clinical studies of patients. A training program for doctors and technicians of the nuclear medicine laboratories was carried out. Workshops on instrumentation and quality assurance in nuclear medicine have been organized in several parts of the country. A joint program of the CNEA and the University of Buenos Aires has trained medical physicists. A method has been established to evaluate the capability of the laboratories to produce high quality images and to follow up the implementation of the quality control program

  19. Operating and Assurance Program Plan. Revision 4

    Energy Technology Data Exchange (ETDEWEB)

    1994-07-01

    The LBL Operating and Assurance Program (OAP) is a management system and a set of requirements designed to maintain the level of performance necessary to achieve LBL`s programmatic and administrative objectives effectively and safely through the application of quality assurance and related conduct of operations and maintenance management principles. Implement an LBL management philosophy that supports and encourages continual improvement in performance and quality at the Laboratory. Provide an integrated approach to compliance with applicable regulatory requirements and DOE orders. The OAP is intended to meet the requirements of DOE Order 5700.6C, Quality Assurance. The Program also contains management system elements of DOE Orders 5480.19, Conduct of Operations Requirements for DOE Facilities; 5480.25, Safety of Accelerator Facilities; and 4330.4A, Maintenance Management Program, and is meant to integrate these elements into the overall LBL approach to Laboratory management. The requirements of this program apply to LBL employees and organizations, and to contractors and facility users as managed by their LBL sponsors. They are also applicable to external vendors and suppliers as specified in procurement documents and contracts.

  20. Dicty_cDB: FC-AP17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 SJMBIB09 SJM Schistosoma japonicum cDNA, mRNA sequence. 80 8e-20 2 BE859184 |BE859184.1 SsS0499 Suaeda salsa ZAP...FC (Link to library) FC-AP17 (Link to dictyBase) - - - Contig-U16254-1 FC-AP17Z (Li...nk to Original site) - - FC-AP17Z 546 - - - - Show FC-AP17 Library FC (Link to library) Clone ID FC-AP17 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP17Q.Seq.d/ Representative seq. ID FC-AP...17Z (Link to Original site) Representative DNA sequence >FC-AP17 (FC-AP17Q) /CSM/FC/FC-AP/FC-AP17Q.Seq.

  1. Dicty_cDB: FC-AP11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone IMAGE:4920557 5', mRNA sequence. 56 1e-04 2 BF345929 |BF345929.1 602017931F1 NCI_CGAP_Brn67 Homo sap...FC (Link to library) FC-AP11 (Link to dictyBase) - - - Contig-U16101-1 FC-AP11F (Li...nk to Original site) FC-AP11F 394 - - - - - - Show FC-AP11 Library FC (Link to library) Clone ID FC-AP11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP11Q.Seq.d/ Representative seq. ID FC-AP...11F (Link to Original site) Representative DNA sequence >FC-AP11 (FC-AP11Q) /CSM/FC/FC-AP/FC-AP11Q.Seq.

  2. Dicty_cDB: FC-AP18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP18 (Link to dictyBase) - - - Contig-U16455-1 FC-AP18Z (Li...nk to Original site) - - FC-AP18Z 367 - - - - Show FC-AP18 Library FC (Link to library) Clone ID FC-AP18 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP18Q.Seq.d/ Representative seq. ID FC-AP...18Z (Link to Original site) Representative DNA sequence >FC-AP18 (FC-AP18Q) /CSM/FC/FC-AP/FC-AP18Q.Seq....XELTPSRPMCVESFNEYPP LGRFAVRDMGQTVAVGVIKSTVKKAPGKAGDKKGAXAPSKKK*innis**iafynnfkkk kkkkk Translated Amino Acid

  3. Dicty_cDB: FC-AP16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP16 (Link to dictyBase) - - - Contig-U16269-1 FC-AP16Z (Li...nk to Original site) - - FC-AP16Z 552 - - - - Show FC-AP16 Library FC (Link to library) Clone ID FC-AP16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP16Q.Seq.d/ Representative seq. ID FC-AP...16Z (Link to Original site) Representative DNA sequence >FC-AP16 (FC-AP16Q) /CSM/FC/FC-AP/FC-AP16Q.Seq....7. 3.28 Translated Amino Acid sequence ---RNRRYKVRKGPLVVVSGKTTVSQALRNIPGVEVANVSRLNLLKLAPGGHLGRFIIWT KSAFEQLD

  4. Dicty_cDB: FC-AP05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP05 (Link to dictyBase) - - - Contig-U16521-1 FC-AP05Z (Li...nk to Original site) - - FC-AP05Z 532 - - - - Show FC-AP05 Library FC (Link to library) Clone ID FC-AP05 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP05Q.Seq.d/ Representative seq. ID FC-AP...05Z (Link to Original site) Representative DNA sequence >FC-AP05 (FC-AP05Q) /CSM/FC/FC-AP/FC-AP05Q.Seq....GAGA TCCGTCAAAGTTTCAAGCAAAAAAGTTGTTGCCAAGTAAATAAATAATACTTTTTTCCCT AT sequence update 1997. 3.25 Translated Amino Acid sequence ---AP

  5. Assurance management program for the 30 Nova laser fusion project

    International Nuclear Information System (INIS)

    The Nova assurance management program was developed using the quality assurance (QA) approach first implemented at LLNL in early 1978. The LLNL QA program is described as an introduction to the Nova assurance management program. The Nova system is described pictorially through the Nova configuration, subsystems and major components, interjecting the QA techniques which are being pragmatically used to assure the successful completion of the project

  6. Quality Assurance Program for Molecular Medicine Laboratories

    Directory of Open Access Journals (Sweden)

    F Sabzavi

    2013-01-01

    Full Text Available Background: Molecular diagnostic methods have played and continuing to have a critical role in clinical laboratories in recent years. Therefore, standardization is an evolutionary process that needs to be upgrade with increasing scientific knowledge, improvement of the instruments and techniques. The aim of this study was to design a quality assurance program in order to have similar conditions for all medical laboratories engaging with molecular tests.Methods: We had to design a plan for all four elements; required space conditions, equipments, training, and basic guidelines. Necessary guidelines was prepared and confirmed by the launched specific committee at the Health Reference Laboratory.Results: Several workshops were also held for medical laboratories directors and staffs, quality control manager of molecular companies, directors and nominees from universities. Accreditation of equipments and molecular material was followed parallel with rest of program. Now we are going to accredit medical laboratories and to evaluate the success of the program.Conclusion: Accreditation of medical laboratory will be succeeding if its basic elements are provided in advance. Professional practice guidelines, holding training and performing accreditation the molecular materials and equipments ensured us that laboratories are aware of best practices, proper interpretation, limitations of techniques, and technical issues. Now, active external auditing can improve the applied laboratory conditions toward the defined standard level.

  7. Implementation plan: Quality assurance requirements: Hazardous Waste Remedial Actions Program

    International Nuclear Information System (INIS)

    This document establishes the Quality Assurance (QA) Program requirements for the Hazards Waste remedial Actions Program (HASWRAP) for ensuring, with a high degree of confidence, that program objectives will be achieved as planned. The QA Program is introduced in Sect. 1. The HAZWRAP Support Contractor Office (SCO) functional organization and QA responsibilities are shown in Sect. 2. QA program requirements are contained in Sect. 3. These requiremens are pased on the American national Standard, American National Standards Institute/American Society of Mechanical Engineers NQA-1 Quality Assurance Program Requirements for Nuclear Facilities. The 18 elements defined in the standard are tailored to HAZWRAP's needs. The QA program requirements are delineated under the major headings: Quality Assurance Program, Organization, and Control of Quality;two additional program requirements, Software Quality Assurance and Problem Prevention, are included. Definitions of QA terms and the list of formal reports published by the HAZWRAP SCO are included as appendixes. 8 refs., 1 fig

  8. Quality Assurance Program Plan for the Environmental Restoration Program

    International Nuclear Information System (INIS)

    The United States Department of Energy (USDOE) has initiated the Environmental Restoration Program (ERP) in an effort to manage, control and remediate existing hazardous, toxic and radioactive wastes generated at the Portsmouth Gaseous Diffusion Plant (PORTS). This ERP Quality Assurance Program Plan (QAPP) is responsive to the PORTS ESH Division QAPP and the ES Environmental Restoration Division (ERD) QAPP. This QAPP establishes the policies, requirements and responsibilities by which an appropriate level of QA shall be implemented within the PORTS-ERP. All PORTS-ERP activities shall be conducted in accordance with the requirements of this document and/or of a project level document which is derivative of this document

  9. Quality Assurance Program Plan for radionuclide airborne emissions monitoring

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) describes the quality assurance requirements and responsibilities for radioactive airborne emissions measurements activities from regulated stacks are controlled at the Hanford Site. Detailed monitoring requirements apply to stacks exceeding 1% of the standard of 10 mrem annual effective dose equivalent to the maximally exposed individual from operations of the Hanford Site

  10. Quality Assurance Program Plan for radionuclide airborne emissions monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Vance, L.M.

    1993-07-01

    This Quality Assurance Program Plan (QAPP) describes the quality assurance requirements and responsibilities for radioactive airborne emissions measurements activities from regulated stacks are controlled at the Hanford Site. Detailed monitoring requirements apply to stacks exceeding 1% of the standard of 10 mrem annual effective dose equivalent to the maximally exposed individual from operations of the Hanford Site.

  11. Building a global information assurance program

    CERN Document Server

    Curts, Raymond J

    2002-01-01

    INTRODUCTION TO INFORMATION ASSURANCE (IA)AuthenticationConfidentialityNon-repudiationBASIC CONCEPTSAttributesInformation AttributesPure Information AttributesAttributes Influenced by the SystemSystem AttributesSecurity AttributesInformation System Support Planning PrinciplesThe Bottom Line, RevisitedInformation Assurance (IA)Commercial CapabilitiesSecurityNetwork ViewsRisk ManagementCognitive HierarchyTypes of LogicSummaryRISK, THREAT AND VULNERABILITYOVERVIEW OF SYSTEMS ENGINEERINGA Systems Engineering Case StudyCase Study BackgroundThe MissionThe GoalAn Approach Toward A SolutionCase Tools:

  12. Transuranic Waste Characterization Quality Assurance Program Plan

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-04-30

    This quality assurance plan identifies the data necessary, and techniques designed to attain the required quality, to meet the specific data quality objectives associated with the DOE Waste Isolation Pilot Plant (WIPP). This report specifies sampling, waste testing, and analytical methods for transuranic wastes.

  13. Marshall Island radioassay quality assurance program an overview

    Energy Technology Data Exchange (ETDEWEB)

    Conrado, C.L.; Hamilton, T.F.; Kehl, S.R.; Robison, W.L.; Stoker, A.C.

    1998-09-01

    The Lawrence Livermore National Laboratory has developed an extensive quality assurance program to provide high quality data and assessments in support of the Marshall Islands Dose Assessment and Radioecology Program. Our quality assurance objectives begin with the premise of providing integrated and cost-effective program support (to meet wide-ranging programmatic needs, scientific peer review, litigation defense, and build public confidence) and continue through from design and implementation of large-scale field programs, sampling and sample preparation, radiometric and chemical analyses, documentation of quality assurance/quality control practices, exposure assessments, and dose/risk assessments until publication. The basic structure of our radioassay quality assurance/quality control program can be divided into four essential elements; (1) sample and data integrity control; (2) instrument validation and calibration; (3) method performance testing, validation, development and documentation; and (4) periodic peer review and on-site assessments. While our quality assurance objectives are tailored towards a single research program and the evaluation of major exposure pathways/critical radionuclides pertinent to the Marshall Islands, we have attempted to develop quality assurance practices that are consistent with proposed criteria designed for laboratory accre

  14. Measurement assurance program for FTIR analyses of deuterium oxide samples

    International Nuclear Information System (INIS)

    Analytical chemistry measurements require an installed criterion based assessment program to identify and control sources of error. This program should also gauge the uncertainty about the data. A self- assessment was performed of long established quality control practices against the characteristics of a comprehensive measurement assurance program. Opportunities for improvement were identified. This paper discusses the efforts to transform quality control practices into a complete measurement assurance program. The resulting program heightened the laboratory's confidence in the data it generated, by providing real-time statistical information to control and determine measurement quality

  15. Mixed Waste Integrated Program Quality Assurance requirements plan

    International Nuclear Information System (INIS)

    Mixed Waste Integrated Program (MWIP) is sponsored by the US Department of Energy (DOE), Office of Technology Development, Waste Management Division. The strategic objectives of MWIP are defined in the Mixed Waste Integrated Program Strategic Plan, and expanded upon in the MWIP Program Management Plan. This MWIP Quality Assurance Requirement Plan (QARP) applies to mixed waste treatment technologies involving both hazardous and radioactive constituents. As a DOE organization, MWIP is required to develop, implement, and maintain a written Quality Assurance Program in accordance with DOE Order 4700.1 Project Management System, DOE Order 5700.6C, Quality Assurance, DOE Order 5820.2A Radioactive Waste Management, ASME NQA-1 Quality Assurance Program Requirements for Nuclear Facilities and ANSI/ASQC E4-19xx Specifications and Guidelines for Quality Systems for Environmental Data Collection and Environmental Technology Programs. The purpose of the MWIP QA program is to establish controls which address the requirements in 5700.6C, with the intent to minimize risks and potential environmental impacts; and to maximize environmental protection, health, safety, reliability, and performance in all program activities. QA program controls are established to assure that each participating organization conducts its activities in a manner consistent with risks posed by those activities

  16. 40 CFR 265.19 - Construction quality assurance program.

    Science.gov (United States)

    2010-07-01

    ... program. (a) CQA program. (1) A construction quality assurance (CQA) program is required for all surface... components, where applicable: (i) Foundations; (ii) Dikes; (iii) Low-permeability soil liners; (iv... specifications and good engineering practices, and proper installation of all components (e.g., pipes)...

  17. Quality assurance program description: Hanford Waste Vitrification Plant, Part 1

    International Nuclear Information System (INIS)

    This document describes the Department of Energy's Richland Field Office (DOE-RL) quality assurance (QA) program for the processing of high-level waste as well as the Vitrification Project Quality Assurance Program for the design and construction of the Hanford Waste Vitrification Plant (HWVP). It also identifies and describes the planned activities that constitute the required quality assurance program for the HWVP. This program applies to the broad scope of quality-affecting activities associated with the overall HWVP Facility. Quality-affecting activities include designing, purchasing, fabricating, handling, shipping, storing, cleaning, erecting, installing, inspecting, testing, maintaining, repairing, and modifying. Also included are the development, qualification, and production of waste forms which may be safely used to dispose of high-level radioactive waste resulting from national defense activities. The HWVP QA program is made up of many constituent programs that are being implemented by the participating organizations. This Quality Assurance program description is intended to outline and define the scope and application of the major programs that make up the HWVP QA program. It provides a means by which the overall program can be managed and directed to achieve its objectives. Subsequent parts of this description will identify the program's objectives, its scope, application, and structure

  18. The NASA Commercial Crew Program (CCP) Mission Assurance Process

    Science.gov (United States)

    Canfield, Amy

    2016-01-01

    In 2010, NASA established the Commercial Crew Program in order to provide human access to the International Space Station and low earth orbit via the commercial (non-governmental) sector. A particular challenge to NASA has been how to determine the commercial providers transportation system complies with Programmatic safety requirements. The process used in this determination is the Safety Technical Review Board which reviews and approves provider submitted Hazard Reports. One significant product of the review is a set of hazard control verifications. In past NASA programs, 100 percent of these safety critical verifications were typically confirmed by NASA. The traditional Safety and Mission Assurance (SMA) model does not support the nature of the Commercial Crew Program. To that end, NASA SMA is implementing a Risk Based Assurance (RBA) process to determine which hazard control verifications require NASA authentication. Additionally, a Shared Assurance Model is also being developed to efficiently use the available resources to execute the verifications. This paper will describe the evolution of the CCP Mission Assurance process from the beginning of the Program to its current incarnation. Topics to be covered include a short history of the CCP; the development of the Programmatic mission assurance requirements; the current safety review process; a description of the RBA process and its products and ending with a description of the Shared Assurance Model.

  19. Development of a multihospital pharmacy quality assurance program.

    Science.gov (United States)

    Hoffmann, R P; Ravin, R; Colaluca, D M; Gifford, R; Grimes, D; Grzegorczyk, R; Keown, F; Kuhr, F; McKay, R; Peyser, J; Ryan, R; Zalewski, C

    1980-07-01

    Seven community hospitals have worked cooperatively for 18 months to develop an initial hospital pharmacy quality assurance program. Auditing criteria were developed for nine service areas corresponding to the model program developed by the American Society of Hospital Pharmacists. Current plans are to implement and modify this program as required at each participating hospital. Follow-up programs will also be essential to a functional, ongoing program, and these will be developed in the future. PMID:10247657

  20. Quality assurance program preparation - review of requirements and plant systems - selection of program levels

    International Nuclear Information System (INIS)

    The establishment and implementation for a practicable quality assurance program for a nuclear power plant demands a detailed background in the field of engineering, manufacturing, organization and quality assurance. It will be demonstrated with examples to define and control the achievement of quality related activities during the phases of design, procurement, manufactoring, commissioning and operation. In general the quality assurance program applies to all items, processes and services important to safety of nuclear power plant. The classification for safety related and non-safety related items and services demonstrate the levels of quality assurance requirements. The lecture gives an introduction of QA Program preparation under the following topics: -Basic criteria and international requirements - Interaction of QA activities - Modular and product oriented QA programs - Structuring of organization for the QA program - Identification of the main quality assurance functions and required actions - Quality Assurance Program documentation - Documentation of planning of activities - Control of program documents - Definitions. (orig./RW)

  1. The Rockford School of Medicine Undergraduate Quality Assurance Program

    Science.gov (United States)

    Barr, Daniel; And Others

    1976-01-01

    An undergraduate program of ambulatory care quality assurance is described which has been operational at the Rockford School of Medicine for three years. Focus is on involving students in peer review and related audit activities. Results of preliminary evaluation are reported and generalizations offered. (JT)

  2. 78 FR 54510 - New Entrant Safety Assurance Program Operational Test

    Science.gov (United States)

    2013-09-04

    ... Process'' on May 13, 2002 (67 FR 31978), which became effective January 1, 2003. Subpart D of 49 CFR part... determine if the carrier is exercising basic safety management controls. On December 16, 2008 (73 FR 76472... TRANSPORTATION Federal Motor Carrier Safety Administration New Entrant Safety Assurance Program Operational...

  3. ERD UMTRA Project quality assurance program plan, Revision 7

    International Nuclear Information System (INIS)

    This document is the revised Quality Assurance Program Plan (QAPP) dated September, 1995 for the Environmental Restoration Division (ERD) Uranium Mill Tailings Remedial Action Project (UMTRA). Quality Assurance requirements for the ERD UMTRA Project are based on the criteria outlined in DOE Order 5700.6C or applicable sections of 10 CFR 830.120. QA requirements contained in this QAPP shall apply to all personnel, processes, and activities, including planning, scheduling, and cost control, performed by the ERD UMTRA Project and its contractors

  4. 200 Area Liquid Effluent Facilities -- Quality assurance program plan

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) describes the quality assurance and management controls used by the 200 Area Liquid Effluent Facilities (LEF) to perform its activities in accordance with DOE Order 5700.6C. The 200 Area LEF consists of the following facilities: Effluent Treatment Facility (ETF); Treated Effluent Disposal Facility (TEDF); Liquid Effluent Retention facility (LERF); and Truck Loading Facility -- (Project W291). The intent is to ensure that all activities such as collection of effluents, treatment, concentration of secondary wastes, verification, sampling and disposal of treated effluents and solids related with the LEF operations, conform to established requirements

  5. Quality assurance program in diagnostic radiology

    International Nuclear Information System (INIS)

    Aiming to elaborate a methodology to optimize the performance of the Radiology Service of the Military Police Hospital, in Rio dee Janeiro, some goals were established: improvement of the attendance to patients; improvement of the qualification of technicians; achievement and maintenance of high degrees of quality in each step of the radiological process; improvement of the image quality; optimization of dose per examination and cost reduction. The procedure used to detect faults in the radiological process was the analysis of causes of film losses. Results show a 70% reduction in the film rejection rate. 74% of total identified faults were due to equipment, 11% to films, 10% to patients and 5% to developing. The reduction in the cost of developed film reached 75%. A training course given to the staff of the radiological service fully reached its goals, contributing, with the staff motivation, mostly to the success of the program. This success indicates that, with a serious persistent work, it is possible to offer to patients services within their expectations, even at a public hospital. Such programs should be supported by health authorities, not only due to their technical and economic needs but, mostly, due to their social implications. (author). 10 refs., 11 figs

  6. The role of the EPA radiation quality assurance program in the measurement quality assurance accreditation program for radioassay laboratories

    Energy Technology Data Exchange (ETDEWEB)

    Grady, T.M. [Environmental Monitoring Systems Laboratory, Las Vegas, NV (United States)

    1993-12-31

    As the nature and extent of radiological contamination becomes better documented and more public, radioanalytical laboratories are faced with a constantly expanding variety of new and difficult analytical requirements. Concurrent with those requirements is the responsibility to provide customers, regulatory officials, or the public with defensible data produced in an environment of verifiable, controlled quality. To meet that need, a quality assurance accreditation program for radioassay laboratories has been proposed by the American National Standards Institute (ANSI). The standard will provide the organizational framework and functional requirements needed to assure the quality of laboratory outputs. Under the proposed program, the U.S. Environmental Protection Agency`s (EPA`s) Laboratory Intercomparison Program plays a key role as a reference laboratory. The current and proposed roles of the EPA Intercomparison Program are discussed, as are the functional relationships between EPA, the accreditating organization, and the service and monitoring laboratories.

  7. Quality Assurance program plan - plutonium stabilization and handling project W-460

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) identifies Project Quality Assurance (QA) program requirements for all parties participating in the design, procurement, demolition, construction, installation, inspection and testing for Project W-460

  8. UMTRA technical assistance contractor quality assurance program plan

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) provides the primary requirements for the integration of quality functions into all Technical Assistance Contractor (TAC) Project organization activities. The QAPP is the written directive authorized by the TAc Program Manager to accomplish this task and to implement procedures that provide the controls and sound management practices needed to ensure TAC contractual obligations are met. The QA program is designed to use monitoring, audit, and surveillance functions as management tools to ensure that all Project organization functions are executed in a manner that will protect public health and safety, promote the success of the Project, and meet or exceed contract requirements

  9. UMTRA Project Office quality assurance program plan. Revision 6

    International Nuclear Information System (INIS)

    The Uranium Mill Tailings Remedial Action (UMTRA) Project was established to accomplish remedial actions at inactive uranium mill tailings sites. The UMTRA Project's mission is to stabilize and control the residual radioactive materials at designated sites in a safe and environmentally sound manner so as to minimize or eliminate radiation health hazards to the public. Because these efforts may involve possible risks to public health and safety, a quality assurance (QA) program that conforms to the applicable criteria has been established to control the quality of the work. This document, the Quality Assurance Program Plan (QAPP), brings into one document the essential criteria to be applied on a selective basis, depending upon the nature of the activity being conducted, and describes how those criteria shall be applied to the UMTRA Project. QA requirements contained in this QAPP shall apply to all personnel, processes, and activities, including planning, scheduling, and cost control, performed by the UMTRA Project Office and its contractors

  10. Participation in Quality Assurance Programs in the Apple Industry

    OpenAIRE

    Bewsell, Denise; Kaine, Geoff

    2006-01-01

    There are several quality assurance (QA) programs operating in Australia for horticulturalists. The documentation of orchard activities and decision making are key features of any QA system. Activities of interest are management of pest and diseases, irrigation, fertiliser management, and fruit production and packing. This documentation provides a means of tracing product flow and is evidence that growers are acting in an environmentally responsible manner to help achieve food safety. QA syst...

  11. Developing a quality assurance program for online services.

    OpenAIRE

    Humphries, A W; Naisawald, G V

    1991-01-01

    A quality assurance (QA) program provides not only a mechanism for establishing training and competency standards, but also a method for continuously monitoring current service practices to correct shortcomings. The typical QA cycle includes these basic steps: select subject for review, establish measurable standards, evaluate existing services using the standards, identify problems, implement solutions, and reevaluate services. The Claude Moore Health Sciences Library (CMHSL) developed a qua...

  12. NIF Project Quality Assurance Program Plan Revision E

    Energy Technology Data Exchange (ETDEWEB)

    Dun, C; Brereton, S; Yatabe, J; Moses, E I

    2001-06-01

    The National Ignition Facility (NIF) is a key constituent of the Department Energy's (DOE's) Stockpile Stewardship Program. The NIF will use inertial confinement fusion (ICF) to produce ignition and energy gain in ICF targets and will perform weapons physics, weapons effects, and high-energy-density experiments in support of national security and civilian objectives. The primary mission of the NIF Project is the design and construction of the facility and equipment, acceptance testing, and activation. To accomplish this mission, the LLNL Director created the NIF Programs Directorate, and within that Directorate, the NIF Project Office to organize and manage the Project. The NIF Project Office establishes this QA Program to ensure its success. This QA Program Plan (QAPP) defines and describes the program--the management system--for specifying, achieving, and assuring the quality of all NIF Project work consistent with the policies of LLNL and the NIF Programs Directorate.

  13. Quality assurance program plan for low-level waste at the WSCF Laboratory

    International Nuclear Information System (INIS)

    The purpose of this document is to provide guidance for the implementation of the Quality Assurance Program Plan (QAPP) for the management of low-level waste at the Waste Sampling and Characterization Facility (WSCF) Laboratory Complex as required by WHC-CM-4-2, Quality Assurance Manual, which is based on Quality Assurance Program Requirements for Nuclear Facilities, NQA-1 (ASME)

  14. Argonne National Laboratory Internal Appraisal Program environment, safety, health/quality assurance oversight

    Energy Technology Data Exchange (ETDEWEB)

    Winner, G.L.; Siegfried, Y.S.; Forst, S.P.; Meshenberg, M.J.

    1995-06-01

    Argonne National Laboratory`s Internal Appraisal Program has developed a quality assurance team member training program. This program has been developed to provide training to non-quality assurance professionals. Upon successful completion of this training and approval of the Internal Appraisal Program Manager, these personnel are considered qualified to assist in the conduct of quality assurance assessments. The training program has been incorporated into a self-paced, computerized, training session.

  15. Quality Assurance Program Plan (QAPP) Waste Management Project

    Energy Technology Data Exchange (ETDEWEB)

    VOLKMAN, D.D.

    1999-10-27

    This document is the Quality Assurance Program Plan (QAPP) for Waste Management Federal Services of Hanford, Inc. (WMH), that implements the requirements of the Project Hanford Management Contract (PHMC), HNF-MP-599, Project Hanford Quality Assurance Program Description (QAPD) document, and the Hanford Federal Facility Agreement with Consent Order (Tri-Party Agreement), Sections 6.5 and 7.8. WHM is responsible for the treatment, storage, and disposal of liquid and solid wastes generated at the Hanford Site as well as those wastes received from other US Department of Energy (DOE) and non-DOE sites. WMH operations include the Low-Level Burial Grounds, Central Waste Complex (a mixed-waste storage complex), a nonradioactive dangerous waste storage facility, the Transuranic Storage Facility, T Plant, Waste Receiving and Processing Facility, 200 Area Liquid Effluent Facility, 200 Area Treated Effluent Disposal Facility, the Liquid Effluent Retention Facility, the 242-A Evaporator, 300 Area Treatment Effluent Disposal Facility, the 340 Facility (a radioactive liquid waste handling facility), 222-S Laboratory, the Waste Sampling and Characterization Facility, and the Hanford TRU Waste Program.

  16. Developing a quality assurance program for online services.

    Science.gov (United States)

    Humphries, A W; Naisawald, G V

    1991-07-01

    A quality assurance (QA) program provides not only a mechanism for establishing training and competency standards, but also a method for continuously monitoring current service practices to correct shortcomings. The typical QA cycle includes these basic steps: select subject for review, establish measurable standards, evaluate existing services using the standards, identify problems, implement solutions, and reevaluate services. The Claude Moore Health Sciences Library (CMHSL) developed a quality assurance program for online services designed to evaluate services against specific criteria identified by research studies as being important to customer satisfaction. These criteria include reliability, responsiveness, approachability, communication, and physical factors. The application of these criteria to the library's existing online services in the quality review process is discussed with specific examples of the problems identified in each service area, as well as the solutions implemented to correct deficiencies. The application of the QA cycle to an online services program serves as a model of possible interventions. The use of QA principles to enhance online service quality can be extended to other library service areas.

  17. Recommendations for quality assurance programs in nuclear medicine facilities. Radiation recommendations series

    International Nuclear Information System (INIS)

    The publication provides the elements that should be considered by nuclear medicine facilities to improve their existing programs or develop new quality assurance programs. The important administrative aspects of quality assurance programs are stressed. Each facility is encouraged to adopt those elements of the recommended program that are appropriate to its individual needs and resources

  18. Three steps to a more successful quality assurance program

    International Nuclear Information System (INIS)

    The three steps that will be presented are by no means a cure-all for the variety of problems and challenges that a Quality Assurance (QA) Department is faced with in its role in the design and construction of a nuclear power plant. However, these steps are considered to be three of the most important ones in the realization of an effective and efficient QA program. Step 1. Awareness. With the multitude of people involved in activities that effect the resultant Quality of Design, Procurement, and Construction of a nuclear power plant, a concerted effort has been put forth at Bechtel to promote 'Quality Awareness'. This effort has resulted in presentations to thousands of engineers, buyers, superintendents, supervisors and many others to make them more aware of their role in the Quality program. These presentations cover the Quality criteria, organizations, manuals, and implementation responsibilities that constitute the Company Quality program. In addition to the above, many specialized courses covering inspection techniques, communications, auditing, problem solving, etc. have been given to the people involved in the Generic Quality Assurance functions. Step 2. Attitude. Nuclear Power Quality requirements are quite stringent and have presented additional requirements to engineers, buyers, and superintendents who have previously designed and constructed fossil fuel power plants. Logically there was a resistance to these new requirements and a number of attitudes had to be changed. The most effective way that we have found to accomplish this is through communications from top management expressing their support of the Quality Program. Step 3. Objective and economical compliance. With the increased awareness and a more positive attitude toward Quality requirements, Bechtel has been able to devote considerable effort on finding effective methods to comply with Quality requirements in the most economical way. The complete presentation will include several examples of

  19. Environmental Assurance Program for the Phoenix Mars Mission

    Science.gov (United States)

    Man, Kin F.; Natour, Maher C.; Hoffman, Alan R.

    2008-01-01

    The Phoenix Mars mission involves delivering a stationary science lander on to the surface of Mars in the polar region within the latitude band 65 deg N to 72 deg N. Its primary objective is to perform in-situ and remote sensing investigations that will characterize the chemistry of the materials at the local surface, subsurface, and atmosphere. The Phoenix spacecraft was launched on August 4, 2007 and will arrive at Mars in May 2008. The lander includes a suite of seven (7) science instruments. This mission is baselined for up to 90 sols (Martian days) of digging, sampling, and analysis. Operating at the Mars polar region creates a challenging environment for the Phoenix landed subsystems and instruments with Mars surface temperature extremes between -120 deg C to 25 deg C and diurnal thermal cycling in excess of 145 deg C. Some engineering and science hardware inside the lander were qualification tested up to 80 deg C to account for self heating. Furthermore, many of the hardware for this mission were inherited from earlier missions: the lander from the Mars Surveyor Program 2001 (MSP'01) and instruments from the MSP'01 and the Mars Polar Lander. Ensuring all the hardware was properly qualified and flight acceptance tested to meet the environments for this mission required defining and implementing an environmental assurance program that included a detailed heritage review coupled with tailored flight acceptance testing. A heritage review process with defined acceptance success criteria was developed and is presented in this paper together with the lessons learned in its implementation. This paper also provides a detailed description of the environmental assurance program of the Phoenix Mars mission. This program includes assembly/subsystem and system level testing in the areas of dynamics, thermal, and electromagnetic compatibility, as well as venting/pressure, dust, radiation, and meteoroid analyses to meet the challenging environment of this mission.

  20. Quality Assurance of ARM Program Climate Research Facility Data

    Energy Technology Data Exchange (ETDEWEB)

    Peppler, RA; Kehoe, KE; Sonntag, KL; Bahrmann, CP; Richardson, SJ; Christensen, SW; McCord, RA; Doty, DJ; Wagener, Richard [BNL; Eagan, RC; Lijegren, JC; Orr, BW; Sisterson, DL; Halter, TD; Keck, NN; Long, CN; Macduff, MC; Mather, JH; Perez, RC; Voyles, JW; Ivey, MD; Moore, ST; Nitschke, DL; Perkins, BD; Turner, DD

    2008-03-01

    This report documents key aspects of the Atmospheric Radiation Measurement (ARM) Climate Research Facility (ACRF) data quality assurance program as it existed in 2008. The performance of ACRF instruments, sites, and data systems is measured in terms of the availability, usability, and accessibility of the data to a user. First, the data must be available to users; that is, the data must be collected by instrument systems, processed, and delivered to a central repository in a timely manner. Second, the data must be usable; that is, the data must be inspected and deemed of sufficient quality for scientific research purposes, and data users must be able to readily tell where there are known problems in the data. Finally, the data must be accessible; that is, data users must be able to easily find, obtain, and work with the data from the central repository. The processes described in this report include instrument deployment and calibration; instrument and facility maintenance; data collection and processing infrastructure; data stream inspection and assessment; the roles of value-added data processing and field campaigns in specifying data quality and haracterizing the basic measurement; data archival, display, and distribution; data stream reprocessing; and engineering and operations management processes and procedures. Future directions in ACRF data quality assurance also are presented.

  1. A comparative study of the properties of TiN films deposited by MAIP and FCAP

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    In this study two types of TiN films were prepared, one using the filtered cathodic arc plasma (FC AP) technique with an in-plane "S" filier, and the other using the multi-arc ion-plating (MAIP), and both deposited under the same parameters. Comparisons of the texture, hardness, roughness, tribological and electrochemical corrosion behaviors of the two types of TiN films were given. The TiN films obtained by the FCAP technology were found to be highly uniform, smooth and macroparticle-free. The TiN films deposited by FCAP had a (111) preferred orientation, while there was no texture in the films deposited by MAIP. Under low load the two kinds of TiN coatings had very different wear mechanisms; the films of FCAP had a lower wear rate and friction coefficient compared with the TiN films deposited by the MAIP technique. The dense and hole-free structure of TiN films of FCAP could effectively avoid the avalanche of TiN films from the substrate during corrosion tests.

  2. Data Quality Assurance Program Plan for NRC Division of Risk Analysis Programs at the INL

    Energy Technology Data Exchange (ETDEWEB)

    Sattison, Martin B. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Wierman, Thomas E. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Vedros, Kurt G. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Germain, Shawn W. St. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Eide, Steven A. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Sant, Robert L. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2009-07-01

    The Division of Risk Analysis (DRA), Office of Nuclear Regulatory Research (RES), must ensure that the quality of the data that feed into its programs follow Office of Management and Budget (OMB) and U.S. Nuclear Regulatory Commission (NRC) guidelines and possibly other standards and guidelines used in nuclear power plant risk analyses. This report documents the steps taken in DRA’s Data Quality Improvement project (Job Control Number N6145) to develop a Data Quality Assurance Program Plan. These steps were 1. Conduct a review of data quality requirements 2. Review current data programs, products, and data quality control activities 3. Review the Institute of Nuclear Power Operation (INPO) Equipment Performance and Information Exchange (EPIX) data quality programs and characterize the EPIX data quality and uncertainty 4. Compare these programs, products, and activities against the requirements 5. Develop a program plan that provides assurance that data quality is being maintained. It is expected that the Data Quality Assurance Program Plan will be routinely implemented in all aspects of future data collection and processing efforts and that specific portions will be executed annually to provide assurance that data quality is being maintained.

  3. Development of quality assurance program for production of sealed radiation source

    CERN Document Server

    Nam, J H; Cho, W K; Han, H S; Hong, S B; Kim, K H; Kim, S D; Lee, Y G; Lim, N J

    2001-01-01

    The quality assurance program for production of sealed radiation sources has been developed to increase the efficiency and safety of production work and to meet the demand of the customers. The quality assurance program are applied to the entire work scope of the production of sealed radiation sources. Every workers related to the production of sealed radiation sources will be required to follow this quality assurance program. It is expected that the sealed radiation source products produced according to this quality assurance program can meet the regulatory requirements, customer's demand and have good competitiveness in the domestic and world markets.

  4. Results of the quality assurance testing program for radiopharmaceuticals, 1994

    International Nuclear Information System (INIS)

    The Australian Radiation Laboratory conducts a Radiopharmaceutical Quality Assurance Test Program in which radiopharmaceuticals used in nuclear medicine in Australia are tested for compliance with specifications. Where the radiopharmaceutical is the subject of a monograph in the British Pharmacopoeia or the European Pharmacopoeia, then the specifications given in the Pharmacopoeia are adopted. In other cases the specifications quoted have been adopted by this Laboratory and have no legal status. It should be noted that unless stated otherwise, the specifications listed apply at all times up to product expiry. Radionuclidic purity has been determined at the calibration time, except for Thallous [201Tl] Chloride injection where the highest impurity level up to product expiry is quoted. Samples for testing were obtained through commercial channels. All technetium-99m cold kits were reconstituted according to the directions in the package insert using Sodium Pertechnetate[99mTc] Injection. Methods used for testing are described in the report ARL/TR093

  5. Quality assurance and performance improvement in intraoperative neurophysiologic monitoring programs.

    Science.gov (United States)

    Tamkus, Arvydas A; Rice, Kent S; McCaffrey, Michael T

    2013-03-01

    Quality assurance (QA) as it relates to intraoperative neurophysiological monitoring (IONM) can be defined as the systematic monitoring, evaluation, and modification of the IONM service to insure that desired standards of quality are being met. In practice, that definition is usually extended to include the concept that the quality of the IONM service will be improved wherever possible and, although there are some differences in the two terms, in this article the term QA will be understood to include quality improvement (QI) processes as well. The measurement and documentation of quality is becoming increasingly important to healthcare providers. This trend is being driven by pressures from accrediting agencies, payers, and patients. The essential elements of a QA program are described. A real-life example of QA techniques and management relevant to IONM providers is presented and discussed.

  6. Risk assessment in the DOE Assurance Program for Remedial Action

    International Nuclear Information System (INIS)

    This document provides information obtained during the performance of risk assessment tasks in support of the Assurance Program for Remedial Action (APRA) sponsored by the Office of Operational Safety of the Department of Energy. We have presented a method for the estimation of projected health effects at properties in the vicinity of uranium mill tailing piles due to transported tailings or emissions from the piles. Because radon and radon daughter exposure is identified as the principal factor contributing to health effects at such properties, the basis for estimating lung cancer risk as a result of such exposure is discussed in detail. Modeling of health risk due to a secondary pathway, ingestion of contaminated, home-grown food products, is also discussed since it is a potentially important additional source of exposure in certain geographic locations. Risk assessment methods used in various mill tailings reports are reviewed. The protocols for radiological surveys conducted in DOE-sponsored remedial action programs are critically reviewed with respect to their relevance to the needs of health risk estimation. The relevance of risk assessment to the APRA program is discussed briefly

  7. UMTRA technical assistance contractor Quality Assurance Program Plan

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) provides the primary requirements for the integration of quality functions into all Technical Assistance Contractor (TAC) Project organization activities. The QAPP is the written directive authorized by the TAC Program Manager to accomplish this task and to implement procedures that provide the controls and sound management practices needed to ensure TAC contractual obligations are met. The QA program is designed to use monitoring, audit, and surveillance functions as management tools to ensure that all Project organization functions are executed in a manner that will protect public health and safety, promote the success of the Project, and meet or exceed contract requirements. The key to ensuring compliance with this directive is a two-step professional approach: utilize the quality system in all areas of activity, and generate a personal commitment from all personnel to provide quality service. The quality staff will be experienced, trained professionals capable of providing maximum flexibility to Project goal attainment. Such flexibility will enable the staff to be more cost effective and to further improve communication and coordination. To provide control details, this QAPP will be supplemented by approved standard operating procedures that provide requirements for performing the various TAC quality-related activities. These procedures shall describe applicable design input and document control activities and documentation

  8. Risk assessment in the DOE Assurance Program for Remedial Action

    Energy Technology Data Exchange (ETDEWEB)

    Marks, S.; Cross, F.T.; Denham, D.H.; Kennedy, W.E.; Stenner, R.D.

    1985-08-01

    This document provides information obtained during the performance of risk assessment tasks in support of the Assurance Program for Remedial Action (APRA) sponsored by the Office of Operational Safety of the Department of Energy. We have presented a method for the estimation of projected health effects at properties in the vicinity of uranium mill tailing piles due to transported tailings or emissions from the piles. Because radon and radon daughter exposure is identified as the principal factor contributing to health effects at such properties, the basis for estimating lung cancer risk as a result of such exposure is discussed in detail. Modeling of health risk due to a secondary pathway, ingestion of contaminated, home-grown food products, is also discussed since it is a potentially important additional source of exposure in certain geographic locations. Risk assessment methods used in various mill tailings reports are reviewed. The protocols for radiological surveys conducted in DOE-sponsored remedial action programs are critically reviewed with respect to their relevance to the needs of health risk estimation. The relevance of risk assessment to the APRA program is discussed briefly.

  9. Waste Encapsulation and Storage Facility (WESF) Quality Assurance Program Plan (QAPP)

    Energy Technology Data Exchange (ETDEWEB)

    ROBINSON, P.A.

    2000-04-17

    This Quality Assurance Plan describes how the Waste Encapsulation and Storage Facility (WESF) implements the quality assurance (QA) requirements of the Quality Assurance Program Description (QAPD) (HNF-Mp-599) for Project Hanford activities and products. This QAPP also describes the organizational structure necessary to successfully implement the program. The QAPP provides a road map of applicable Project Hanford Management System Procedures, and facility specific procedures, that may be utilized by WESF to implement the requirements of the QAPD.

  10. Quality assurance FY 1995 site support program plan WBS 6.7.2.5

    International Nuclear Information System (INIS)

    This report is a summary of the quality assurance plan and program for the Westinghouse Hanford Company. The quality assurance plan verifies that the appropriate quality assurance programs and controls are applied to activities that affect quality related to work in: waste management; environmental activities (restoration, remediation, and monitoring); implementation of environmental, state, local, and federal regulations; tri-party agreement activities; facility operation and deactivation/transition to shutdown; new facility construction and operation

  11. Extending cluster lot quality assurance sampling designs for surveillance programs.

    Science.gov (United States)

    Hund, Lauren; Pagano, Marcello

    2014-07-20

    Lot quality assurance sampling (LQAS) has a long history of applications in industrial quality control. LQAS is frequently used for rapid surveillance in global health settings, with areas classified as poor or acceptable performance on the basis of the binary classification of an indicator. Historically, LQAS surveys have relied on simple random samples from the population; however, implementing two-stage cluster designs for surveillance sampling is often more cost-effective than simple random sampling. By applying survey sampling results to the binary classification procedure, we develop a simple and flexible nonparametric procedure to incorporate clustering effects into the LQAS sample design to appropriately inflate the sample size, accommodating finite numbers of clusters in the population when relevant. We use this framework to then discuss principled selection of survey design parameters in longitudinal surveillance programs. We apply this framework to design surveys to detect rises in malnutrition prevalence in nutrition surveillance programs in Kenya and South Sudan, accounting for clustering within villages. By combining historical information with data from previous surveys, we design surveys to detect spikes in the childhood malnutrition rate. PMID:24633656

  12. Toward development of a comprehensive external quality assurance program for polyfunctional intracellular cytokine staining assays

    OpenAIRE

    Staats, Janet S.; Enzor, Jennifer H.; Sanchez, Ana M.; Rountree, Wes; Chan, Cliburn; Jaimes, Maria; Chan, Ray Chun-Fai; Gaur, Amitabh; Thomas N Denny; Weinhold, Kent J.

    2014-01-01

    The External Quality Assurance Program Oversight Laboratory (EQAPOL) Flow Cytometry Program assesses the proficiency of NIH/NIAID/DAIDS-supported and potentially other interested research laboratories in performing Intracellular Cytokine Staining (ICS) assays. The goal of the EQAPOL Flow Cytometry External Quality Assurance Program (EQAP) is to provide proficiency testing and remediation for participating sites. The program is not punitive; rather, EQAPOL aims to help sites identify areas for...

  13. Results of the quality assurance testing program for radiopharmaceuticals, 1994

    Energy Technology Data Exchange (ETDEWEB)

    Baldas, J.; Bonnyman, J.; Ivanov, Z.; Lauder, R

    1995-08-01

    The Australian Radiation Laboratory conducts a Radiopharmaceutical Quality Assurance Test Program in which radiopharmaceuticals used in nuclear medicine in Australia are tested for compliance with specifications. Where the radiopharmaceutical is the subject of a monograph in the British Pharmacopoeia or the European Pharmacopoeia, then the specifications given in the Pharmacopoeia are adopted. In other cases the specifications quoted have been adopted by this Laboratory and have no legal status. It should be noted that unless stated otherwise, the specifications listed apply at all times up to product expiry. Radionuclidic purity has been determined at the calibration time, except for Thallous [{sup 201}Tl] Chloride injection where the highest impurity level up to product expiry is quoted. Samples for testing were obtained through commercial channels. All technetium-99m cold kits were reconstituted according to the directions in the package insert using Sodium Pertechnetate[{sup 99m}Tc] Injection. Methods used for testing are described in the report ARL/TR093 24 tabs.

  14. Relevant aspects of a quality assurance program applied to a nuclear power plant operation

    International Nuclear Information System (INIS)

    The purpose of this work was to enumerate the most relevant subjects to be taken into account for the elaboration of a Quality Assurance Program aimed to regulate a nuclear power plant operation. At first, it was necessary to point out the relevance that implies the presence of a group of personnel, experienced in quality assurance with enough knowledge on the technical and organizing aspects of the plant. Other aspect to be taken into account was the contemplation of the international requirements, through the International Atomic Energy Agency and of the national requirements that each country had set up by the corresponding regulating agencies. These organizations pointed out the minimum rules that must be followed for the adequate and efficient execution of a program. The Quality Assurance Manual and the program and work procedures constituted the Quality Assurance Program which must be checked as regards its fulfillment by auditors and quality assurance supervisions. (Author)

  15. A TLD therapy dosimetry quality assurance program for Australia

    International Nuclear Information System (INIS)

    characteristics of the TLD powder; Contamination of the light emitted by non-radiation induced signals; The absorption of light in the TLD powder; False readings due to dust or other particles which glow when heated, and; The exposure of TLD to ultraviolet light. A pilot study is being undertaken in selected Australian radiotherapy centres. IAEA standard capsules and jigs are being used. Each of these centres will be sent several capsules filled with LiF powder. Two or three will be exposed to 2 Gy in a water phantom, with either a TPR20/10 or D20/10 beam specification. An unexposed capsule will measure environmental effects on the TLD powder during transport and storage. The centres will be given a 2 week window in which to expose the capsules. They will be asked to nominate the date of exposure so that a normalisation capsule, exposed at ARPANSA on the same day, can be used to correct the results. The pilot study will help to correct problems encountered with the TLD method before the TLD Quality Assurance Program begins for all radiotherapy centres in Australia. There are approximately 33 radiotherapy centres in the country, and all will be expected to participate. Initially ARPANSA's TLD QA Program will involve one photon beam per centre. Future work at ARPANSA will include the development of procedures so that 1-3 photon beams and 1-2 electron beams will be offered. The assistance of the IAEA is gratefully acknowledged in providing a quality assurance program for some Australian hospitals through the World Health Organisation (WHO) and in recent years for directly organising two Australia-wide TLD QA programs. (author)

  16. Development of a quality assurance program for ionizing radiation secondary calibration laboratories

    Energy Technology Data Exchange (ETDEWEB)

    Heaton, H.T. II; Taylor, A.R. Jr. [Center for Devices and Radiological Health, Rockville, MD (United States)

    1993-12-31

    For calibration laboratories, routine calibrations of instruments meeting stated accuracy goals are important. One method of achieving the accuracy goals is to establish and follow a quality assurance program designed to monitor all aspects of the calibration program and to provide the appropriate feedback mechanism if adjustments are needed. In the United States there are a number of organizations with laboratory accreditation programs. All existing accreditation programs require that the laboratory implement a quality assurance program with essentially the same elements in all of these programs. Collectively, these elements have been designated as a Measurement Quality Assurance (MQA) program. This paper will briefly discuss the interrelationship of the elements of an MQA program. Using the Center for Devices and Radiological Health (CDRH) X-ray Calibration Laboratory (XCL) as an example, it will focus on setting up a quality control program for the equipment in a Secondary Calibration Laboratory.

  17. Implementation of quality assurance program for operational safety of P2TBDU installation

    International Nuclear Information System (INIS)

    According to Decree of Head of BAPETEN No : 07/Ka-BAPETEN/V-99 which determines the duties to perform the quality assurance function for each nuclear installation, the Head of P2TBDU has decided to perform and maintain the quality assurance program controlling each activity which may influence the safety. The P2TBDU Quality Assurance Program has been arranged and put into force since 1993, however the implementation of the program has not been effective as expected. The change of organization structure shall cause the changes of organisation's function and main duty, therefore it requires that the change/revision be made to accommodate the new policy on the quality assurance program. The Quality Assurance Program revision 1 has been arranged and put into force since Nov. 19, 1999 which incorporated the change of the organizational structure. The effectiveness of implementation of the program shall extremely be determined y commitment of the P2TBDU management as well as awareness of each personal of the organization on the necessity of Quality Assurance Program for operational safety of the installation. (author)

  18. Quality Assurance Program Plan for the Waste Isolation Pilot Plant Experimental-Waste Characterization Program

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) identifies the quality of data necessary to meet the specific objectives associated with the Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Experimental-Waste Characterization Program (the Program). This experimental-waste characterization program is only one part of the WIPP Test Phase, both in the short- and long-term, to quantify and evaluate the characteristics and behavior of transuranic (TRU) wastes in the repository environment. Other parts include the bin-scale and alcove tests, drum-scale tests, and laboratory experiments. In simplified terms, the purpose of the Program is to provide chemical, physical, and radiochemical data describing the characteristics of the wastes that will be emplaced in the WIPP, while the remaining WIPP Test Phase is directed at examining the behavior of these wastes in the repository environment. 50 refs., 35 figs., 33 tabs

  19. Standard guide for establishing a quality assurance program for uranium conversion facilities

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2004-01-01

    1.1 This guide provides guidance and recommended practices for establishing a comprehensive quality assurance program for uranium conversion facilities. 1.2 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate health and safety practices and determine the applicability of regulatory limitations prior to use. 1.3 The basic elements of a quality assurance program appear in the following order: FUNCTION SECTION Organization 5 Quality Assurance Program 6 Design Control 7 Instructions, Procedures & Drawings 8 Document Control 9 Procurement 10 Identification and Traceability 11 Processes 12 Inspection 13 Control of Measuring and Test Equipment 14 Handling, Storage and Shipping 15 Inspection, Test and Operating Status 16 Control of Nonconforming Items 17 Corrective Actions 18 Quality Assurance Records 19 Audits 20 TABLE 1 NQA-1 Basic Requirements Relat...

  20. Quality assurance program plan for the Radiological Survey Activities Program - Uranium Mill Tailings Remedial Action Project

    International Nuclear Information System (INIS)

    The Radiological Survey Activities (RASA) program at Oak Ridge National Laboratory (ORNL) is responsible for surveying designated sites in the vicinity of 24 inactive mill sites involved in the Department of Energy's (DOE) Uranium Mill Tailings Remedial Action Project (UMTRAP). The purpose of these surveys is to provide a recommendation to DOE whether to include or exclude the site from UMTRAP based on whether the onsite residual radioactive material (if any) originated from the former mill sites, and radiation levels onsite are in excess of appropriate Environmental Protection Agency (EPA) criteria. This report describes the quality assurance program plan for the RASA program in conducting all activities related to the UMTRA project. All quality assurance provisions given by the DOE, DOE/UMTRA, and ORNL organizations are integrated into this plan. Specifically, this report identifies the policies and procedures followed in accomplishing the RASA/UMTRAP QA program, identifies those organizational units involved in the implementation of these procedures, and outlines the respective responsibilities of those groups

  1. Multi-Function Waste Tank Facility Quality Assurance Program Plan, Project W-236A. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Hall, L.R.

    1995-05-30

    This document describes the Quality Assurance (QA) program for the Multi-Function Waste Tank Facility (MWTF) Project. The purpose of this QA program is to control project activities in such a manner as to achieve the mission of the MWTF Project in a safe and reliable manner. The QA program for the MWTF Project is founded on DOE Order 5700.6C, Quality Assurance, and implemented through the use of ASME NQA-1, Quality Assurance Program Requirements for Nuclear Facilities (ASME 1989 with addenda la-1989, lb-1991 and lc-1992). This document describes the program and planned actions which the Westinghouse Hanford Company (WHC) will implement to demonstrate and ensure that the project meets the requirements of DOE Order 5700.6C through the interpretive guidance of ASME NQA-1.

  2. Quality Assurance Program Plan for the Waste Isolation Pilot Plant Experimental-Waste Characterization Program

    International Nuclear Information System (INIS)

    This Quality Assurance Program Plan (QAPP) identifies the quality of data necessary to meet the specific objectives associated with the Department of Energy (DOE) Waste Isolation Pilot Plant (WIPP) Experimental-Waste Characterization Program (the Program). DOE plans to conduct experiments in the WIPP during a Test Phase of approximately 5 years. These experiments will be conducted to reduce the uncertainties associated with the prediction of several processes (e.g., gas generation) that may influence repository performance. The results of the experiments will be used to assess the ability of the WIPP to meet regulatory requirements for the long-term protection of human health and the environment from the disposal of TRU wastes. 37 refs., 25 figs., 18 tabs

  3. SWRL Communication Skills Programs: Quality Assurance Information for the 1973-74 Academic Year.

    Science.gov (United States)

    Hanson, Ralph A.; And Others

    This document reports on the quality assurance aspects of the tryout of three SWRL (Southwest Regional Laboratory) Communication Skills Programs: Reading, Composition, and Expressive Language. The sample population was both large and diverse, and a pattern of high proficiency was achieved both within program blocks or levels and across program…

  4. 42 CFR 423.153 - Drug utilization management, quality assurance, and medication therapy management programs (MTMPs).

    Science.gov (United States)

    2010-10-01

    ... medication therapy management programs (MTMPs). 423.153 Section 423.153 Public Health CENTERS FOR MEDICARE... management, quality assurance, and medication therapy management programs (MTMPs). (a) General rule. Each...) Must offer a minimum level of medication therapy management services for each beneficiary enrolled...

  5. Hanford Waste Vitrification Plant Quality Assurance Program description: Overview and applications

    International Nuclear Information System (INIS)

    This document (Parts 1 and 2) describes the requirements that must be implemented during the design and construction phases for the Hanford Waste Vitrification Plant Project Quality Assurance Program. This program is being implemented to ensure the acceptability of high-level radioactive canistered waste forms produced by the Hanford Waste Vitrification Plant for disposal in a licensed federal repository

  6. Results of the quality assurance testing program for radiopharmaceuticals 1995

    Energy Technology Data Exchange (ETDEWEB)

    Baldas, J.; Binnyman, J.; Ivanov, Z.; Lauder, R.

    1996-07-01

    The results of the quality assurance testing conducted by the Australian Radiation Laboratory is summarised. Overall 111 batches of 27 different types of radiopharmaceuticals were tested on samples obtained through normal commercial channels. Failure to meet full specifications was observed in 10 of the 111 batches. All technetium-99m cold kits were reconstituted according to the directions in the package insert using sodium pertechnetate ( {sup 99m}Tc) injection. Radionuclidic purity has been determined at the calibration time, except for Thallous [{sup 201}Tl] Chloride injection where the highest impurity level up to product expiry is quoted. Non-compliance of the vial label was observed in one of the ten batches failing specification and was the sole cause of product failure for this batch. Vial label non-compliance consisted of, absence of volume in the vial. Six batches failed the biodistribution test but in no case did this involve failure of the distribution for the target organs. tabs.

  7. Results of the quality assurance testing program for radiopharmaceuticals 1995

    International Nuclear Information System (INIS)

    The results of the quality assurance testing conducted by the Australian Radiation Laboratory is summarised. Overall 111 batches of 27 different types of radiopharmaceuticals were tested on samples obtained through normal commercial channels. Failure to meet full specifications was observed in 10 of the 111 batches. All technetium-99m cold kits were reconstituted according to the directions in the package insert using sodium pertechnetate ( 99mTc) injection. Radionuclidic purity has been determined at the calibration time, except for Thallous [201Tl] Chloride injection where the highest impurity level up to product expiry is quoted. Non-compliance of the vial label was observed in one of the ten batches failing specification and was the sole cause of product failure for this batch. Vial label non-compliance consisted of, absence of volume in the vial. Six batches failed the biodistribution test but in no case did this involve failure of the distribution for the target organs. tabs

  8. Project Hanford management contract quality assurance program implementation plan for nuclear facilities

    Energy Technology Data Exchange (ETDEWEB)

    Bibb, E.K.

    1997-10-15

    During transition from the Westinghouse Hanford Company (WHC) Management and Operations (M and O) contract to the Fluor Daniel Hanford (FDH) Management and Integration (M and I) contract, existing WHC policies, procedures, and manuals were reviewed to determine which to adopt on an interim basis. Both WHC-SP-1131,Hanford Quality Assurance Program and Implementation Plan, and WHC-CM-4-2, Quality Assurance Manual, were adopted; however, it was recognized that revisions were required to address the functions and responsibilities of the Project Hanford Management Contract (PHMC). This Quality Assurance Program Implementation Plan for Nuclear Facilities (HNF-SP-1228) supersedes the implementation portion of WHC-SP-1 13 1, Rev. 1. The revised Quality Assurance (QA) Program is documented in the Project Hanford Quality Assurance Program Description (QAPD), HNF-MP-599. That document replaces the QA Program in WHC-SP-1131, Rev. 1. The scope of this document is limited to documenting the nuclear facilities managed by FDH and its Major Subcontractors (MSCS) and the status of the implementation of 10 CFR 830.120, Quality Assurance Requirements, at those facilities. Since the QA Program for the nuclear facilities is now documented in the QAPD, future updates of the information provided in this plan will be by letter. The layout of this plan is similar to that of WHC-SP-1 13 1, Rev. 1. Sections 2.0 and 3.0 provide an overview of the Project Hanford QA Program. A list of Project Hanford nuclear facilities is provided in Section 4.0. Section 5.0 provides the status of facility compliance to 10 CFR 830.120. Sections 6.0, 7.0, and 8.0 provide requested exemptions, status of open items, and references, respectively. The four appendices correspond to the four projects that comprise Project Hanford.

  9. Quality Assurance Program Plan for the Waste Sampling and Characterization Facility

    Energy Technology Data Exchange (ETDEWEB)

    Grabbe, R.R.

    1995-03-02

    The objective of this Quality Assurance Plan is to provide quality assurance (QA) guidance, implementation of regulatory QA requirements, and quality control (QC) specifications for analytical service. This document follows the Department of Energy (DOE)-issued Hanford Analytical Services Quality Assurance Plan (HASQAP) and additional federal [10 US Code of Federal Regulations (CFR) 830.120] QA requirements that HASQAP does not cover. This document describes how the laboratory implements QA requirements to meet the federal or state requirements, provides what are the default QC specifications, and/or identifies the procedural information that governs how the laboratory operates. In addition, this document meets the objectives of the Quality Assurance Program provided in the WHC-CM-4-2, Section 2.1. This document also covers QA elements that are required in the Guidelines and Specifications for Preparing Quality Assurance Program Plans (QAPPs), (QAMS-004), and Interim Guidelines and Specifications for Preparing Quality Assurance Product Plans (QAMS-005) from the Environmental Protection Agency (EPA). A QA Index is provided in the Appendix A.

  10. Summary report on the Solar Consumer Assurance Network (SOLCAN) Program Planning Task in the southern region

    Energy Technology Data Exchange (ETDEWEB)

    Browne, M. B. [comp.

    1981-03-15

    The goal of the SOLCAN Program Planning Task is to assist in the development, at the state and local levels, of consumer assurance approaches that will support the accelerated adoption and effective use of new products promoted by government incentives to consumers to meet our nation's energy needs. The task includes state-conducted evaluations and state SOLCAN meetings to identify consumer assurance mechanisms, assess their effectiveness, and identify and describe alternative means for strengthening consumer and industry assurance in each state. Results of the SOLCAN process are presented, including: a Solar Consumer Protection State Assessment Guide; State Solar Consumer Assurance Resources for Selected States; State Solar Consumer Protection Assessment Interviews for Florida; and state SOLCAN meeting summaries and participants. (LEW)

  11. Chemical Reactivity Testing for the National Spent Nuclear Fuel Program. Quality Assurance Project Plan

    International Nuclear Information System (INIS)

    This quality assurance project plan (QAPjP) summarizes requirements used by Lockheed Martin Energy Systems, Incorporated (LMES) Development Division at Y-12 for conducting chemical reactivity testing of Department of Energy (DOE) owned spent nuclear fuel, sponsored by the National Spent Nuclear Fuel Program (NSNFP). The requirements are based on the NSNFP Statement of Work PRO-007 (Statement of Work for Laboratory Determination of Uranium Hydride Oxidation Reaction Kinetics.) This QAPjP will utilize the quality assurance program at Y-12, QA-101PD, revision 1, and existing implementing procedures for the most part in meeting the NSNFP Statement of Work PRO-007 requirements, exceptions will be noted

  12. A new postal quality assurance program for diagnostic radiology departments

    International Nuclear Information System (INIS)

    The Federal Government of Canada has responsibility for the design and performance of new x-ray equipment, but the Provinces have responsibility for controlling the installation, maintenance and use of the equipment. For the past 30 years Saskatchewan has had regular inspection of X-ray units by radiation health officers who have ensured that deficiencies are corrected. With the present emphasis on quality assurance procedures and hospital accreditation requirements some additional needs have had to be met. These are primarily due to unusual geographical factors. The province covers a quarter to a million square miles and has a continental climate with very severe winters. This used to impede winter travel and many small communities therefore established their own hospital. Today there are a large number of very small hospitals (four beds and upwards) which are geographically widely spread and which, with current resources, can only be visited rather infrequently. A mail out test package, primarily designed to give early warning of the existence of radiation related problems, has therefore been introduced. If a test gives an unexpected result, a prompt visit can be made to the centre concerned to carry out whatever more sophisticated test procedures may be necessary. Experience has shown however that the postal test package has, in itself, a high diagnostic potential so the source of the problem can often be identified without a visit becoming necessary

  13. John F. Kennedy Space Center, Safety, Reliability, Maintainability and Quality Assurance, Survey and Audit Program

    Science.gov (United States)

    1994-01-01

    This document is the product of the KSC Survey and Audit Working Group composed of civil service and contractor Safety, Reliability, and Quality Assurance (SR&QA) personnel. The program described herein provides standardized terminology, uniformity of survey and audit operations, and emphasizes process assessments rather than a program based solely on compliance. The program establishes minimum training requirements, adopts an auditor certification methodology, and includes survey and audit metrics for the audited organizations as well as the auditing organization.

  14. Planning and programing a quality assurance system in the National Institute of Nuclear Research

    International Nuclear Information System (INIS)

    The quality assurance systems implanted in the National Institute of Nuclear Research toward the latest of 70's, was derived in two main emptying the first one is dedicated to verify the system implantation in several studies, projects, services and areas of the Institute through the application of inspection, vigilance and auditories. The second one is referred the present paper which is the representative to watch the document completion of the diverse distinguished requisites in the codes, by-laws, standards, specifications and other applicable standing documents as national as internationals. In the NINR is started the Quality Assurance Systems implantation, through of its 'Quality Assurance Plan' which to determine the Quality Institutional policies and the general nature requisites which must be executed in every study, project or area subjected to the Institutional Quality Assurance Systems. From this plan are derived the 'Quality Assurance Programs', in which are indicated the specific requisites in according to the activity type to development. Later is started the documentation preparation which is previous to activities developing which is verified by Quality Assurance with the object to check between other aspects, its foundation and convenience with respect to the applicable standing standards; just as the competence, brightness, legibility, homogeneity and formality of each document. (Author)

  15. 75 FR 9142 - Information Assurance Scholarship Program (IASP)

    Science.gov (United States)

    2010-03-01

    ... management or administration, computer crime investigations, computer engineering, computer programming... part, the term ``IA'' includes computer security, network security and other relevant IT related to...'' includes computers, ancillary equipment, software, firmware, and similar procedures, services...

  16. Quality Assurance Plan for Transportation Management Division Transportation Training Programs

    International Nuclear Information System (INIS)

    The U.S. Department of Transportation (DOT) implemented new rules requiring minimum levels of training for certain key individuals who handle, package, transport, or otherwise prepare hazardous materials for transportation. In response to these rules, the U.S. Department of Energy (DOE), Transportation Management Division (TMD), has developed a transportation safety training program. This program supplies designed instructional methodology and course materials to provide basic levels of DOT training to personnel for whom training has become mandatory. In addition, this program provides advanced hazardous waste and radioactive material packaging and transportation training to help personnel achieve proficiency and/or certification as hazardous waste and radioactive material shippers. This training program does not include site-specific or task-specific training beyond DOT requirements

  17. Requirements for an ES and H assurance program at the working levels of organization

    International Nuclear Information System (INIS)

    Means by which the disciplines of quality assurance (QA), reliability (R), and human factors (HF) might be used to the advantage of Environment, Safety, and Health (ES and H) programs are being investigated. A generalized model assurance program, based on QA, R, and HF principles but specifically tailored to ES and H program needs, has been developed. Current studies address implementation of the model assurance program at the working levels of organization. It appears that the only way practicability at the working level can be determined is by the case study method. The present study represents a first step in the application of such a procedure. An attempt was made to approach the question of practicability by first constructing a generic ES and H assurance plan for working-level organizations that is based upon the more widely-applied model plan and studies mentioned earlier. Then the elements of this generic working-level plan were compared with the practices of an existing R and D organization at Sandia Laboratories, Albuquerque. Some of the necessary steps were taken to convert these practices to those required by the generic plan in order to gain a measure of the feasibility, cost, and some of the possible benefits of such a conversion. Partial results of one case study are presented, and some generalizations that emerge regarding the structure of an idealized working-level ES and H plan are made

  18. THE IMPORTANCE OF A SUCCESSFUL QUALITY ASSURANCE (QA) PROGRAM FROM A RESEARCH MANAGER'S PERSPECTIVE

    Science.gov (United States)

    The paper discusses the Air Pollution Prevention and Control Division's Quality Assurance (QA) program and the approaches used to meet QA requirements in the Division. The presentation is a technical manager's perspective of the Division's requirements for and approach to QA in i...

  19. Mammography in public hospitals at Rio de Janeiro: a quality assurance program

    Energy Technology Data Exchange (ETDEWEB)

    Briquet, C.; Coutinho, C.M.C.; Mota, H.C.; Tavares, E. [Instituto de Radioprotecao e Dosimetria/ Commisao Nacional de Energia Nuclear. Av. Salvador Allende, s/n CEP: 22780-160. Rio de Janeiro (Brazil)

    1998-12-31

    This paper presents the preliminary results and the methodology followed by the implementation of a Quality Assurance Program in public hospitals at Rio de Janeiro. We observed that the main problems of image are due to the processing. None facility has a dedicated processor and the processor daily quality control is a concern not yet adopted. (Author)

  20. Quality Matters: A Faculty-Centred Program to Assure Quality in Online Course Design

    Science.gov (United States)

    Shattuck, Kay

    2010-01-01

    One of the dilemmas faced by today's faculty is assuring quality in online courses. As one solution to that dilemma, Quality Matters (QM), a program of MarylandOnline, built a rubric of design standards informed by existing research literature and best practices. The rubric was implemented within a faculty-centred, peer review process in which…

  1. Quality Assurance of Non-Local Accounting Programs Conducted in Hong Kong

    Science.gov (United States)

    Cheng, Mei-Ai; Leung, Noel W.

    2014-01-01

    This study examines the current government policy and institutional practice on quality assurance of non-local accounting programs conducted in Hong Kong. Both international guidelines, national regulations and institutional frameworks in higher education and transnational higher education, and professional practice in accounting education are…

  2. B and W NPGD quality assurance program for nuclear equipment. Revision 1

    International Nuclear Information System (INIS)

    B and W's Quality Assurance Program (QAP) is described. The program is implemented through the Nuclear Power Generation Division (NPGD) and includes design, procurement, and manufacturing activities of NPGD and all its suppliers furnishing items in the B and W scope of supply including other Divisions/ Subsidiaries of B and W. These activities are controlled by including applicable quality assurance requirements, as described, in NPGD procurement documents imposed on its suppliers. Each supplier must then establish and/or maintain a documented QA Program to meet the requirements imposed by the procurement documents. Implementation of the suppliers' NPGD-approved QA Program is verified by NPGD through Audit and QC Surveillance activities. The position and relationships of the NPGD within the Company's corporate structure are described. An overview of the QAP describing its implementation, its operation, the controls imposed on all suppliers (both corporate and vendor) and site consulting activities is presented. (U.S.)

  3. Technical Excellence and Communication: The Cornerstones for Successful Safety and Mission Assurance Programs

    Science.gov (United States)

    Malone, Roy W.; Livingston, John M.

    2010-01-01

    The paper describes the role of technical excellence and communication in the development and maintenance of safety and mission assurance programs. The Marshall Space Flight Center (MSFC) Safety and Mission Assurance (S&MA) organization is used to illustrate philosophies and techniques that strengthen safety and mission assurance efforts and that contribute to healthy and effective organizational cultures. The events and conditions leading to the development of the MSFC S&MA organization are reviewed. Historic issues and concerns are identified. The adverse effects of resource limitations and risk assessment roles are discussed. The structure and functions of the core safety, reliability, and quality assurance functions are presented. The current organization s mission and vision commitments serve as the starting points for the description of the current organization. The goals and objectives are presented that address the criticisms of the predecessor organizations. Additional improvements are presented that address the development of technical excellence and the steps taken to improve communication within the Center, with program customers, and with other Agency S&MA organizations.

  4. USCEA/NIST measurement assurance programs for the radiopharmaceutical and nuclear power industries

    Energy Technology Data Exchange (ETDEWEB)

    Golas, D.B. [Council for Energy Awareness, Washington, DC (United States)

    1993-12-31

    In cooperation with the U.S. Council for Energy Awareness (USCEA), the National Institute of Standards and Technology (NIST) supervises and administers two measurement assurance programs for radioactivity measurement traceability. One, in existence since the mid 1970s, provides traceability to suppliers of radiochemicals and radiopharmaceuticals, dose calibrators, and nuclear pharmacy services. The second program, begun in 1987, provides traceability to the nuclear power industry for utilities, source suppliers, and service laboratories. Each program is described, and the results of measurements of samples of known, but undisclosed activity, prepared at NIST and measured by the participants are presented.

  5. QUALITY ASSURANCE IN SECONDARY EDUCATION PROGRAME OF BANGLADESH OPEN UNIVERSITY: Present Status and Challenges

    Directory of Open Access Journals (Sweden)

    Zobaida AKHTER

    2008-04-01

    Full Text Available In the present day in national and international perspectives, quality is the top of most agendas. Quality of education has significant impact and invaluable contribution to the area of development. Recently, the SSC & HSC program of BOU have earned recognition of equivalency with the formal education sector, which has naturally raised the question of quality assurance of these programs By applying the quantitative method, the study has assessed the present status of the quality of SSC & HSC program of BOU and also put some recommendations to meet the challenges for further development.

  6. Quality assurance program in the External dosimetry laboratory of the CPHR

    International Nuclear Information System (INIS)

    From 1999 the Laboratory of External Dosimetry of the Radiation Protection and Hygiene Center comes applying in its service of personal dosimetry a Program of Quality Assurance. This program was designed according to the recommendations of national and international organizations as the National Assuring Office of the Republic of Cuba (ONARC), the International Standards Organization (ISO), the International Electro technique Commission (IEC) and the International Atomic Energy Agency (IAEA). In this work it is presented in a summarized way the operation of this Program of Quality Assurance which includes the administration and conservation of the results and the documentation of the service, the controls that are carried out to the equipment, the acceptance tests that are applied to the equipment and new dosemeters, the shipment and prosecution of the dosemeters, the evaluation, storage and conservation of the doses, the report of the results, the traceability and reproducibility of the measurements, the attention to the reclamations and the clients complaints and the internal and external audits to those that it undergoes periodically the laboratory. (Author)

  7. Quality Assurance of Computer Programs for Photopeak Integration in Activation Analysis

    DEFF Research Database (Denmark)

    Heydorn, Kaj

    1978-01-01

    The purpose of a computer program for quantitative activation analysis is basically to produce information on the ratio of radioactive decays of a specific radio-nuclide observed by a detector from two alternative sources. It is assumed that at least one of the sources is known to contain...... the radionuclide in question, and qualitative analysis is therefore needed only to the extent that the decay characteristics of this radionuclide could be confused with those of other possible radionuclides, thus interfering with its determination. The quality of these computer programs can only be assured...

  8. The Evolution of the NASA Commercial Crew Program Mission Assurance Process

    Science.gov (United States)

    Canfield, Amy C.

    2016-01-01

    In 2010, the National Aeronautics and Space Administration (NASA) established the Commercial Crew Program (CCP) in order to provide human access to the International Space Station and low Earth orbit via the commercial (non-governmental) sector. A particular challenge to NASA has been how to determine that the Commercial Provider's transportation system complies with programmatic safety requirements. The process used in this determination is the Safety Technical Review Board which reviews and approves provider submitted hazard reports. One significant product of the review is a set of hazard control verifications. In past NASA programs, 100% of these safety critical verifications were typically confirmed by NASA. The traditional Safety and Mission Assurance (S&MA) model does not support the nature of the CCP. To that end, NASA S&MA is implementing a Risk Based Assurance process to determine which hazard control verifications require NASA authentication. Additionally, a Shared Assurance Model is also being developed to efficiently use the available resources to execute the verifications.

  9. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) Quality Assurance Manual

    Energy Technology Data Exchange (ETDEWEB)

    C. L. Smith; R. Nims; K. J. Kvarfordt; C. Wharton

    2008-08-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) is a software application developed for performing a complete probabilistic risk assessment using a personal computer running the Microsoft Windows operating system. SAPHIRE is primarily funded by the U.S. Nuclear Regulatory Commission (NRC). The role of the INL in this project is that of software developer and tester. This development takes place using formal software development procedures and is subject to quality assurance (QA) processes. The purpose of this document is to describe how the SAPHIRE software QA is performed for Version 6 and 7, what constitutes its parts, and limitations of those processes.

  10. A program on quality assurance and dose calibration for radiation therapy units in Venezuela

    International Nuclear Information System (INIS)

    The results of a five year program (1988-90-91-92-93) on quality assurance and dose calibration for 12 Cobalt-60 units from public hospitals, which represents 30% of total radiation therapy units in Venezuela, are presented. The remarkable improvement in the general performance of these units can be seen in the IAEA/WHO Postal TLD Intercomparison results which gave 100% within ± 5% in 1990 and 1992, while 63% in 1990 and 44% in 1992, with errors up to 37% were obtained for the participants not included in the program. The difference between the two groups lead the government to decrete through the Gaceta Oficial de la Republica de Venezuela, Resolution G-1397 on March 3, 1993, the quality assurance and dose calibration programs shall be established for all radiation therapy installations in Venezuela. The project for the standards was developed by the SSDL physicists and it was already approbated by the Health Ministry. It is expected that the Norms will enter into effect by the end of 1994. (author). 14 refs, 1 fig., 3 tabs

  11. Development and status of data quality assurance program at NASA Langley research center: Toward national standards

    Science.gov (United States)

    Hemsch, Michael J.

    1996-01-01

    As part of a continuing effort to re-engineer the wind tunnel testing process, a comprehensive data quality assurance program is being established at NASA Langley Research Center (LaRC). The ultimate goal of the program is routing provision of tunnel-to-tunnel reproducibility with total uncertainty levels acceptable for test and evaluation of civilian transports. The operational elements for reaching such levels of reproducibility are: (1) statistical control, which provides long term measurement uncertainty predictability and a base for continuous improvement, (2) measurement uncertainty prediction, which provides test designs that can meet data quality expectations with the system's predictable variation, and (3) national standards, which provide a means for resolving tunnel-to-tunnel differences. The paper presents the LaRC design for the program and discusses the process of implementation.

  12. Assurance Program for Remedial Action (APRA) microcomputer-operated bibliography management system

    Energy Technology Data Exchange (ETDEWEB)

    Stenner, R.D.; Washburn, D.K.; Denham, D.H.

    1985-06-01

    Pacific Northwest Laboratory (PNL) provided technical assistance to the Office of Operational Safety (OOS) in developing their Assurance Program for Remedial Action (APRA). The APRA Bibliography Management System (BMS), a microcomputer-operated system designed to file, locate and retrieve project-specific bibliographic data, was developed to manage the documentation associated with APRA. The BMS uses APRABASE, a PNL-developed computer program written in dBASE II language, which is designed to operate using the commercially available dBASE II database software. This document describes the APRABASE computer program, its associated subprograms, and the dBASE II APRA file. A User's Manual is also provided in the document. Although the BMS was designed to manage APRA-associated documents, it could be easily adapted for use in handling bibliographic data associated with any project.

  13. Plutonium immobilization project development and testing technical project office quality assurance program description

    International Nuclear Information System (INIS)

    The Plutonium Immobilization Project (PIP) is one of several fissile materials disposition projects managed by the Department of Energy (DOE) Office of Fissile Materials Disposition (OFMD). The PIP is expected to evolve from the current Development and Testing (D and T) effort, to design, to construction, and finally to operations. Overall management and technical management of the D and T effort resides at the Lead Laboratory, Lawrence Livermore National Laboratory (LLNL), through the LLNL Manager, Fissile Materials Disposition Program (FMDP). Day to day project activities are managed by the D and T Technical Project Office (TPO), which reports to the LLNL Manager, FMDP. The D and T TPO consists of the Technical Manager, the TPO Quality Assurance (QA) Program Manager, and TPO Planning and Support Staff. This Quality Assurance Program Description (QAPD) defines the QA policies and controls that will be implemented by these TPO personnel in their management of D and T activities. This QAPD is consistent with and responsive to the Department of Energy Fissile Materials Disposition Program Quality Assurance Requirements Document (FMDP QARD). As the Project and upper level requirement's documents evolve, this QAPD will be updated as necessary to accurately define and describe the QA Program and Management of the PIP. The TPO has a policy that all development and testing activities be planned, performed and assessed in accordance with its customer's requirements, needs and expectations, and with a commitment to excellence and continuous improvement. The TPO QAPD describes implementation requirements which, when completed, will ensure that the project development and testing activities conform to the appropriate QA requirements. For the program to be effective, the TPO QA Program Manager will ensure that each site participating in D and T activities has developed a QAPD, which meets the customer's requirements, and has a designated quality leader in place. These customer

  14. Energy Assurance Technical Training and Awareness Program/Energy Infrastructure Training and Analysis Center

    Energy Technology Data Exchange (ETDEWEB)

    Barbara McCabe

    2005-11-15

    This report covers the work completed during Year One (Year One has a 16 month project period) of a five- year Cooperative Agreement (DE-FC26-03NT41895) between the International Union of Operating Engineers (IUOE) National Hazmat Program (OENHP) and the U. S. Department of Energy (DOE) National Energy Technology Laboratory (NETL). This final technical report is being submitted, as required by the Cooperative Agreement, within 90 (calendar) days after the project period ends (December 31, 2004). The resources allocated to Year One of the Cooperative Agreement were adequate for the completion of the required deliverables. All deliverables have been completed and sent to AAD Document Control as directed in the cooperative agreement. The allocation for Year One required 20-25 trainers to be trained in each of five Train-the-Trainer courses and a total of 6,000 workers trained throughout the country. Through cost savings employed for the scheduling and conduct of Train-the-Trainer, instructor refreshers, and direct training classes, 3171 workers have been trained to date. This total incorporates 159 trainers and members from management, local, county, state and federal organizations identified in the Strategic Plan. The largest percentage of personnel trained is heavy equipment operators, and building engineers, which is the largest targeted population identified under this cooperative agreement. The OENHP, using existing curriculum as appropriate, has modified and developed new training modules that have been used to establish four different levels of training courses. The four courses are: (1) EA 500 Energy Assurance Train-the-Trainer, (2) EA 400 Energy Assurance Instructor Refresher, (3) EA 300 Energy Assurance, and (4) EA 100 Energy Assurance Awareness. Training modules cover topics, such as, but not limited to, facility vulnerability and vulnerability assessment, physical security- heating, ventilation, air conditioning, terrorism awareness, weapons of mass

  15. Analysis of retakes: understanding, managing, and using an analysis of retakes program for Quality Assurance

    International Nuclear Information System (INIS)

    The benefits to be obtained from an analysis of retakes program include: identificaton of problems which are know to be affecting image quality and patient dose by creating additional retakes; documentation of monetary savings from QA programs by achieving fewer retakes; and potential improvement in departmental performance by using retake data feedback to increase motivation. In addition to outlining the meaning of retakes and suggested procedures for beginning and maintaining an on-going retake analysis program, the cost of retakes is discussed in both dollar and radiation exposure contexts, balanced against this cost savings is the expense of implementing a quality assurance program in a diagnostic radiology facility. This expense varies widely depending on the level and management of the QA program. The additional cost of performing the analysis of retakes study is minimal. For a facility with five rooms of radiographic equipment, the retake tabulation and analysis should require one to two hours per week to perform. The program would require $312 to $625 per year and even less with experience and streamlining. The benefits would appear to definitely outweigh the costs

  16. Nutrition Program Quality Assurance through a Formalized Process of On-Site Program Review

    Science.gov (United States)

    Paddock, Joan Doyle; Dollahite, Jamie

    2012-01-01

    A protocol for a systematic onsite review of the Expanded Food and Nutrition Education Program and Supplemental Nutrition Assistance Program-Education was developed to support quality programming and ensure compliance with state guidelines and federal regulations. Onsite review of local nutrition program operations is one strategy to meet this…

  17. Hanford Waste Vitrification Plant Quality Assurance Program description for high-level waste form development and qualification

    International Nuclear Information System (INIS)

    The Hanford Waste Vitrification Plant Project has been established to convert the high-level radioactive waste associated with nuclear defense production at the Hanford Site into a waste form suitable for disposal in a deep geologic repository. The Hanford Waste Vitrification Plant will mix processed radioactive waste with borosilicate material, then heat the mixture to its melting point (vitrification) to forin a glass-like substance that traps the radionuclides in the glass matrix upon cooling. The Hanford Waste Vitrification Plant Quality Assurance Program has been established to support the mission of the Hanford Waste Vitrification Plant. This Quality Assurance Program Description has been written to document the Hanford Waste Vitrification Plant Quality Assurance Program

  18. External Quality Assurance Programs Managed by the U.S. Geological Survey in Support of the National Atmospheric Deposition Program/Mercury Deposition Network

    Science.gov (United States)

    Latysh, Natalie E.; Wetherbee, Gregory A.

    2007-01-01

    The U.S. Geological Survey (USGS) Branch of Quality Systems operates external quality assurance programs for the National Atmospheric Deposition Program/Mercury Deposition Network (NADP/MDN). Beginning in 2004, three programs have been implemented: the system blank program, the interlaboratory comparison program, and the blind audit program. Each program was designed to measure error contributed by specific components in the data-collection process. The system blank program assesses contamination that may result from sampling equipment, field exposure, and routine handling and processing of the wet-deposition samples. The interlaboratory comparison program evaluates bias and precision of analytical results produced by the Mercury Analytical Laboratory (HAL) for the NADP/MDN, operated by Frontier GeoSciences, Inc. The HAL's performance is compared with the performance of five other laboratories. The blind audit program assesses bias and variability of MDN data produced by the HAL using solutions disguised as environmental samples to ascertain true laboratory performance. This report documents the implementation of quality assurance procedures for the NADP/MDN and the operating procedures for each of the external quality assurance programs conducted by the USGS. The USGS quality assurance information provides a measure of confidence to NADP/MDN data users that measurement variability is distinguished from environmental signals.

  19. A quality assurance program for radiotherapy centers in the Republic of Korea

    International Nuclear Information System (INIS)

    Recognizing the importance of quality assurance in radiotherapy and the need to make access to radiation standards traceable to the international measurement system to every radiotherapy center, the KFDA, as a national secondary standard dosimetry laboratory (SSDL), has started a quality assurance program from 1999. This program was initiated by tele-survey to all radiotherapy centers regarding general information about their radiotherapists, medical physicists, type of equipment, dosimeters, etc. This provided the KFDA with a data file and led to links between the KFDA and the clinics. In 1999 a national quality assurance program for ensuring dosimetry accuracy has been performed by on-site dosimetry for 4 60Co γ ray, 47 high-energy photon beams used in 43 centers. During the audits, the procedure followed by the KFDA was to measure the outputs of the LINAC(6 MV) and Co-60 teletherapy units in terms of absorbed dose to water for fixed dose (2 Gy) in water phantom (only one phantom used in this on-site visit). For all the case, the measurements are carried out in a water phantom according to the IAEA recommended code of practice. The distributions of deviations in total audit are given. The results showed deviations varying between -7.11% and 8.38%. KFDA follow up the large deviated radiotherapy centers. The traceability to SSDL is a major factor of deviation between KFDA measurement dose and clinics quoted dose. The correction for air density (temperature and pressure) is a factor that sometimes introduces errors. Most of the clinics do not calibrate their own barometers and sometimes rely on the air pressure that is quoted during measurements by local metrological offices. In one case, the barometer and thermometer of the clinic were deviating from KFDA instruments by about 10 mmHg and 2, respectively even if the temperature was measured in air. In one case, about 4% of output variation with gantry head angle (horizontal vs. vertical). In the past two years the

  20. Using RUFDATA to guide a logic model for a quality assurance process in an undergraduate university program.

    Science.gov (United States)

    Sherman, Paul David

    2016-04-01

    This article presents a framework to identify key mechanisms for developing a logic model blueprint that can be used for an impending comprehensive evaluation of an undergraduate degree program in a Canadian university. The evaluation is a requirement of a comprehensive quality assurance process mandated by the university. A modified RUFDATA (Saunders, 2000) evaluation model is applied as an initiating framework to assist in decision making to provide a guide for conceptualizing a logic model for the quality assurance process. This article will show how an educational evaluation is strengthened by employing a RUFDATA reflective process in exploring key elements of the evaluation process, and then translating this information into a logic model format that could serve to offer a more focussed pathway for the quality assurance activities. Using preliminary program evaluation data from two key stakeholders of the undergraduate program as well as an audit of the curriculum's course syllabi, a case is made for, (1) the importance of inclusivity of key stakeholders participation in the design of the evaluation process to enrich the authenticity and accuracy of program participants' feedback, and (2) the diversification of data collection methods to ensure that stakeholders' narrative feedback is given ample exposure. It is suggested that the modified RUFDATA/logic model framework be applied to all academic programs at the university undergoing the quality assurance process at the same time so that economies of scale may be realized. PMID:26788815

  1. Using RUFDATA to guide a logic model for a quality assurance process in an undergraduate university program.

    Science.gov (United States)

    Sherman, Paul David

    2016-04-01

    This article presents a framework to identify key mechanisms for developing a logic model blueprint that can be used for an impending comprehensive evaluation of an undergraduate degree program in a Canadian university. The evaluation is a requirement of a comprehensive quality assurance process mandated by the university. A modified RUFDATA (Saunders, 2000) evaluation model is applied as an initiating framework to assist in decision making to provide a guide for conceptualizing a logic model for the quality assurance process. This article will show how an educational evaluation is strengthened by employing a RUFDATA reflective process in exploring key elements of the evaluation process, and then translating this information into a logic model format that could serve to offer a more focussed pathway for the quality assurance activities. Using preliminary program evaluation data from two key stakeholders of the undergraduate program as well as an audit of the curriculum's course syllabi, a case is made for, (1) the importance of inclusivity of key stakeholders participation in the design of the evaluation process to enrich the authenticity and accuracy of program participants' feedback, and (2) the diversification of data collection methods to ensure that stakeholders' narrative feedback is given ample exposure. It is suggested that the modified RUFDATA/logic model framework be applied to all academic programs at the university undergoing the quality assurance process at the same time so that economies of scale may be realized.

  2. Quality assurance

    Energy Technology Data Exchange (ETDEWEB)

    Gillespie, B.M.; Gleckler, B.P.

    1995-06-01

    This section of the 1994 Hanford Site Environmental Report summarizes the quality assurance and quality control practices of Hanford Site environmental monitoring and surveillance programs. Samples are analyzed according to documented standard analytical procedures. This section discusses specific measures taken to ensure quality in project management, sample collection, and analytical results.

  3. Implementation of an integral program of quality assurance based on EPID to the IMRT

    International Nuclear Information System (INIS)

    We bring forward with this research the implementation of a procedure related to the assurance guaranty in the control of tue quality of IMRT treatment based on the technology of electronic portal images digital (EPID). For the sake of accomplishing quality controls, based in pylic digital images, we used like main tool the System of pylic digital images IviewGTTM with his application software. For the control of positioning of the multi-plates, we implemented a program in MATLAB, which yields the errors of positioning of the plates. For the dosimetric controls, the images obtained for the fields of treatment were climbed with the software ImageJ, and compared with the treatment planning systems (TPS) model Elekta's PrecisePlan® for it we used the software Verisoft. We managed to implement a comprehensive program of quality control for IMRT. The positioning errors of the multiplates intervening bayouth's test younger errors of positioning under a 1m threw which the requisite is for the IMRT. The rest of the geometric proofs yielded favorable results inmail with them tolerance, same as the test Picket Fence. We verified 2 cases with the technique step and shoot, for it we verified 16 field, where gamma Index varied 85,8 - 98,9. It was checked the possibility to accomplish the quality controls for IMRT using pylic digital images, in our case checked itself himself I apply the Linac Elekta specify on the Ameijeiras. (Author)

  4. Illinois Breast and Cervical Cancer Program: Implementing Effective Public-Private Partnerships to Assure Population Health.

    Science.gov (United States)

    Handler, Arden S; Henderson, Vida A; Rosenfeld, Amy; Rankin, Kristin; Jones, Brenda; Issel, L Michele

    2015-01-01

    With the implementation of the Affordable Care Act (ACA), it is essential for the public health sector to elucidate its role with respect to its mission of assuring population health, and to clarify its role with respect to the private health care system. To that end, we examined the value added to the population health enterprise of successful public-private partnerships (PPPs) such as those found in the Illinois Breast and Cervical Cancer Program (IBCCP), the Centers for Disease Control and Prevention's (CDC's) National Breast and Cervical Cancer Early Detection Program (NBCCEDP) in Illinois. Key Informant (KI) interviews focused on IBCCP implementation were conducted with IBCCP lead agency (LA) program coordinators (n = 35/36) in winter 2012-2013. Analysis was conducted using Atlas.ti software. The KI interviews revealed the existence of highly developed PPPs between the IBCCP LAs and individual medical providers and hospitals across Illinois. The data suggest that the small amount of funding provided by IBCCP to each LA in Illinois has been used to build and sustain robust PPPs in the majority of the IBCCP communities. The PPPs developed through the IBCCP can be seen as an unplanned benefit of CDC's investment in breast and cervical health through the NBCCEDP. While the IBCCP/NBCCEDP might be considered a "boutique" categorical program which some may consider no longer necessary as individuals gain insurance under the ACA, the KI data underscore the critical role of public sector dollars, not only to serve individuals and communities directly but also to mobilize the private health care sector to act in partnership with public entities and become advocates for underserved communities. PMID:25470661

  5. Obtaining accreditation by the pharmacy compounding accreditation board, part 3: developing a program of qualtity assurance and continuous qualtiy improvement.

    Science.gov (United States)

    Cabaleiro, Joe

    2008-01-01

    Before a compounding pharmacy can receive accreditation from the Pharmacy Compounding Accreditation Board, the pharmacy must show evidence of both quality assurance activities and continuous quality improvement activities. Although quality assurance data gathering and monitoring can be integrated into pharmacy activities fairly easily, the coninuous quality improvement program may take a little more time and effort to implement . Before integrating these programs, compounding pharmacists must have a complete understanding of the differences between these two programs. Even if accreditation with the Pharmacy Compounding Accreditation Board is not being considered, it is important that compounding pharmacies have these two programs implemented. In the long run, it will pay off in higher quality services, error prevention, and perhaps greater efficiency of pharmacy operations. PMID:23969712

  6. National waste terminal storage repository in a bedded salt formation for spent unreprocessed fuel. Quality assurance program for licensing

    International Nuclear Information System (INIS)

    A National Waste Terminal Storage Repository, in bedded salt, for spent unreprocessed fuel is the subject of a conceptual design project which began in January 1977. This volume presents a preliminary quality assurance program to guide the license applicant in developing a detailed program that will be compatible with anticipated National Waste Terminal Storage (NWTSR2) contracting arrangements and provide the documentation required by regulatory bodies. This QA program is designed to provide confidence that the quality-related activities pertaining to safety-related structures, systems, and components will be identified and controlled. Specific responsibilities for quality-related activities are documented and assigned to personnel and organizations for the major phases of facility design and construction. These responsibilities encompass a broad range of activities and are addressed in this preliminary program. The quality assurance program elements are organized and discussed herein as follows: (1) quality assurance during design and construction; (2) the applicant (DOE); (3) siting contractor; (4) architect/engineer; (5) project field management; and (6) operations contractor

  7. Final Report Project Activity Task ORD-FY04-002 Nevada System of Higher Education Quality Assurance Program

    Energy Technology Data Exchange (ETDEWEB)

    Smiecinski, Amy; Keeler, Raymond; Bertoia, Julie; Mueller, Terry; Roosa, Morris; Roosa, Barbara

    2008-03-07

    The principal purpose of DOE Cooperative Agreement DE-FC28-04RW12232 is to develop and continue providing the public and the U.S. Department of Energy’s (DOE) Office of Civilian Radioactive Waste Management (OCRWM) with an independently derived, unbiased body of scientific and engineering data concerning the study of Yucca Mountain as a potential high-level radioactive waste repository. Under this agreement, the Nevada System of Higher Education (NSHE), formerly the University and Community College System of Nevada (UCCSN), performs scientific or engineering research, and maintains and fosters collaborative working relationships between government and academic researchers. In performing these activities, the NSHE has already developed and implemented a Quality Assurance (QA) program, which was accepted by the DOE Office of Quality Assurance, under the previous Cooperative Agreement Number DE-FC28-98NV12081. The following describes the objectives of Project Activity 002 “Quality Assurance Program” under cooperative agreement DE-FC28-04RW12232. The objective of this QA program was to assure that data produced under the cooperative agreement met the OCRWM QA Requirements and Description (QARD) requirements for quality-affecting (Q) data. The QA Program was written to address specific QARD requirements historically identified and incorporated in Q activities to the degree appropriate for the nature, scope, and complexity of the activity. Additional QARD requirements were integrated into the program when required to complete a specific activity. NSHE QA staff developed a detailed matrix to address each QARD element, identifying the applicable requirements and specifying where each requirement is addressed in the QA program procedures, or identify requirements as “not applicable” to the QA program. Controlled documents were prepared in the form of QA procedures (QAPs) and implementing procedures (IPs). NSHE identified new QAPs and IPs when needed. NSHE PIs

  8. External quality-assurance programs managed by the U.S. Geological Survey in support of the National Atmospheric Deposition Program/National Trends Network

    Science.gov (United States)

    Latysh, Natalie E.; Wetherbee, Gregory A.

    2005-01-01

    The U.S. Geological Survey, Branch of Quality Systems, operates the external quality-assurance programs for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN). Beginning in 1978, six different programs have been implemented?the intersite-comparison program, the blind-audit program, the sample-handling evaluation program, the field-audit program, the interlaboratory-comparison program, and the collocated-sampler program. Each program was designed to measure error contributed by specific components in the data-collection process. The intersite-comparison program, which was discontinued in 2004, was designed to assess the accuracy and reliability of field pH and specific-conductance measurements made by site operators. The blind-audit and sample-handling evaluation programs, which also were discontinued in 2002 and 2004, respectively, assessed contamination that may result from sampling equipment and routine handling and processing of the wet-deposition samples. The field-audit program assesses the effects of sample handling, processing, and field exposure. The interlaboratory-comparison program evaluates bias and precision of analytical results produced by the contract laboratory for NADP, the Illinois State Water Survey, Central Analytical Laboratory, and compares its performance with the performance of international laboratories. The collocated-sampler program assesses the overall precision of wet-deposition data collected by NADP/NTN. This report documents historical operations and the operating procedures for each of these external quality-assurance programs. USGS quality-assurance information allows NADP/NTN data users to discern between actual environmental trends and inherent measurement variability.

  9. Implementation of a lung radiosurgery program: technical considerations and quality assurance in an Australian institution

    International Nuclear Information System (INIS)

    The Peter MacCallum Cancer Centre has established a stereotactic lung radiosurgery program for the treatment of isolated lung metastases. The aim of this study was to critically assess the technical feasibility of performing stereotactic lung radiosurgery in an Australian institution. A single 26-Gy fraction of radiotherapy was delivered to patients with positron emission tomography (PET) staged solitary lung metastases. Motion management was addressed using four-dimensional computed tomographic simulation, and cone beam CT (CBCT) online soft-tissue matching. Treatments were with multiple coplanar and non-coplanar asymmetric beams. Patients were immobilised in a dedicated stereotactic body cradle. Quality assurance (QA) of treatment plans with both ion chamber and film measurements was performed accounting for patient-specific respiratory motion. Between February 2010 and February 2011, nine patients received stereotactic lung radiosurgery. One grade 1 toxicity and one grade 2 toxicity were recorded after treatment. The mean planning target volume was 22.6 cc. A median of eight beams were delivered per treatment plan (range 7–10) with a median of two non-coplanar beams (range 0–6). At treatment plan QA, the difference between planned and delivered dose was ≤1.76% in all static and dynamic ion chamber recordings. A mid-treatment CBCT was performed at a median time of 21 min, with the mean displacement discrepancy from initial set-up being 0.4 mm (range 0–2 mm). Stereotactic radiosurgery to the lung was both feasible and tolerable at our institution. Intrafractional immobilisation within 2 mm was reproducible. Excellent concordance between planned and delivered treatments was achieved in the phantom QA.

  10. The integrated performance evaluation program quality assurance guidance in support of EM environmental sampling and analysis activities

    International Nuclear Information System (INIS)

    EM's (DOE's Environmental Restoration and Waste Management) Integrated Performance Evaluation Program (IPEP) has the purpose of integrating information from existing PE programs with expanded QA activities to develop information about the quality of radiological, mixed waste, and hazardous environmental sample analyses provided by all laboratories supporting EM programs. The guidance addresses the goals of identifying specific PE sample programs and contacts, identifying specific requirements for participation in DOE's internal and external (regulatory) programs, identifying key issues relating to application and interpretation of PE materials for EM headquarters and field office managers, and providing technical guidance covering PE materials for site-specific activities. (PE) Performance Evaluation materials or samples are necessary for the quality assurance/control programs covering environmental data collection

  11. The implementation of quality assurance programs: basic aspect in nuclear plants management

    International Nuclear Information System (INIS)

    Experience in implementing and developing the Quality Assurance programme for the Almaraz nuclear power plant is briefly described. Almaraz was the first Spanish nuclear plant that had to apply specific Quality Assurance standards to its project and construction. The complexity of the project which was developed using standards in a continuous state of evolution, the large number of participating organizations and the numerous interrelationships between them, made the working methods required by the Quality Assurance standards a fundamental tool for establishing order within the framework of the projects, an essential requirement to achieve the objectives regarding costs, schedules and quality. The experience has shown that implementation of Quality Assurance programmes must be accomplished from the highest levels of management and must be thought of as being an essential management tool for achievement of the objectives established, and subjected to periodic revisions in order to check their effectiveness. This logically means that the scope of Quality Assurance must be extended to cover not only those aspects relating to safety but also all activities directly or indirectly affecting adequate operation of the plant, grading the requirements depending on several factors as impact on plant availability, costs of items, complexity of activities, etc. (author)

  12. Modality-dependent dose requirements in the Austrian breast cancer early detection program. First results from technical quality assurance

    International Nuclear Information System (INIS)

    The Austrian Breast Cancer Early Detection Program (BKFP) has officially started in January 2014. In order to ensure that all participating women can rely on a sufficient cancer detection rate while at the same time the required dose is as low as reasonably achievable, all participating radiology institutes (approx. 200) have to fulfill strict quality assurance requirements. The control and certification is performed by the Reference Center for Technical Quality Assurance (RefZQS), which has been developing the methods and tolerances in a pilot project since 2007. The limits are defined in the EUREF-Oeprotocol which is based on the European EPQC guidelines. From the requirement for optimized image quality while simultaneously following the ALARA principle, we found modality-dependent dose requirements, which we had expected but which have now been compiled for the first time for Austria.

  13. Quality assurance manual for the environmental survey and site assessment program, Oak Ridge Institute for Science and Education

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-03-21

    The purpose of this manual is to provide Program policy and oversight for the maintenance of Quality Assurance (QA) and Quality Control (QC) within the Environmental Survey and Site Assessment Program (ESSAP) of Oak Ridge Institute for Science and Education. This manual describes administrative systems, as well as specific quality control procedures, which apply to all functional groups in ESSAP. The sites surveyed under this program are primarily those where residual contamination from previous operations may pose a potential risk to the environment or to the health and safety of those in the immediate vicinity. Other major activities include environmental assessments, training related to decommissioning survey activities, effluent sampling and monitoring, special laboratory analyses, program appraisals and document reviews, consulting on environment-related topics, and technical assistance for guideline development. The methodology for performance of particular field and laboratory activities is presented in the ESSAP Survey Procedures Manual and the Laboratory Procedures Manual.

  14. Revitalizing quality assurance

    International Nuclear Information System (INIS)

    The image of someone inspecting or auditing often comes to mind when people hear the term quality assurance. Although partially correct, this image is not the complete picture. The person doing the inspecting or auditing is probably part of a traditional quality assurance organization, but that organization is only one aspect of a properly conceived and effectively implemented quality assurance system whose goal is improved facility safety and reliability. This paper introduces the underlying philosophies and basic concepts of the International Atomic Energy Agency's new quality assurance initiative that began in 1991 as part of a broad Agency-wide program to enhance nuclear safety. The first product of that initiative was publication in 1996 of a new Quality Assurance Code 50-C/SG-Q and fourteen related Safety Guides. This new suite of documents provide the technical and philosophical foundation upon which Member States can base their quality assurance programs. (author)

  15. Use of alumni and employer surveys for internal quality assurance of the DVM program at the University of Montreal.

    Science.gov (United States)

    Doucet, Michèle Y; Vrins, André

    2010-01-01

    Annual alumni and employer surveys, initially designed as outcomes assessment tools, were integrated into a new internal quality assurance strategy to improve the doctor of veterinary medicine program at the University of Montreal's Faculté de Médecine Vétérinaire. Data collected annually from the classes of 2004-2007 indicated that alumni and their employers were generally satisfied with their level of preparation after one year of professional activity. Specific weaknesses were found in non-technical skills such as communication and resource management. These data were used in support of other forms of feedback to guide curricular reform.

  16. Summary report of the Department of Energy, Division of Operational and Environmental Safety: Quality Assurance Programs 9 through 12

    International Nuclear Information System (INIS)

    Analaytical Laboratories which provide environmental monitoring data for assessment of radioactive contamination, under the Department of Energy (DOE) Contract, were requested to participate in a Quality Assurance Program. The Environmental Measurement Laboratory (EML) was asked to prepare intercomparison samples for radionuclide analysis of soil, water, air filters, tissue ash and vegetation ash for distribution to the Analytical Laboratories. Samples were collected in the environment of DOE facilities, since only water and air samples could be conveniently spiked. A set of 6 to 8 samples is distributed quarterly to 34 laboratories. EML performed multiple analyses on the samples, however, the results are considered intercomparisons, not standards. The program is summarized, and data for Quality Assessment Programs (QAP) 9 through 12 are evaluated

  17. Directory of certificates of compliance for radioactive materials packages: Report of NRC approved quality assurance programs for radioactive material packages

    International Nuclear Information System (INIS)

    This directory contains a Report of the US Nuclear Regulatory Commission's Approved Packages (Volume 1), all Certificates of Compliance (Volume 2), and a Report of NRC Approved Quality Assurance Programs (Volume 3) for Radioactive Material Packages effective October 1, 1988. The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the front of Volume 2 of the directory. A listing by packaging types is included in the back of Volume 2. An alphabetical listing by Company name is included in the back of Volume 3 for approved QA programs. The Reports include a listing of all users of each package design and approved QA programs prior to the publication date of the directory

  18. The Australian Quality Assurance and Continuing Education Program as a model for the reaccreditation of general practitioners in the United Kingdom.

    OpenAIRE

    Salisbury, C.

    1997-01-01

    A Quality Assurance and Continuing Education Program has been developed in Australian general practice over the past nine years. This effectively integrates audit and education within a coherent strategy for quality improvement. The programme fulfils many of the same aims as current proposals for reaccreditation in the United Kingdom (UK). This report describes the operation of the programme and an analysis of the effects of the scheme. A similar quality assurance strategy is proposed for the...

  19. Technical position on items and activities in the high-level waste geologic repository program subject to quality assurance requirements

    International Nuclear Information System (INIS)

    This document provides guidance on how to identify items and activities subject to Quality Assurance in the high-level nuclear waste repository program for pre-closure and post-closure phases of the repository. In the pre-closure phase, structures, systems and components essential to the prevention or mitigation of an accident that could result in an off-site radiation dose of 0.5rem or greater are termed ''important to safety''. In the post-closure phase, the barriers which are relied on to meet the containment and isolation requirements are defined as ''important to waste isolation''. These structures, systems, components, and barriers, and the activities related to their characterization, design, construction, and operation are required to meet quality assurance (QA) criteria to provide confidence in the performance of the geologic repository. The list of structures, systems, and components important to safety and engineered barriers important to waste isolation is referred to as the ''Q-List'' and lies within the scope of the QA program. 10 refs

  20. External quality-assurance results for the National Atmospheric Deposition Program/National Trends Network, 2002-03

    Science.gov (United States)

    Wetherbee, Gregory A.; Latysh, Natalie E.; Burke, Kevin P.

    2005-01-01

    Six external quality-assurance programs were operated by the U.S. Geological Survey (USGS) External Quality-Assurance (QA) Project for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN) from 2002 through 2003. Each program measured specific components of the overall error inherent in NADP/NTN wet-deposition measurements. The intersite-comparison program assessed the variability and bias of pH and specific conductance determinations made by NADP/NTN site operators twice per year with respect to accuracy goals. The percentage of site operators that met the pH accuracy goals decreased from 92.0 percent in spring 2002 to 86.3 percent in spring 2003. In these same four intersite-comparison studies, the percentage of site operators that met the accuracy goals for specific conductance ranged from 94.4 to 97.5 percent. The blind-audit program and the sample-handling evaluation (SHE) program evaluated the effects of routine sample handling, processing, and shipping on the chemistry of weekly NADP/NTN samples. The blind-audit program data indicated that the variability introduced by sample handling might be environmentally significant to data users for sodium, potassium, chloride, and hydrogen ion concentrations during 2002. In 2003, the blind-audit program was modified and replaced by the SHE program. The SHE program was designed to control the effects of laboratory-analysis variability. The 2003 SHE data had less overall variability than the 2002 blind-audit data. The SHE data indicated that sample handling buffers the pH of the precipitation samples and, in turn, results in slightly lower conductivity. Otherwise, the SHE data provided error estimates that were not environmentally significant to data users. The field-audit program was designed to evaluate the effects of onsite exposure, sample handling, and shipping on the chemistry of NADP/NTN precipitation samples. Field-audit results indicated that exposure of NADP/NTN wet-deposition samples

  1. Results of the quality assurance testing program for radiopharmaceuticals 1982-1983

    International Nuclear Information System (INIS)

    The Australian Radiation Laboratory conducts a Radiopharmaceutical Quality Assurance Test Programme in which radiopharmaceuticals used in nuclear medicine in Australia are tested for compliance with specifications. The results of testing during 1982 and 1983 are summarised. Overall 144 batches of 27 different types of radiopharmaceutical were tested in 1982-83. Samples failed to meet specification in 17 of the 1150 tests performed. In all, failure to meet full specification was observed in 13 different types of radiopharmaceutical. No single radiopharmaceutical was responsible for more than 2 failures. Labelling errors accounted for 6/17 failures. Most other errors were of a minor nature and were due to the product being slightly outside specified limits. Of the 17 failures, 11 were associated with imported radiopharmaceuticals (86 batches tested) and 6 were associated with locally produced radiopharmaceuticals (58 batches tested). There is thus no significant difference in the failure rate of local and imported radiopharmaceuticals

  2. Methodology for establishing of a control and assurance program on a Radiology Department of a university hospital

    International Nuclear Information System (INIS)

    The purpose of this work is to present a proposal of a quality assurance program developed for a typical diagnostic radiology department of a University Hospital. The aim of this program is to reduce the number of films lost due to several kinds of problems, equipment malfunction, incorrect selection of the physical parameters of the X-ray equipment, poor conditions of the film ecrans and chassis, excessive temperature fluctuations on the processor, personnel training and organizational related aspects. The preliminary results shows that the main causes of problems are film overexposure, film under exposure, unexposed films taken back to the dark room, inadequate positioning of the film in the couch, inadequate positioning of the patient and the X-ray processor in addition to others of minor importance. It is very important to emphasize that the data acquisition methodology must contemplate a professional posture of respect for those involved in the procedures and as result of this one would expect their active participation in the program. As result of the first year of study, this program has demonstrated that the annual losses in the department studied are over US$ 125.000,00 and the goal of this program now is to reduce this figure to an acceptable number, US$40.000,00 a reasonable value for a large diagnostic radiology facility. (author). 6 refs., 4 figs

  3. 10 CFR 71.37 - Quality assurance.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance. 71.37 Section 71.37 Energy NUCLEAR... Package Approval § 71.37 Quality assurance. (a) The applicant shall describe the quality assurance program... quality assurance program that are applicable to the particular package design under...

  4. Need of patient-specific quality assurance and pre-treatment verification program for special plans in radiotherapy

    International Nuclear Information System (INIS)

    Accuracy in planned radiation dose delivery in cancer treatments becomes necessary in the advent of complex treatment delivery options with newer technology using medical linear accelerators, which makes patient management very crucial. Treatment outcome in an individual patient therefore depends on the professional involvement of staff and execution accuracy of planned procedure. Therefore, this article has addressed an important problem. International Atomic Energy Agency (IAEA) and International Commission on Radiological Protection (ICRP) reported mis-administrations of radiation dose, the nature of their occurrence and complexity of situations. Lack of adequate quality assurance (QA) program or failure in their routine applications, complacency in attention, lack of knowledge, overconfidence, pressures of time, lack of resources and failures in communication are some of the general human causes of errors. A recent report enumerated misadministration of radiation doses under the heading 'harming instead of healing' delivery of wrong doses in small field treatment plans with stereotactic equipment' was mostly highlighted

  5. Effect of certified reference material 470 (CRM 470) on national quality assurance programs for serum proteins in Europe.

    Science.gov (United States)

    Johnson, A M; Whicher, J T

    2001-11-01

    The introduction of the international reference material for serum proteins, CRM 470, has resulted in significant reduction of the among-laboratory variance for most proteins assayed in European national quality assurance programs. In general, the CVs have decreased by 5 to 65%. However, both among- and within-manufacturer variances in many cases remain unacceptably high. In addition, concentration-dependent differences in variance and bias are present for some proteins. Although some variance will persist, reducing variance and bias to levels required for the institution of universal reference ranges will necessitate more accurate transfer of values to calibrants and controls and improved calibration curve fitting by manufacturers, as well as better quality control within laboratories.

  6. External quality-assurance results for the National Atmospheric Deposition Program and the National Trends Network during 1986

    Science.gov (United States)

    See, Randolph B.; Schroder, LeRoy J.; Willoughby, Timothy C.

    1988-01-01

    During 1986, the U.S. Geological Survey operated three programs to provide external quality-assurance monitoring of the National Atmospheric Deposition Program and National Trends Network. An intersite-comparison program was used to assess the accuracy of onsite pH and specific-conductance determinations at quarterly intervals. The blind-audit program was used to assess the effect of routine sample handling on the precision and bias of program and network wet-deposition data. Analytical results from four laboratories, which routinely analyze wet-deposition samples, were examined to determine if differences existed between laboratory analytical results and to provide estimates of the analytical precision of each laboratory. An average of 78 and 89 percent of the site operators participating in the intersite-comparison met the network goals for pH and specific conductance. A comparison of analytical values versus actual values for samples submitted as part of the blind-audit program indicated that analytical values were slightly but significantly (a = 0.01) larger than actual values for pH, magnesium, sodium, and sulfate; analytical values for specific conductance were slightly less than actual values. The decreased precision in the analyses of blind-audit samples when compared to interlaboratory studies indicates that a large amount of uncertainty in network deposition data may be a result of routine field operations. The results of the interlaboratory comparison study indicated that the magnitude of the difference between laboratory analyses was small for all analytes. Analyses of deionized, distilled water blanks by participating laboratories indicated that the laboratories had difficulty measuring analyte concentrations near their reported detection limits. (USGS)

  7. External quality-assurance results for the National Atmospheric Deposition Program / National Trends Network and Mercury Deposition Network, 2004

    Science.gov (United States)

    Wetherbee, Gregory A.; Latysh, Natalie E.; Greene, Shannon M.

    2006-01-01

    The U.S. Geological Survey (USGS) used five programs to provide external quality-assurance monitoring for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN) and two programs to provide external quality-assurance monitoring for the NADP/Mercury Deposition Network (NADP/MDN) during 2004. An intersite-comparison program was used to estimate accuracy and precision of field-measured pH and specific-conductance. The variability and bias of NADP/NTN data attributed to field exposure, sample handling and shipping, and laboratory chemical analysis were estimated using the sample-handling evaluation (SHE), field-audit, and interlaboratory-comparison programs. Overall variability of NADP/NTN data was estimated using a collocated-sampler program. Variability and bias of NADP/MDN data attributed to field exposure, sample handling and shipping, and laboratory chemical analysis were estimated using a system-blank program and an interlaboratory-comparison program. In two intersite-comparison studies, approximately 89 percent of NADP/NTN site operators met the pH measurement accuracy goals, and 94.7 to 97.1 percent of NADP/NTN site operators met the accuracy goals for specific conductance. Field chemistry measurements were discontinued by NADP at the end of 2004. As a result, the USGS intersite-comparison program also was discontinued at the end of 2004. Variability and bias in NADP/NTN data due to sample handling and shipping were estimated from paired-sample concentration differences and specific conductance differences obtained for the SHE program. Median absolute errors (MAEs) equal to less than 3 percent were indicated for all measured analytes except potassium and hydrogen ion. Positive bias was indicated for most of the measured analytes except for calcium, hydrogen ion and specific conductance. Negative bias for hydrogen ion and specific conductance indicated loss of hydrogen ion and decreased specific conductance from contact of the sample with

  8. Development of a Program on quality assurance in radiotherapy and radiology

    International Nuclear Information System (INIS)

    In this paper the development of a program of QA in radiotherapy and radiology is described. The objectives, resources, manpower and the cooperation between the IAEA and the Direccion General de Energia are outlined

  9. External quality-assurance results for the National Atmospheric Deposition Program/National Trends Network during 1991

    Science.gov (United States)

    Nilles, M.A.; Gordon, J.D.; Schroder, L.J.; Paulin, C.E.

    1995-01-01

    The U.S. Geological Survey used four programs in 1991 to provide external quality assurance for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN). An intersite-comparison program was used to evaluate onsite pH and specific-conductance determinations. The effects of routine sample handling, processing, and shipping of wet-deposition samples on analyte determinations and an estimated precision of analyte values and concentrations were evaluated in the blind-audit program. Differences between analytical results and an estimate of the analytical precision of four laboratories routinely measuring wet deposition were determined by an interlaboratory-comparison program. Overall precision estimates for the precipitation-monitoring system were determined for selected sites by a collocated-sampler program. Results of the intersite-comparison program indicated that 93 and 86 percent of the site operators met the NADP/NTN accuracy goal for pH determinations during the two intersite-comparison studies completed during 1991. The results also indicated that 96 and 97 percent of the site operators met the NADP/NTN accuracy goal for specific-conductance determinations during the two 1991 studies. The effects of routine sample handling, processing, and shipping, determined in the blind-audit program indicated significant positive bias (a=.O 1) for calcium, magnesium, sodium, potassium, chloride, nitrate, and sulfate. Significant negative bias (or=.01) was determined for hydrogen ion and specific conductance. Only ammonium determinations were not biased. A Kruskal-Wallis test indicated that there were no significant (*3t=.01) differences in analytical results from the four laboratories participating in the interlaboratory-comparison program. Results from the collocated-sampler program indicated the median relative error for cation concentration and deposition exceeded eight percent at most sites, whereas the median relative error for sample volume

  10. 77 FR 14955 - DoD Information Assurance Scholarship Program (IASP)

    Science.gov (United States)

    2012-03-14

    ... programming, computer science, computer systems analysis, cyber operations, cybersecurity, database... Register, (75 FR 9142) on Monday, March 1, 2010 for public comments. The comment period ended on April 30... excellence. IA. For the purpose of this part, the term ``IA'' includes computer security, network...

  11. 78 FR 12157 - RFS Renewable Identification Number (RIN) Quality Assurance Program

    Science.gov (United States)

    2013-02-21

    ... to the Definition and Treatment of Invalid RINs ] A. Export and Exporter Provisions 1. Exporter RVO 2....\\1\\ \\1\\ 75 FR 14670. The RFS program requires that specified volumes of renewable fuel be used as... percentage standards annually that apply to the sum of all gasoline and diesel produced or imported....

  12. Using Continuous Improvement in Online Program Design: DMAIC as a Tool for Assurance of Learning Assessments

    Science.gov (United States)

    Carnovale, Steven; Allen, Cliff; Pullman, Madeleine; Wong, Daniel

    2016-01-01

    The integration of technology into education has forced radical innovations to traditional instructional delivery models. Given its prevalence, a thorough understanding of pedagogical best practices associated with the design and implementation of such programs is critical. Furthermore, the need for an institutional commitment to assessment and a…

  13. Initial experience with the installation and quality assurance program of the Philips SRI-100 digital portal imaging

    International Nuclear Information System (INIS)

    The Radiotherapy Department at Heidelberg Repatriation Hospital has purchased the first Digital Portal Imaging System (DPIS) in Australia. The DPIS has a demountable armature attached to a Philips SL15 6MV X-ray therapy unit. The SRI-100 captures images which can then be printed, stored or processed for image enhancement. The component sections of the DPIS are image detection, conversion, processing, control and display. All sections are made up from original equipment manufacturer modules that should provide for ease of access to spare parts and technical support. Computer control is provided from a Compaq 386-SX PC using DOS version 3.3 and a GEM desktop environment. The imaging software is user friendly and provides the operator with a comparatively easy environment in which to write dedicated image processing procedures as the need arises. The standard software provides a large number of image processing routines including filters, statistical functions, grey-scale manipulation and image housekeeping. A daily quality assurance (QA) program has been implemented using system software to check camera noise and image saturation, with a monthly imaging QA program using the RMI Portal Film Phantom. The systems strengths and weaknesses are discussed along with suggested hardware and software improvements and upgrades. 8 refs., 2 tabs., 7 figs

  14. Project quality assurance plan for research and development services provided by Oak Ridge National Laboratory in support of the Hanford Grout Disposal Program

    International Nuclear Information System (INIS)

    This Project Quality Assurance Plan (PQAP) is being published to provide the sponsor with referenceable documentation for work conducted in support of the Hanford WHC Grout Disposal Program. This plan, which meets NQA-1 requirements, is being applied to work performed at Oak Ridge National Laboratory (ORNL) during FY 1991 in support of this program. It should also be noted that with minor revisions, this plan should be applicable to other projects involving research and development that must comply with NQA-1 requirements

  15. Evaluation Research and Quality Assurance.

    Science.gov (United States)

    Pesta, George; Respress, Trinetia; Major, Aline K.; Arazan, Christine; Coxe, Terry

    2002-01-01

    Describes the Juvenile Justice Educational Enhancement Program's implementation of an evaluation research-driven quality assurance process for Florida's juvenile justice educational programs. Reviews the literature on juvenile justice educational practices and describes the educational quality assurance standards and annual modifications that draw…

  16. Navy Radon Assessment and Mitigation Program: Work/quality assurance project plan screening phase

    International Nuclear Information System (INIS)

    In 1987, the military services of the United States were tasked to take appropriate action to establish an indoor radon assessment and mitigation program. As a result, the Naval Facilities Engineering Command (NAVFACENGCOM) was assigned the responsibility of identifying potential hazards to personnel from exposure to naturally occurring radon gas and prioritizing corrective actions and to coordinating these actions with the major claimants. NAVRAMP is based upon current US Environmental Protection Agency (EPA) guidelines. The program has been separated into four phases. The screening phase will concentrate on evaluating radon levels, based on statistical samples, in those buildings that have been determined to be at most at risk to elevated levels of radon, such as base housing, schools, day-care centers, hospitals, brigs, Base Officer Quarters, and Base Enlisted Quarters. During the assessment phase, every building that contains personnel for over 4 h/day will be evaluated. Mitigation work will be accomplished by Navy or Navy-contracted personnel. HAZWRAP services during the mitigation phase will consist of determining the extent of reduction in radon levels after the mitigation effort. 7 refs., 11 figs

  17. Quality assurance program in diagnostic radiology; Programa de garantia de qualidade em radiologia diagnostica

    Energy Technology Data Exchange (ETDEWEB)

    Yacovenco, Alejandro; Borges, J.C. [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia; Lira, S.H. [Hospital Central da Policia Militar, Rio de Janeiro, RJ (Brazil). Servico de Radiologia; Mota, H.C. [Instituto de Radioprotecao e Dosimetria (IRD), Rio de Janeiro, RJ (Brazil)

    1994-07-01

    Aiming to elaborate a methodology to optimize the performance of the Radiology Service of the Military Police Hospital, in Rio dee Janeiro, some goals were established: improvement of the attendance to patients; improvement of the qualification of technicians; achievement and maintenance of high degrees of quality in each step of the radiological process; improvement of the image quality; optimization of dose per examination and cost reduction. The procedure used to detect faults in the radiological process was the analysis of causes of film losses. Results show a 70% reduction in the film rejection rate. 74% of total identified faults were due to equipment, 11% to films, 10% to patients and 5% to developing. The reduction in the cost of developed film reached 75%. A training course given to the staff of the radiological service fully reached its goals, contributing, with the staff motivation, mostly to the success of the program. This success indicates that, with a serious persistent work, it is possible to offer to patients services within their expectations, even at a public hospital. Such programs should be supported by health authorities, not only due to their technical and economic needs but, mostly, due to their social implications. (author). 10 refs., 11 figs.

  18. External quality-assurance results for the national atmospheric deposition program/national trends network, 2000-2001

    Science.gov (United States)

    Wetherbee, Gregory A.; Latysh, Natalie E.; Gordon, John D.

    2004-01-01

    Five external quality-assurance programs were operated by the U.S. Geological Survey for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN) from 2000 through 2001 (study period): the intersite-comparison program, the blind-audit program, the field-audit program, the interlaboratory-comparison program, and the collocated-sampler program. Each program is designed to measure specific components of the total error inherent in NADP/NTN wet-deposition measurements. The intersite-comparison program assesses the variability and bias of pH and specific-conductance determinations made by NADP/NTN site operators with respect to accuracy goals. The accuracy goals are statistically based using the median of all of the measurements obtained for each of four intersite-comparison studies. The percentage of site operators responding on time that met the pH accuracy goals ranged from 84.2 to 90.5 percent. In these same four intersite-comparison studies, 88.9 to 99.0 percent of the site operators met the accuracy goals for specific conductance. The blind-audit program evaluates the effects of routine sample handling, processing, and shipping on the chemistry of weekly precipitation samples. The blind-audit data for the study period indicate that sample handling introduced a small amount of sulfate contamination and slight changes to hydrogen-ion content of the precipitation samples. The magnitudes of the paired differences are not environmentally significant to NADP/NTN data users. The field-audit program (also known as the 'field-blank program') was designed to measure the effects of field exposure, handling, and processing on the chemistry of NADP/NTN precipitation samples. The results indicate potential low-level contamination of NADP/NTN samples with calcium, ammonium, chloride, and nitrate. Less sodium contamination was detected by the field-audit data than in previous years. Statistical analysis of the paired differences shows that contaminant ions

  19. Implementation of a Quality Assurance Program in a new Radiotherapy Center taking as base the TG-40

    International Nuclear Information System (INIS)

    The recommended principles in the 'Comprehensive QA for radiation oncology: Report of AAPM Radiation Therapy Committee Task Group 40', TG-40, have been the base for implementation of the Quality Assurance Program of a modern Radiotherapy service. During its application has been necessary: to initiate its implementation before the equipment installation, assuming the costs of the contracts of the qualified personnel, realizing an initial investment adequate for equipment acquisition necessary for acceptation, commissioning and routinary control, the experienced formation of the personnel in the protocol philosophy, establishing procedures for day by day process which would allow the retrofeeding, the elaboration of templates and opening to changes and adjustments according to the necessities. The experience of two years had been demonstrated that the TG-40: a) It is feasible to be implemented but sometimes no strict totally and it is essential to have qualified personnel and the necessary material resources; b) It does not contains all the necessary for its practical implementation and must be completing with procedures and routine formats which facilitate their application; c) It allows the detection and opportune failure correction in the process; d) It is a continuous process that does not finishes. (Author)

  20. Preliminary results of a program of quality assurance applied to the image service of a public hospital

    International Nuclear Information System (INIS)

    Overall quality in radiological protection and medical image depend largely on keeping certain safety standards and technical procedures in good levels. In this way, in June 1998, the Ministry of Health published the document 453 - Guidelines of Radiological Protection to Medical and Dental Practices, defining different levels of actions and responsibility for radiological installation where the critical starting point was the necessity of a previous quality assurance program (QAP) into the radiological service. Preliminary results of a QAP realized in the Department of Radiology of a high complexity Hospital in Rio de Janeiro has showed that, although the importance of 453 Regulation be recognized, there is a few motivation for implementing it. Besides, during 1999 it was possible to identify film losses of 14,9 % related only to the repetition of exposures in the patients, reflecting in terms of cost about U$ 100,000 a year. Results suggest that losses of 64% of total film are due to under or over exposures and 15% are due to inadequate positioning of either film or patient, evidencing the need for training the technical and medical staff . (author)

  1. Quality assurance program of a respiratory gating irradiation system based on external and internal fiducial markers

    International Nuclear Information System (INIS)

    Respiratory Gating involves the administration of radiation during treatment delivery within a particular portion of the patients breathing cycle, so the absorbed dose administration with respiratory control techniques requires specific quality control to ensure the correctness of the delivered dose. The establishment of a Quality Control Program (QC) is proposed for the Respiratory Gating based techniques in order to have a better understanding of how this system works and to know its associated dosimetric impact. The influence of the CT acquisition under respiratory motion conditions has been analyzed for the treatment isocenter localization, using internal and external fiducial markers with IGRT techniques that allow the correlation of the isocenter positioning with the phase of the respiratory cycle. Radiation delivery in the presence of intra fraction organ motion causes an averaging or blurring of the static dose distribution over the path of motion increasing the beam penumbra of the radiation field and reducing the therapeutic region when the irradiation is not breath controlled. The feasibility of intensity modulated treatments (IMRT) for both static and dynamic techniques, managed by respiratory control has been tested, demonstrating the possibility of synchronizing the movement of the leaves in the microfluorimeter collimator (mMLC) with the gated beam irradiation. (Author) 45 refs.

  2. Quality assurance/quality control summary report for Phase 1 of the Clinch River remedial investigation. Environmental Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    Holladay, S.K.; Bevelhimer, M.S.; Brandt, C.C. [and others

    1994-07-01

    The Clinch River Remedial Investigation (CRRI) is designed to address the transport, fate, and distribution of waterborne contaminants released from the US Department of Energy Oak Ridge Reservation and to assess potential risks to human health and the environment associated with these contaminants. Primary areas of investigation are Melton Hill Reservoir, the Clinch River from Melton Hill Dam to its confluence with the Tennessee River, Poplar Creek, and Watts Bar Reservoir. Phase 1 of the CRRI was a preliminary study in selected areas of the Clinch River/Watts Bar Reservoir. Fish, sediment, and water samples were collected and analyzed for inorganic, organic, and radiological parameters. Phase 1 was designed to (1) obtain high-quality data to confirm existing historical data for contaminant levels; (2) determine the range of contaminant concentrations present in the river-reservoir system; (3) identify specific contaminants of concern; and (4) establish the reference (background) concentrations for those contaminants. Quality assurance (QA) objectives for Phase I were that (1) scientific data generated would withstand scientific scrutiny; (2) data would be gathered using appropriate procedures for field sampling, chain-of-custody, laboratory analyses, and data reporting; and (3) data would be of known precision and accuracy. These objectives were met through the development and implementation of (1) a QA oversight program of audits and surveillances; (2) standard operating procedures accompanied by a training program; (3) field sampling and analytical laboratory quality control requirements; (4) data and records management systems; and (5) validation of the data by an independent reviewer. Approximately 1700 inorganic samples, 1500 organic samples, and 2200 radiological samples were analyzed and validated. The QA completeness objective for the project was to obtain valid analytical results for at least 95% of the samples collected.

  3. A quality-assurance assessment for constituents reported by the National Atmospheric Deposition Program and the National Trends Network

    Science.gov (United States)

    See, R.B.; Schroder, L.J.; Willoughby, T.C.

    1989-01-01

    A continuing quality-assurance program has been operated by the U.S. Geographical Survey to evaluate any bias introduced by routine handling, shipping, and laboratory analyses of wet-deposition samples collected in the National Atmospheric Deposition Program (NADP) and National Trends Network (NTN). Blind-audit samples having a variety of constituent concentrations and values were selected. Only blind-audit samples with constituent concentrations and values less than the 95th-percentile concentration for natural wet-deposition samples were included in the analysis. Of the major ions, there was a significant increase of Ca2+, Mg2+, K+ SO42+ and Cl- in samples handled according to standard protocols and shipped in NADP/NTN sample-collection buckets. For 1979-1987, graphs of smoothed data showing the estimated contaminations in blind-audit samples indicate a decrease in the median concentration and ranges of Ca2+, Mg2+ and SO42- contamination of blind-audit samples shipped in sample-collection buckets. Part of the contamination detected in blind-audit samples can be attributed to contact with the sample-collection bucket and lid; however, additional sources also seem to contaminate the blind-audit sample. Apparent decreases in the magnitude and range of sample contamination may be caused by differences in sample-collection bucket- and lid-washing procedures by the NADP/NTN Central Analytical Laboratory. Although the degree of bias is minimal for most constituents, summaries of the NADP/NTN data base may contain overestimates of Ca2+, Mg2+, Na-, K+, SO42- and Cl- concentrations, and underestimates of H+ concentrations.

  4. Central online quality assurance in radiology. An IT solution exemplified by the German Breast Cancer Screening Program

    International Nuclear Information System (INIS)

    Purpose: Physical-technical quality assurance is one of the essential tasks of the National Reference Centers in the German Breast Cancer Screening Program. For this purpose the mammography units are required to transfer the measured values of the constancy tests on a daily basis and all phantom images created for this purpose on a weekly basis to the reference centers. This is a serious logistical challenge. To meet these requirements, we developed an innovative software tool. Materials and Methods: By the end of 2005, we had already developed web-based software (MammoControl) allowing the transmission of constancy test results via entry forms. For automatic analysis and transmission of the phantom images, we then introduced an extension (MammoControl DIANA). This was based on Java, Java Web Start, the NetBeans Rich Client Platform, the Pixelmed Java DICOM Toolkit and the ImageJ library. Results: MammoControl DIANA was designed to run locally in the mammography units. This allows automated on-site image analysis. Both results and compressed images can then be transmitted to the reference center. We developed analysis modules for the daily and monthly consistency tests and additionally for a homogeneity test. Conclusion: The software we developed facilitates the immediate availability of measurement results, phantom images, and DICOM header data in all reference centers. This allows both targeted guidance and short response time in the case of errors. We achieved a consistent IT-based evaluation with standardized tools for the entire screening program in Germany. (orig.)

  5. QA [Quality Assurance] role in advanced energy activities: Towards an /open quotes/orthodox/close quotes/ Quality Program: Canonizing the traditions at Fermilab

    International Nuclear Information System (INIS)

    After a brief description of the goal of Fermi National Accelerator Laboratory (Fermilab) this paper poses and answers three questions related to Quality Assurance (QA) at the Laboratory. First, what is the difference between 'orthodox' and 'unorthodox' QA and is there a place for 'orthodox' QA at a laboratory like Fermilab? Second, are the deeper philosophical and cultural frameworks of high-energy physics acommodating or antagonistic to an 'orthodox' QA Program? Finally, faced with the task of developing an institutional QA program for Fermilab where does one begin? The paper is based on experience with the on-going development and implementation of an institutional QA Program at Fermilab. 10 refs

  6. Directory of certificates of compliance for radioactive materials packages: Summary report of NRC approved quality assurance programs for radioactive material packages

    International Nuclear Information System (INIS)

    This directory contains a Summary Report of the US Nuclear Regulatory Commission's Summary Report of NRC Approved Quality Assurance Programs (Volume 3) for Radioactive Material Packages effective October 1, 1987. This directory makes available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an alphabetical listing by Company name is included in the back of Volume 3 for approved QA programs. The Summary Reports include a listing of all users of each package design and approved QA programs prior to the publication date of the directory

  7. Flow assurance

    Energy Technology Data Exchange (ETDEWEB)

    Mullins, O.C.; Dong, C. [Schlumberger-Doll Research Center, Cambridge, MA (United States); Elshahawi, H. [Shell Exploration and Production Company, The Hague (Netherlands)

    2008-07-01

    This study emphasized the need for considering flow assurance for producing oil and gas, particularly in high cost areas such as deepwater. Phase behaviour studies, sticking propensities, and interfacial interactions have been investigated in many laboratory studies using asphaltenes, wax, hydrates, organic and inorganic scale, and even diamondoids. However, the spatial variation of reservoir fluids has received little attention, despite the fact that it is one of the most important factors affecting flow assurance. This issue was difficult to address in a systematic way in the past because of cost constraints. Today, reservoir fluid variation and flow assurance can be considered at the outset of a project given the technological advances in downhole fluid analysis. This study described the origins of reservoir fluid compositional variations and the controversies surrounding them. It also described the indispensable chemical analytical technology. The impact of these reservoir fluid compositional variations on flow assurance considerations was also discussed. A methodology that accounts for these variations at the outset in flow assurance evaluation was also presented.

  8. Financial assurances

    International Nuclear Information System (INIS)

    US Ecology is a full service waste management company. The company operates two of the nation's three existing low-level radioactive waste (LLRW) disposal facilities and has prepared and submitted license applications for two new LLRW disposal facilities in California and Nebraska. The issue of financial assurances is an important aspect of site development and operation. Proper financial assurances help to insure that uninterrupted operation, closure and monitoring of a facility will be maintained throughout the project's life. Unfortunately, this aspect of licensing is not like others where you can gauge acceptance by examining approved computer codes, site performance standards or applying specific technical formulas. There is not a standard financial assurance plan. Each site should develop its requirements based upon the conditions of the site, type of design, existing state or federal controls, and realistic assessments of future financial needs. Financial assurances at U.S. Ecology's existing sites in Richland, Washington, and Beatty, Nevada, have been in place for several years and are accomplished in a variety of ways by the use of corporate guarantees, corporate capital funds, third party liability insurance, and post closure/long-term care funds. In addressing financial assurances, one can divide the issue into three areas: Site development/operations, third party damages, and long-term care/cleanup

  9. Design and implementation of a quality assurance program for gamma cameras; Diseno e implementacion de un programa de aseguramiento de calidad para camaras gamma

    Energy Technology Data Exchange (ETDEWEB)

    Montoya M, A.; Rodriguez L, A. [Instituto Nacional de Cancerologia, Departamento de Medicina Nuclear, Av. San Fernando No. 22, Col. Seccion XVI, 14080 Mexico D. F. (Mexico); Trujillo Z, F. E., E-mail: montoya-moreno@hotmail.co [Hospital Regional de Alta Especialidad de Oaxaca, Area de Fisica Medica, Aldama s/n, Paraje El Tule, 71256 San Bartolo Coyotepec, Oaxaca (Mexico)

    2010-09-15

    In nuclear medicine more than 90% of the carried out procedures are diagnostic. To assure an appropriate diagnostic quality of the images and the doses optimization received by the patients originated in the radioactive material, it is indispensable the periodic surveillance of the operation and performance of the equipment s by means of quality assurance tests. This work presents a proposal of a quality assurance program for gamma cameras based on recommendations of the IAEA, the American Association of Medical Physics and the National Electrical Manufacturers Association. Some tests of the program were applied to an e.cam gamma camera (Siemens) of the Nuclear Medicine Department of the National Institute of Cancer. The intrinsic and extrinsic uniformity, the intrinsic spatial resolution and the extrinsic sensibility were verified. For intrinsic uniformity the average daily values of the integral uniformity and differential uniformity in the useful vision field were 2.61% and 1.58% respectively, the average monthly values of intrinsic uniformity for the integral and differential uniformity in the useful vision field were 4.10% and 1.66% respectively. The used acceptance criterions were respectively of 3.74% and 2.74%. The average values of extrinsic uniformity for the useful vision field were of 7.65% (intrinsic uniformity) and 2.69% (extrinsic uniformity), in this case the acceptance criterion is a value of 6.00%. The average value of intrinsic spatial resolution went 4.67 mm superior to 4.4. mm that is the acceptance limit. Finally, maximum variations of 1.8% were observed (minors than 2% that is the acceptance criterion) for the extrinsic sensibility measured in different regions of the detector. Significant variations of extrinsic sensibility were not observed among the monthly lectures. Of the realized measurements was concluded that the system requires of a maintenance service by part of the manufacturer, which one carries out later on to this work. The

  10. The quality assurance liaison: Combined technical and quality assurance support

    International Nuclear Information System (INIS)

    This paper describes the role of the quality assurance liaison, the responsibilities of this position, and the evolutionary changes in duties over the last six years. The role of the quality assurance liaison has had a very positive impact on the Los Alamos Yucca Mountain Site Characterization (YW) quality assurance program. Having both technical and quality assurance expertise, the quality assurance liaisons are able to facilitate communications with scientists on quality assurance issues and requirements, thereby generating greater productivity in scientific investigations. The quality assurance liaisons help ensure that the scientific community knows and implements existing requirements, is aware of new or changing regulations, and is able to conduct scientific work within Project requirements. The influence of the role of the quality assurance liaison can be measured by an overall improvement in attitude of the staff regarding quality assurance requirements and improved job performance, as well as a decrease in deficiencies identified during both internal and external audits and surveillances. This has resulted in a more effective implementation of quality assurance requirements

  11. The quality assurance liaison: Combined technical and quality assurance support

    Science.gov (United States)

    Bolivar, S. L.; Day, J. L.

    1993-03-01

    The role of the quality assurance liaison, the responsibilities of this position, and the evolutionary changes in duties over the last six years are described. The role of the quality assurance liaison has had a very positive impact on the Los Alamos Yucca Mountain Site Characterization (YW) quality assurance program. Having both technical and quality assurance expertise, the quality assurance liaisons are able to facilitate communications with scientists on quality assurance issues and requirements, thereby generating greater productivity in scientific investigations. The quality assurance liaisons help ensure that the scientific community knows and implements existing requirements, is aware of new or changing regulations, and is able to conduct scientific work within Project requirements. The influence of the role of the quality assurance liaison can be measured by an overall improvement in attitude of the staff regarding quality assurance requirements and improved job performance, as well as a decrease in deficiencies identified during both internal and external audits and surveillances. This has resulted in a more effective implementation of quality assurance requirements.

  12. Quality assurance program in the External dosimetry laboratory of the CPHR; Programa de aseguramiento de la calidad en el laboratorio de dosimetria externa del CPHR

    Energy Technology Data Exchange (ETDEWEB)

    Molina P, D.; Pernas S, R.; Martinez H, E.; Cardenas H, J. [Centro de Proteccion e Higiene de las Radiaciones, Calle 20 No. 4113 e/41 y 47. Playa, C.P. 11300, A.P. 6195, C.P. 10600 La Habana (Cuba)

    2006-07-01

    From 1999 the Laboratory of External Dosimetry of the Radiation Protection and Hygiene Center comes applying in its service of personal dosimetry a Program of Quality Assurance. This program was designed according to the recommendations of national and international organizations as the National Assuring Office of the Republic of Cuba (ONARC), the International Standards Organization (ISO), the International Electro technique Commission (IEC) and the International Atomic Energy Agency (IAEA). In this work it is presented in a summarized way the operation of this Program of Quality Assurance which includes the administration and conservation of the results and the documentation of the service, the controls that are carried out to the equipment, the acceptance tests that are applied to the equipment and new dosemeters, the shipment and prosecution of the dosemeters, the evaluation, storage and conservation of the doses, the report of the results, the traceability and reproducibility of the measurements, the attention to the reclamations and the clients complaints and the internal and external audits to those that it undergoes periodically the laboratory. (Author)

  13. SU-C-BRD-01: Multi-Centre Collaborative Quality Assurance Program for IMRT Planning and Delivery: Year 3 Results

    Energy Technology Data Exchange (ETDEWEB)

    McNiven, A; Jaffray, D; Letourneau, D [Princess Margaret Cancer Centre and Department of Radiation Oncology, University of Toronto, Toronto, ON (Canada)

    2015-06-15

    Purpose: A multi-centre quality assurance program was developed to enable quality improvement by coupling measurement of intensity modulated radiotherapy (IMRT) planning and delivery performance for site-specific planning exercises with diagnostic testing. The third year of the program specifically assessed the quality of spine stereotactic body radiotherapy (SBRT) planning and delivery amongst the participating centres. Methods: A spine SBRT planning exercise (24 Gy in 2 fractions) was created and completed by participants prior to an on-site visit. The delivery portion of the on-site visit included spine SBRT plan delivery and diagnostic testing, which included portal image acquisition for quantification of phantom positioning error and multi-leaf collimator (MLC) calibration accuracy. The measured dose was compared to that calculated in the treatment planning system (TPS) using 3%/2mm composite analysis and 3%/3mm gamma analysis. Results: Fourteen institutions participated, creating 17 spine SBRT plans (15 VMAT and 2 IMRT). Three different TPS, two beam energies (6 MV and 6 MV FFF), and four MLC designs from two linac vendors were tested. Large variation in total monitor units (MU) per plan (2494–6462 MU) and dose-volume parameters was observed. The maximum point dose in the plans ranged from 116–149% and was dependent upon the TPS used. Pass rates for measured to planned dose comparison ranged from 89.4–100% and 97.3–100% for 3%/2mm and 3%/3mm criteria respectively. The largest measured MLC error did Result in one of the poorer pass rates. No direct correlation between phantom positioning error and pass rates overall. Conclusion: Significant differences were observed in the planning exercise for some plan and dose-volume parameters based on the TPS used. Standard evaluation criteria showed good agreement between planned and measured dose for all participants, however on an individual plan basis, diagnostic tests were able to identify contributing

  14. SU-C-BRD-01: Multi-Centre Collaborative Quality Assurance Program for IMRT Planning and Delivery: Year 3 Results

    International Nuclear Information System (INIS)

    Purpose: A multi-centre quality assurance program was developed to enable quality improvement by coupling measurement of intensity modulated radiotherapy (IMRT) planning and delivery performance for site-specific planning exercises with diagnostic testing. The third year of the program specifically assessed the quality of spine stereotactic body radiotherapy (SBRT) planning and delivery amongst the participating centres. Methods: A spine SBRT planning exercise (24 Gy in 2 fractions) was created and completed by participants prior to an on-site visit. The delivery portion of the on-site visit included spine SBRT plan delivery and diagnostic testing, which included portal image acquisition for quantification of phantom positioning error and multi-leaf collimator (MLC) calibration accuracy. The measured dose was compared to that calculated in the treatment planning system (TPS) using 3%/2mm composite analysis and 3%/3mm gamma analysis. Results: Fourteen institutions participated, creating 17 spine SBRT plans (15 VMAT and 2 IMRT). Three different TPS, two beam energies (6 MV and 6 MV FFF), and four MLC designs from two linac vendors were tested. Large variation in total monitor units (MU) per plan (2494–6462 MU) and dose-volume parameters was observed. The maximum point dose in the plans ranged from 116–149% and was dependent upon the TPS used. Pass rates for measured to planned dose comparison ranged from 89.4–100% and 97.3–100% for 3%/2mm and 3%/3mm criteria respectively. The largest measured MLC error did Result in one of the poorer pass rates. No direct correlation between phantom positioning error and pass rates overall. Conclusion: Significant differences were observed in the planning exercise for some plan and dose-volume parameters based on the TPS used. Standard evaluation criteria showed good agreement between planned and measured dose for all participants, however on an individual plan basis, diagnostic tests were able to identify contributing

  15. External quality-assurance results for the National Atmospheric Deposition Program/National Trends Network, 1997-99

    Science.gov (United States)

    Gordon, John D.; Latysh, Natalie E.; Lindholm, Sandy J.

    2003-01-01

    Five external quality-assurance programs were operated by the U.S. Geological Survey for the National Atmospheric Deposition Program/ National Trends Network (NADP/NTN) during 1997 through 1999: the intersite-comparison program, the blind-audit program, the field- audit program, the interlaboratory-comparison program, and the collocated-sampler program. The intersite-comparison program assesses the accuracy of pH and specific-conductance determinations made by NADP/NTN site operators. In two 1997 intersite-comparison studies, 83.7 and 85.8 percent of the pH determinations met the NADP/NTN accuracy goals, whereas 97.3 and 92.4 percent of the specific-conductance determinations met the NADP/NTN accuracy goals. The percentage of pH and specific-conductance determinations that met the accuracy goals in 1998 were, for the most part, higher than in 1997. In two 1998 studies, 90.9 and 90.3 percent of the pH determinations met the accuracy goals compared to 94.7 and 96.0 percent of the specific- conductance measurements meeting the accuracy goals. In one 1999 intersite-comparison study, 89.5 percent and 99.4 percent of pH and specific- conductance determinations, respectively, met the NADP/NTN accuracy goals. The blind-audit program evaluates the effects of routine sample handling, processing, and shipping on the analytical bias and precision of weekly precipitation samples. A portion of the blind-audit sample subject to the normal onsite handling and processing of a weekly precipitation sample is referred to as the bucket portion, whereas the portion receiving only minimal handling is referred to as the bottle portion. Positive bias in regard to blind-audit results indicates that the bucket portion has a higher concentration than the bottle portion. The paired t-test for the 1997 through 1999 blind- audit data indicates that routine sample handling, processing, and shipping introduced a positive bias (a=0.05) for calcium and chloride and a negative bias (cz=0.05) for

  16. External quality-assurance results for the National Atmospheric Deposition Program/National Trends Network, 1995-96

    Science.gov (United States)

    Gordon, John D.

    1999-01-01

    The U.S. Geological Survey operated four external quality-assurance programs for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN) in 1995 and 1996: the intersite-comparison program, the blind-audit program, the interlaboratory- comparison program, and the collocated-sampler program. The intersite-comparison program assessed the precision and bias of pH and specific-conductance determinations made by NADP/NTN site operators. The analytical bias introduced during routine handling, processing, and shipping of wet-deposition samples and precision of analyte values was estimated using a blind-audit program. An interlaboratory-comparison program was used to evaluate differences between analytical results and to estimate the analytical precision of five North American laboratories that routinely analyzed wet deposition. A collocated-sampler program estimated the precision of the overall precipitation collection and analysis system from initial sample collection through final storage of the data. Results of two intersite-comparison studies completed in 1995 indicated 94.6 and 94.4 percent of the onsite pH determinations met the NADP/NTN accuracy goals, whereas 97.2 and 98.3 percent of the specific-conductance determinations were within the established limits. The percentages of onsite determinations that met the accuracy goals in 1996 were slightly less for both pH and specific-conductance than in 1995. In 1996, 93.2 and 87.5 percent of onsite pH determinations met the accuracy goals, whereas the percentage of onsite specific-conductance measurements that met the goals was 93.9 and 94.9 percent.The blind audit program utilizes a paired sample design to evaluate the effects of routine sample handling, processing and shipping on the chemistry of weekly precipitation samples. The portion of the blind audit sample subject to all of the normal onsite handling and processing steps of a regular weekly precipitation sample is referred to as the bucket

  17. Engineering support services for the DOE/GRI coal gasification research program. Safety assurance study of high-Btu coal-gasification pilot plants and process development units

    Energy Technology Data Exchange (ETDEWEB)

    Bostwick, L.E.; Chen, R.G.; Coyle, D.A.; Ethridge, T.R.; Hubbard, D.A.; Scales, D.; Senules, E.A.; Shah, K.V.; Singer, D.L.; Smith, M.R.

    1981-04-01

    The purpose of this study was to identify risks and provide suggestions to improve and assure the safety of the high BTU coal gasification units (pilot plants and process development units) currently in the joint US Department of Energy and The Gas Research Institute (DOE/GRI) program. This was accomplished by performing a systematic detailed investigation of the gasifiers for each of the processes to identify operating conditions or equipment deficiences that could lead to potential hazards. This report documents the potential hazards identified to date. It is expected that the study will contribute to the improved safety aspect of larger scale production units by providing descriptions of the lessons learned. This safety assurance study involved a detailed systematic investigation of the gasifier area and related equipment of six different gasification units: Bell Aerosopace, BI-GAS, Exxon, Hygas, Rockwell and Westinghouse.

  18. GLYCOHEMOGLOBIN - COMPARISON OF 12 ANALYTICAL METHODS, APPLIED TO LYOPHILIZED HEMOLYSATES BY 101 LABORATORIES IN AN EXTERNAL QUALITY ASSURANCE PROGRAM

    NARCIS (Netherlands)

    WEYKAMP, CW; PENDERS, TJ; MUSKIET, FAJ; VANDERSLIK, W

    1993-01-01

    Stable lyophilized ethylenediaminetetra-acetic acid (EDTA)-blood haemolysates were applied in an external quality assurance programme (SKZL, The Netherlands) for glycohaemoglobin assays in 101 laboratories using 12 methods. The mean intralaboratory day-to-day coefficient of variation (CV), calculate

  19. Assurance of Learning in an MBA Program: Exploration of the Value Added by the Graduate Major Field Test in Business

    Science.gov (United States)

    Kass, Darrin; Grandzol, Christian

    2014-01-01

    The use of standardized tests as a piece of outcomes assessment has risen in recent years in order to satisfy external accrediting bodies such as the Association to Advance Collegiate Schools of Business International. The authors explore the value added by the Graduate Major Field Test in Business (GMFT-B) for assurance of learning in a master of…

  20. The successful Chief Executive Officer understands quality assurance

    International Nuclear Information System (INIS)

    The successful Chief Executive Officer (CEO) will have recognized the benefits of, and have implemented, a total quality assurance program. The quality assurance program will be adequately defined in policies and procedures such that managers and supervisors of each organizational element understand their primary and supporting roles in carrying out an effective quality assurance program. The traditional practice of having all quality assurance activities reside in a quality assurance organization will have been cast aside. Instead, the quality assurance activities necessary to achieve and assure the quality of the desired end product will have been defined and assigned to responsible organization elements. The quality assurance organization's primary role will be to define the total quality assurance program, insure that the achieving and assuring functions are assigned in policies and procedures, conduct training necessary to have management and supervisors understand the total quality assurance program, measure the effectiveness of the program and feedback measurement data for improvements in the program. The successful CEO will have implemented a quality assurance program that provides for a graded approach for application of the program based upon the importance of the intended use of the product or service. The successful CEO will rely heavily on the scheduled progress reports and assessments to measure the pulse of his organization's successes and improvement needs. This paper will describe suggested approaches for the Quality Assurance Manager to implement a quality assurance program which results in his corporation's CEO being a supporter of and a driving force in the implementation of the quality assurance program

  1. Solar consumer assurance network briefing book

    Energy Technology Data Exchange (ETDEWEB)

    Connor, Lynda

    1980-06-01

    Background information is provided on the rationale and purpose of the Solar Consumer Assurance Network (SOLCAN) program. Mechanisms being instituted by states to meet solar consumer assurance needs are identified. Mechanisms being developed with Federal government support to encourage solar consumer assurance activities are described. The operation of the FY 80 SOLCAN effort is described. (MHR)

  2. 10 CFR 76.93 - Quality assurance.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance. 76.93 Section 76.93 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) CERTIFICATION OF GASEOUS DIFFUSION PLANTS Safety § 76.93 Quality assurance. The Corporation shall establish, maintain, and execute a quality assurance program satisfying each...

  3. 10 CFR 26.137 - Quality assurance and quality control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Quality assurance and quality control. 26.137 Section 26....137 Quality assurance and quality control. (a) Quality assurance program. Each licensee testing facility shall have a quality assurance program that encompasses all aspects of the testing...

  4. Measurement quality assurance

    International Nuclear Information System (INIS)

    The quality of a radiation protection program can be no better than the quality of the measurements made to support it. In many cases, that quality is unknown and is merely implied on the basis of a calibration of a measuring instrument. If that calibration is inappropriate or is performed improperly, the measurement result will be inaccurate and misleading. Assurance of measurement quality can be achieved if appropriate procedures are followed, including periodic quality control actions that demonstrate adequate performance. Several national measurement quality assurance (MQA) programs are operational or under development in specific areas. They employ secondary standards laboratories that provide a high-quality link between the National Bureau of Standards and measurements made at the field use level. The procedures followed by these secondary laboratories to achieve MQA will be described, as well as plans for similar future programs. A growing general national interest in quality assurance, combined with strong specific motivations for MQA in the area of ionizing radiation, will provide continued demand for appropriate national programs. Such programs must, however, employ procedures that are cost effective and must be developed with participation by all affected parties

  5. Directory of certificates of compliance for radioactive materials packages. Volume 3, revision 1. Summary report of NRC approved quality assurance programs for radioactive material packages

    International Nuclear Information System (INIS)

    The directory contains a Summary Report of NRC approved Packages (Volume 1), Certificates of Compliance (Volume 2), and a Summary Report of NRC Approved Quality Assurance Programs for Radioactive Material Packages (Volume 3). The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the U.S. Nuclear Regulatory Commission. To assist in identifying packaging, and index by Model Number and corresponding Certificate of Compliance number is included at the back of each volume of the directory. The Summary Report includes a listing of all users of each package design prior to the publication date of the directory

  6. Establishing a quality assurance program for in-core fuel management of the Dalat Nuclear Research Reactor using low enriched fuel

    International Nuclear Information System (INIS)

    Quality assurance program for calculating of in-core fuel management of research reactor plays very important role in safety operation and effective utilization. The main objective of the program is to ensure the safe, reliable and optimum use of nuclear fuel and to meet the reactor utilization, which remains reactor operation within the limits imposed by the design safety considerations and the operational limits and conditions (OLCs) on the basis of safety analysis. The management of reactor core and nuclear fuel must be organized in a coherent way and comply with safety requirements. After successfully converting from HEU to LEU fuel for Dalat Research Reactor, a work to be in place is to study and implement the management of reactor core and nuclear fuel. This not only helps to ensure safety operation and efficient utilization but also contributes to build the safety culture and to be valuable experience for other nuclear projects. In addition, the application of the quality assurance program for in-core fuel management will contribute to avoid subjective mistakes, to clearly define responsibilities and to ensure legacy of expertise, which is also an urgent requirement. The selected computer code systems, data libraries and computation models must be fully met the requirements for analyzing status and characteristics of reactor core as well as the requirements for selecting, verifying and evaluating according to the regulations of the IAEA. (author)

  7. Quality Assurance for Consumers of Private Training Programs. Findings and Recommendations from the Consultation on the Regulation and Support of Training Providers in New Brunswick = Assurance de la qualite pour les consommateurs de programmes de formation du secteur prive. Resultats et recommandations a la suite des consultations relativement a la reglementation et au soutien des fournisseurs de cours de formation au Nouveau-Brunswick.

    Science.gov (United States)

    New Brunswick Labour Force Development Board, Fredericton.

    Eighteen key individuals from the business, labor, and training sectors and other organizations concerned with the purchase of private training programs were consulted in an effort to determine the role of Canada's federal government and New Brunswick's provincial government in quality assurance for consumers of private training programs. There…

  8. QA (Quality Assurance) role in advanced energy activities: Towards an /open quotes/orthodox/close quotes/ Quality Program: Canonizing the traditions at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Bodnarczuk, M.W.

    1988-02-01

    After a brief description of the goal of Fermi National Accelerator Laboratory (Fermilab) this paper poses and answers three questions related to Quality Assurance (QA) at the Laboratory. First, what is the difference between 'orthodox' and 'unorthodox' QA and is there a place for 'orthodox' QA at a laboratory like Fermilab. Second, are the deeper philosophical and cultural frameworks of high-energy physics acommodating or antagonistic to an 'orthodox' QA Program. Finally, faced with the task of developing an institutional QA program for Fermilab where does one begin. The paper is based on experience with the on-going development and implementation of an institutional QA Program at Fermilab. 10 refs.

  9. Directory of Certificates of Compliance for Radioactive-Materials Packages. Summary report of NRC approved quality assurance programs for radioactive material packages

    International Nuclear Information System (INIS)

    This directory contains a Summary Report of the US Nuclear Regulatory Commission's Approved Packages (Volume I), all Certificates of Compliance (Volume 2), and Summary Report of NRC Approved Quality Assurance Programs (Volume 3) for Radioactive Material Packages effective December 31, 1982. The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the back of Volumes 1 and 2 of the directory. A listing by packaging types is included in the back of Volume 2. An alphabetical listing by Company name is included in the back of Volume 3 for approved QA programs. The Summary Reports include a listing of all users of each package design and approved QA programs prior to the publication date of the directory

  10. Teacher Reaction to ICP Quality Assurance Procedures.

    Science.gov (United States)

    Leonard, Ann

    An integral part of the Quality Assurance Manual developed by Southwest Regional Laboratory (SWRL) to accompany the Kindergarten Program is the end-of-program assessment of the Instructional Concepts Program (ICP). Following completion of ICP Quality Assurance assessment, four teachers were interviewed in order to gather information pertinent to…

  11. Nova laser assurance-management system

    International Nuclear Information System (INIS)

    In a well managed project, Quality Assurance is an integral part of the management activities performed on a daily basis. Management assures successful performance within budget and on schedule by using all the good business, scientific, engineering, quality assurance, and safety practices available. Quality assurance and safety practices employed on Nova are put in perspective by integrating them into the overall function of good project management. The Nova assurance management system was developed using the quality assurance (QA) approach first implemented at LLNL in early 1978. The LLNL QA program is described as an introduction to the Nova assurance management system. The Nova system is described pictorially through the Nova configuration, subsystems and major components, interjecting the QA techniques which are being pragmatically used to assure the successful completion of the project

  12. Directory of certificates of compliance for radioactive materials packages: summary report of NRC approved quality-assurance programs for radioactive-material packages. Volume 3, Revision 3

    International Nuclear Information System (INIS)

    This directory contains a Summary Report of NRC Approved Packages (Volume 1), Certificates of Compliance (Volume 2), and a Summary Report of NRC Approved Quality Assurance Programs for Radioactive Material Packages (Volume 3). The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance number is included at the back of each volume of the directory. The Summary Report includes a listing of all users of each package design prior to the publication date of the directory. Shipments of radioactive material utilizing these packagings must be in accordance with the provisions of 49 CFR 173.471 and 10 CFR Part 71, as applicable. In satisfying the requirements of Section 71.12, it is the responsibility of the licensees to insure them in accordance with an NRC approved quality assurance program. Copies of the current approval may be obtained from the US Nuclear Regulatory Commission Public Document Room files (see Docket No. listed on each certificate) at 1717 H Street, Washington, DC 20555. Note that the general license of 10 CFR 71.12 does not authorize the receipt, possession, use or transfer of byproduct source, or special nuclear material; such authorization must be obtained pursuant to 10 CFR Parts 30 to 36, 40, 50, or 70

  13. Directory of certificates of compliance for radioactive materials packages. Summary report of NRC approved quality assurance programs for radioactive material packages. Volume 3, Revision 4

    International Nuclear Information System (INIS)

    This directory contains a Summary Report of NRC Approved Packages (Volume 1), Certificates of Compliance (Volume 2), and a Summary Report of NRC Approved Quality Assurance Programs for Radioactive Material Packages (Volume 3). The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance number is included at the back of each volume of the directory. The Summary Report includes a listing of all users of each package design prior to the publication date of the directory. Shipments of radioactive material utilizing these packagings must be in accordance with the provisions of 49 CFR 173.471 and 10 CFR Part 71, as applicable. In satisfying the requirements of Section 71.12, it is the responsibility of the licensees to insure they have a copy of the current approval and conduct their transportation activities in accordance with an NRC approved quality assurance program. Copies of the current approval may be obtained from the US Nuclear Regulatory Commission Public Document Room files (see Docket No. listed on each certificate) at 1717 H Street, Washington, DC 20555. Note that the general license of 10 CFR 71.12 does not authorize the receipt, possession, use or transfer of byproduct source, or special nuclear material; such authorization must be obtained pursuant to 10 CFR Parts 30 to 36, 40, 50, or 70

  14. Guidelines for the processing and quality assurance of benthic invertebrate samples collected as part of the National Water-Quality Assessment Program

    Science.gov (United States)

    Cuffney, T.F.; Gurtz, M.E.; Meador, M.R.

    1993-01-01

    Benthic invertebrate samples are collected as part of the U.S. Geological Survey's National Water-Quality Assessment Program. This is a perennial, multidisciplinary program that integrates biological, physical, and chemical indicators of water quality to evaluate status and trends and to develop an understanding of the factors controlling observed water quality. The Program examines water quality in 60 study units (coupled ground- and surface-water systems) that encompass most of the conterminous United States and parts of Alaska and Hawaii. Study-unit teams collect and process qualitative and semi-quantitative invertebrate samples according to standardized procedures. These samples are processed (elutriated and subsampled) in the field to produce as many as four sample components: large-rare, main-body, elutriate, and split. Each sample component is preserved in 10-percent formalin, and two components, large-rare and main-body, are sent to contract laboratories for further processing. The large-rare component is composed of large invertebrates that are removed from the sample matrix during field processing and placed in one or more containers. The main-body sample component consists of the remaining sample materials (sediment, detritus, and invertebrates) and is subsampled in the field to achieve a volume of 750 milliliters or less. The remaining two sample components, elutriate and split, are used for quality-assurance and quality-control purposes. Contract laboratories are used to identify and quantify invertebrates from the large-rare and main-body sample components according to the procedures and guidelines specified within this document. These guidelines allow the use of subsampling techniques to reduce the volume of sample material processed and to facilitate identifications. These processing procedures and techniques may be modified if the modifications provide equal or greater levels of accuracy and precision. The intent of sample processing is to

  15. Quality assurance during site construction

    International Nuclear Information System (INIS)

    During the time of planing and construction of a nuclear power plant, the following proceeding is approved: - the deliverer of a nuclear power plant provides the reports fixing the quality assurance program, it means that he is responsible to write the safety analysis report, the specifications for the erection of the components, the working manuals and specifications for testing (eg nondestr. testing) - the manufacturing of components or systems will be controlled by an own independent quality assurance group, provided that this group was checked by the quality assurance group of the applicant - the TUeV with its independent assessors will fix the requirements relating to quality assurance in its assessment. On this basis the examination of the applicants specifications, working manuals, testing specifications will be done. The efficiency of quality assurance at the manufacturer and at the applicant will be checked by the TUeV specialists by considering specifications of modifications, repairs or tolerances. A mean point of the quality assurance in Germany is the dynamic adjustment, of an action on the latest state of engineering or science. If there exists a change of rules or guidelines, the quality assurance requirements have to be fit on this state in so far as it is feasible from the technical point of view. (orig./RW)

  16. An Application Example Analysis of Quality Assurance Program for STELLA(Sodium Integral Effect Test Loop for Safety Simulation and Assessment) Project

    International Nuclear Information System (INIS)

    KAERI has been conducting various basic R and D activities in the field of nuclear technology. In addition, KAERI is now participating in the Generation IV International Forum (GIF), preparing for the development of key technologies for Generation IV nuclear energy system, including Sodium cooled Fast Reactor (SFR) development. All of the key technologies for SFR development need an appropriate level of QA activities to achieve the GIF safety and performance objectives. Therefore, QA activities have been conducted as an essential part of the national SFR project. As a result, QAM (Quality Assurance Manual) and QAP (Quality Assurance Procedures) have been developed for the SFR project, which are based on ASME NQA-1, KEPIC QAP and the GIF Quality Management System Guidelines. In this work, the introduction background and application examples of the QA program for the STELLA project were investigated. Application of the QA for the STELLA project has great significance because the QA has been mainly applied for the nuclear power plant area in operation, which helps ensure the reliability of the test data and completeness of the research performance. Nevertheless, developing more appropriate QA procedures remains a major task because some parts of them are not applicable to the Na-experiment

  17. U.S. Geological Survey external quality-assurance project report to the National Atmospheric Deposition Program / National Trends Network and Mercury Deposition Network, 2007-08

    Science.gov (United States)

    Wetherbee, Gregory A.; Latysh, Natalie E.; Chesney, Tanya A.

    2010-01-01

    The U.S. Geological Survey (USGS) used six distinct programs to provide external quality-assurance monitoring for the National Atmospheric Deposition Program / National Trends Network (NTN) and Mercury Deposition Network (MDN) during 2007-08. The field-audit program assessed the effects of onsite exposure, sample handling, and shipping on the chemistry of NTN samples, and a system-blank program assessed the same effects for MDN. Two interlaboratory-comparison programs assessed the bias and variability of the chemical analysis data from the Central Analytical Laboratory (CAL), Mercury (Hg) Analytical Laboratory (HAL), and 12 other participating laboratories. A blind-audit program was also implemented for the MDN to evaluate analytical bias in HAL total Hg concentration data. A co-located-sampler program was used to identify and quantify potential shifts in NADP data resulting from replacement of original network instrumentation with new electronic recording rain gages (E-gages) and prototype precipitation collectors. The results indicate that NADP data continue to be of sufficient quality for the analysis of spatial distributions and time trends of chemical constituents in wet deposition across the U.S. NADP data-quality objectives continued to be achieved during 2007-08. Results also indicate that retrofit of the NADP networks with the new E-gages is not likely to create step-function type shifts in NADP precipitation-depth records, except for sites where annual precipitation depth is dominated by snow because the E-gages tend to catch more snow than the original NADP rain gages. Evaluation of prototype precipitation collectors revealed no difference in sample volumes and analyte concentrations between the original NADP collectors and modified, deep-bucket collectors, but the Yankee Environmental Systems, Inc. (YES) collector obtained samples of significantly higher volumes and analyte concentrations than the standard NADP collector.

  18. External quality-assurance project report for the National Atmospheric Deposition Program/National Trends Network and Mercury Deposition Network, 2009-2010

    Science.gov (United States)

    Wetherbee, Gregory A.; Martin, RoseAnn; Rhodes, Mark F.; Chesney, Tanya A.

    2014-01-01

    The U.S. Geological Survey operated six distinct programs to provide external quality-assurance monitoring for the National Atmospheric Deposition Program/National Trends Network (NTN) and Mercury Deposition Network (MDN) during 2009–2010. The field-audit program assessed the effects of onsite exposure, sample handling, and shipping on the chemistry of NTN samples; a system-blank program assessed the same effects for MDN. Two interlaboratory-comparison programs assessed the bias and variability of the chemical analysis data from the Central Analytical Laboratory (CAL) and Mercury (Hg) Analytical Laboratory (HAL). The blind-audit program was also implemented for the MDN to evaluate analytical bias in total Hg concentration data produced by the HAL. The co-located-sampler program was used to identify and quantify potential shifts in NADP data resulting from replacement of original network instrumentation with new electronic recording rain gages (E-gages) and precipitation collectors that use optical sensors. The results indicate that NADP data continue to be of sufficient quality for the analysis of spatial distributions and time trends of chemical constituents in wet deposition across the United States. Results also suggest that retrofit of the NADP networks with the new precipitation collectors could cause –8 to +14 percent shifts in NADP annual precipitation-weighted mean concentrations and total deposition values for ammonium, nitrate, sulfate, and hydrogen ion, and larger shifts (+13 to +74 percent) for calcium, magnesium, sodium, potassium, and chloride. The prototype N-CON Systems bucket collector is more efficient in the catch of precipitation in winter than Aerochem Metrics Model 301 collector, especially for light snowfall.

  19. A novel compound 6D-offset simulating phantom and quality assurance program for stereotactic image-guided radiation therapy system.

    Science.gov (United States)

    Yuen Kan Ngar, Dennis; Lok-Man Cheung, Michael; Koon-Ming Kam, Michael; Poon, Wai-Sang; Tak-Cheung Chan, Anthony

    2013-01-01

    A comprehensive quality assurance (QA) device cum program was developed for the commissioning and routine testing of the 6D IGRT systems. In this article, both the new QA system and the BrainLAB IGRT system which was added onto a Varian Clinac were evaluated. A novel compound 6D-offset simulating phantom was designed and fabricated in the Prince of Wales Hospital (PWH), Hong Kong. The QA program generated random compound 6D-offset values. The 6D phantom was simply set up and shifted accordingly. The BrainLAB ExacTrac X-ray IGRT system detected the offsets and then corrected the phantom position automatically through the robotic couch. Routine QA works facilitated data analyses of the detection errors, the correction errors, and the correlations. Fifty sets of data acquired in 2011 in PWH were thoroughly analyzed. The 6D component detection errors and correction errors of the IGRT system were all within ± 1 mm and ± 1° individually. Translational and rotational scalar resultant errors were found to be 0.50 ± 0.27 mm and 0.54 ± 0.23°, respectively. Most individual component errors were shown to be independent of their original offset values. The system characteristics were locally established. The BrainLAB 6D IGRT system added onto a regular linac is sufficiently precise for stereotactic RT. This new QA methodology is competent to assure the IGRT system overall integrity. Annual grand analyses are recommended to check local system consistency and for external cross comparison. The target expansion policy of 1.5 mm 3D margin from CTV to PTV is confirmed for this IGRT system currently in PWH. PMID:24257294

  20. Quality-assurance study of the special - purpose finite-element program - SPECTROM: I. Thermal, thermoelastic, and viscoelastic problems

    International Nuclear Information System (INIS)

    This comparison study involves a preliminary verification of finite element calculations. The methodology of the comparison study consists of solving four example problems with both the SPECTROM finite element program and the MARC-CDC general purpose finite element program. The results show close agreement for all example problems

  1. Quality Assurance - Construction

    DEFF Research Database (Denmark)

    Gaarslev, Axel

    1996-01-01

    Gives contains three main chapters:1. Quality Assurance initiated by external demands2. Quality Assurance initiated by internal company goals3. Innovation strategies......Gives contains three main chapters:1. Quality Assurance initiated by external demands2. Quality Assurance initiated by internal company goals3. Innovation strategies...

  2. GSFC Safety and Mission Assurance Organization

    Science.gov (United States)

    Kelly, Michael P.

    2010-01-01

    This viewgraph presentation reviews NASA Goddard Space Flight Center's approach to safety and mission assurance. The contents include: 1) NASA GSFC Background; 2) Safety and Mission Assurance Directorate; 3) The Role of SMA-D and the Technical Authority; 4) GSFC Mission assurance Requirements; 5) GSFC Systems Review Office (SRO); 6) GSFC Supply Chain Management Program; and 7) GSFC ISO9001/AS9100 Status Brief.

  3. Introduction to quality assurance

    International Nuclear Information System (INIS)

    In today's interpretation 'quality assurance' means 'good management'. Quality assurance has to cover all phases of a work, but all quality assurance measures must be adapted to the relevance and complexity of the actual task. Examples are given for the preparation of quality classes, the organization of quality assurance during design and manufacturing and for auditing. Finally, efficiency and limits of quality assurance systems are described. (orig.)

  4. An analysis of current and former mathematics and science teacher education program participants' perceptions for quality assurance

    Science.gov (United States)

    Williams-Duncan, Omah Makebbe

    State curriculum and professional standards characterize the level of proficiency pre-service teachers must attain to be prepared to teach in Texas classrooms. Teacher education programs are being scrutinized for their ability to help pre-service teachers reach a level of proficiency commensurate with these state standards. This dissertation presents an understanding of a teacher education program's quality via analysis of its current student teacher and former student perceptions. There are two participant groups in this study - current student teachers (n=11) and former students (n=78) from one program called, aggieTEACH, a traditional baccalaureate secondary mathematics and science teacher education program. Of the current student teachers and former students participating in this study, 77.5% (n = 69) were female, 21.3% (n = 19) were male and 1.1% (n = 1) did not disclose their gender; additionally, 80.9% (n = 72) identify as white or Caucasian, 9% (n = 8) identify as Hispanic, 7.8% (n = 7) identifying as African American, Asian, or other, and 2.2% (n = 2) decided not to disclose their race. This mixed methods study reveals participant's agreement and confidence levels in mentoring, confidence, TEP quality, and program characteristics of aggieTEACH. The researcher used principal components analysis, exploratory factor analysis, and content analysis to review secondary data from administered web-based surveys. The surveys have Likert-scaled, single-response items and open-ended response items. Specific survey items were identified per categories called (a) mentoring, (b) confidence, (c) TEP quality, and (d) program characteristics. The mentoring scale yielded an alpha of .903. The confidence subscale yielded an alpha .951. The quality items yielded an alpha .881 and the characteristics items yielded an alpha of .919. Significant differences occurred between current student teacher and former student participants' agreement and confidence levels about the teacher

  5. Training, Quality Assurance Factors, and Tools Investigation: a Work Report and Suggestions on Software Quality Assurance

    Science.gov (United States)

    Lee, Pen-Nan

    1991-01-01

    Previously, several research tasks have been conducted, some observations were obtained, and several possible suggestions have been contemplated involving software quality assurance engineering at NASA Johnson. These research tasks are briefly described. Also, a brief discussion is given on the role of software quality assurance in software engineering along with some observations and suggestions. A brief discussion on a training program for software quality assurance engineers is provided. A list of assurance factors as well as quality factors are also included. Finally, a process model which can be used for searching and collecting software quality assurance tools is presented.

  6. Development of a postal dosimetric system for quality assurance programs in radiotherapy using fotons beams in non references conditions

    CERN Document Server

    Marin, A

    2003-01-01

    In radiotherapy, to cure the primary tumor, the absorbed dose delivered at the target volume should have an accuracy better than +- 5%. As the basic aim in radiotherapy is the eradication of the primary tumor with the smallest possible damage to the health tissues, it is necessary to guarantee that the dose delivered to the patient in different depths and treatment configurations has the right accuracy. For this reason, a quality control program should be carried out by regulatory and national standardization programs including postal evaluation of the beam dosimetry are also necessary. Since many years Brazil is running a postal quality control program in radiotherapy in reference conditions, Nevertheless it should be increased to include also measurements in non reference conditions. In this paper we present a new dosimetric postal system using thermoluminescent dosimeters (TLD-100 in powder) for photon beams quality control in radiotherapy, in non reference conditions. This system has been checked and appl...

  7. Quality assurance and quality control data validation procedures used for the Love Canal and Dallas lead soil monitoring programs.

    Science.gov (United States)

    Brown, K W; Black, S C

    1983-06-01

    Public awareness of soils contamination has increased in recent years due in part to the notoriety associated with the indiscriminate release, packaging, transporting and disposal of hazardous materials. In 1980, and again in 1982, the U.S. Environmental Protection Agency (EPA) was responsible for designing, implementing and conducting environmental monitoring programs at Love Canal in Niagara Falls, New York, and in Dallas, Texas, that dealt with suspected contaminated soils. Both of these monitoring programs were conducted over a relatively short time with the collection and analysis of over 4000 soil samples. The methods employed by the Environmental Protection Agency for providing soil data that was scientifically valid and of defensible quality for each of these monitoring programs are presented. Also, methods for identifying data bias, its precision and its uncertainty are identified.

  8. Directory of certificates of compliance for radioactive materials packages: Report of NRC approved quality assurance programs for radioactive materials packages

    International Nuclear Information System (INIS)

    The purpose of this directory is to make available a convenient source of information on packaging which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the front of Volume 2 of the directory. A listing by packaging types is included in the back of Volume 2. An alphabetical listing by Company name is included in the back of Volume 3 for approved QA programs. The Reports include a listing of all users of each package design and approved QA programs prior to the publication date of the directory

  9. Directory of certificates of compliance for radioactive materials packages: Report of NRC approved quality assurance programs for radioactive materials packages

    International Nuclear Information System (INIS)

    The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of compliance Number is included at the front of Volume 2 of the directory. A listing by packaging types is included in the back of Volume 2. An alphabetical listing by Company name is included in the back of Volume 3 for approved QA programs. The Reports include a listing of all users of each package design and approved QA programs prior to the publication date of the directory

  10. 7 CFR 90.102 - Quality assurance review.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) COMMODITY LABORATORY TESTING PROGRAMS INTRODUCTION Quality Assurance § 90.102 Quality assurance review. (a) Each laboratory performing tests...

  11. Implementation of a program of quality assurance of image in an imaging system of flat panel portal; Puesta en marcha de un programa de garantia de calidad de imagen en un sistema de imagen portal de panel plano

    Energy Technology Data Exchange (ETDEWEB)

    Gomez Barrado, A.; Sanchez Jimenez, E.; Benitez, J. A.; Sanchez-Reyes, A.

    2013-07-01

    (IGRT) image-guided radiation therapy is the one in which images are used to locate the area of treatment. Modern irradiation systems are equipped with different modalities for obtaining images, such as flat panel systems, systems conebeam, tomoimagen, etc. This paper describes the start-up and the experience of a quality assurance program based on a flat panel portal Imaging System. (Author)

  12. Software Assurance Using Structured Assurance Case Models

    OpenAIRE

    Rhodes, Thomas; Boland, Frederick; Fong, Elizabeth; Kass, Michael

    2010-01-01

    Software assurance is an important part of the software development process to reduce risks and ensure that the software is dependable and trustworthy. Software defects and weaknesses can often lead to software errors and failures and to exploitation by malicious users. Testing, certification and accreditation have been traditionally used in the software assurance process to attempt to improve software trustworthiness. In this paper, we examine a methodology known as a structured assurance mo...

  13. Quality assurance in individual monitoring

    International Nuclear Information System (INIS)

    Measurement and assessment of radiation dose to the individual radiation worker, called 'Individual monitoring', is one of the most important aspects of radiation protection. International Commission on Radiation Protection (ICRP-75) has outlined three main objectives of personal monitoring viz assessment of the effectively equivalent dose to demonstrate compliance with managerial and regulatory requirements; to contribute to control of operation and design of facilities and in case of accidental overexposure, to provide valuable information for the initiation and support of any health surveillance and treatment. To meet these objectives, it is essential that the measurements are reliable and accurate as defined by National and International Standards. This requires setting up of well defined internal as well as external quality assurance protocol in the individual monitoring program. External quality assurance program is meant to provide a reliable and qualitative as well as quantitative assessment of the service provided by the service provider. In India, individual monitoring is based on CaSO4:Dy based TLD badge and the task of conducting external quality assurance (QA) is being performed by RP and AD, Bhabha Atomic Research Centre. The paper presents the methodology of Quality assurance, Performance evaluation standards and criteria. It discusses the results and important observations of last few QA cycles conducted for all the TLD Labs. The quality assurance check has indicated that the performance of all the Labs is satisfactory in accordance with ANSI as well as Trumpet curve methodology. It provided feedback on further improvements in the quality

  14. 78 FR 5813 - 2013 Assuring Radiation Protection

    Science.gov (United States)

    2013-01-28

    ... HUMAN SERVICES Food and Drug Administration 2013 Assuring Radiation Protection AGENCY: Food and Drug... protection program. The goal of the 2013 Assuring Radiation Protection will be to coordinate Federal, State... radiation protection. The recipient will establish committees, in accordance with Federal statutes...

  15. Implementation of Good Clinical Laboratory Practice (GCLP) guidelines within the External Quality Assurance Program Oversight Laboratory (EQAPOL)

    OpenAIRE

    Todd, Christopher A.; Sanchez, Ana M.; Garcia, Ambrosia; Thomas N Denny; Sarzotti-Kelsoe, Marcella

    2013-01-01

    The EQAPOL contract was awarded to Duke University to develop and manage global proficiency testing programs for flow cytometry-, ELISpot-, and Luminex bead-based assays (cytokine analytes), as well as create a genetically diverse panel of HIV-1 viral cultures to be made available to National Institutes of Health (NIH) researchers. As a part of this contract, EQAPOL was required to operate under Good Clinical Laboratory Practices (GCLP) that are traditionally used for laboratories conducting ...

  16. Separation Assurance and Collision Avoidance

    Science.gov (United States)

    Lauderdale, Todd

    2010-01-01

    Objective SACA-1: Determine the level of safety provided by tactical separation assurance safety monitoring systems for UAS missions. a) Rationale: Continuous mission-risk monitoring can provide equivalent levels of safety for UAS operations possibly reducing the burden on other safety systems. b) Approach: Utilize and adapt algorithms and approaches developed for the NextGen Airspace Systems Program for UAS applications.

  17. Waste Management Quality Assurance Plan

    Energy Technology Data Exchange (ETDEWEB)

    Waste Management Group

    2006-08-14

    The WMG QAP is an integral part of a management system designed to ensure that WMG activities are planned, performed, documented, and verified in a manner that assures a quality product. A quality product is one that meets all waste acceptance criteria, conforms to all permit and regulatory requirements, and is accepted at the offsite treatment, storage, and disposal facility. In addition to internal processes, this QA Plan identifies WMG processes providing oversight and assurance to line management that waste is managed according to all federal, state, and local requirements for waste generator areas. A variety of quality assurance activities are integral to managing waste. These QA functions have been identified in the relevant procedures and in subsequent sections of this plan. The WMG QAP defines the requirements of the WMG quality assurance program. These requirements are derived from Department of Energy (DOE) Order 414.1C, Quality Assurance, Contractor Requirements Document, the LBNL Operating and Assurance Program Plan (OAP), and other applicable environmental compliance documents. The QAP and all associated WMG policies and procedures are periodically reviewed and revised, as necessary, to implement corrective actions, and to reflect changes that have occurred in regulations, requirements, or practices as a result of feedback on work performed or lessons learned from other organizations. The provisions of this QAP and its implementing documents apply to quality-affecting activities performed by the WMG; WMG personnel, contractors, and vendors; and personnel from other associated LBNL organizations, except where such contractors, vendors, or organizations are governed by their own WMG-approved QA programs.

  18. Waste Management Quality Assurance Plan

    International Nuclear Information System (INIS)

    The WMG QAP is an integral part of a management system designed to ensure that WMG activities are planned, performed, documented, and verified in a manner that assures a quality product. A quality product is one that meets all waste acceptance criteria, conforms to all permit and regulatory requirements, and is accepted at the offsite treatment, storage, and disposal facility. In addition to internal processes, this QA Plan identifies WMG processes providing oversight and assurance to line management that waste is managed according to all federal, state, and local requirements for waste generator areas. A variety of quality assurance activities are integral to managing waste. These QA functions have been identified in the relevant procedures and in subsequent sections of this plan. The WMG QAP defines the requirements of the WMG quality assurance program. These requirements are derived from Department of Energy (DOE) Order 414.1C, Quality Assurance, Contractor Requirements Document, the LBNL Operating and Assurance Program Plan (OAP), and other applicable environmental compliance documents. The QAP and all associated WMG policies and procedures are periodically reviewed and revised, as necessary, to implement corrective actions, and to reflect changes that have occurred in regulations, requirements, or practices as a result of feedback on work performed or lessons learned from other organizations. The provisions of this QAP and its implementing documents apply to quality-affecting activities performed by the WMG; WMG personnel, contractors, and vendors; and personnel from other associated LBNL organizations, except where such contractors, vendors, or organizations are governed by their own WMG-approved QA programs

  19. Set up and programming of an ALICE Time-Of-Flight trigger facility and software implementation for its Quality Assurance (QA) during LHC Run 2

    CERN Document Server

    Toschi, Francesco

    2016-01-01

    The Cosmic and Topology Trigger Module (CTTM) is the main component of a trigger based on the ALICE TOF detector. Taking advantage of the TOF fast response, this VME board implements the trigger logic and delivers several L0 trigger outputs, used since Run 1, to provide cosmic triggers and rare triggers in pp, p+Pb and Pb+Pb data taking. Due to TOF DCS architectural change of the PCs controlling the CTTM (from 32 bits to 64 bits) it is mandatory to upgrade the software related to the CTTM including the code programming the FPGA firmware. A dedicated CTTM board will be installed in a CERN lab (Meyrin site), with the aim of recreating the electronics chain of the TOF trigger, to get a comfortable porting of the code to the 64 bit environment. The project proposed to the summer student is the setting up of the CTTM and the porting of the software. Moreover, in order to monitor the CTTM Trigger board during the real data taking, the implementation of a new Quality Assurance (QA) code is also crucial, together wit...

  20. Quality assurance in a large research and development laboratory

    International Nuclear Information System (INIS)

    Developing a quality assurance program for a large research and development laboratory provided a unique opportunity for innovative planning. The quality assurance program that emerged has been tailored to meet the requirements of several sponsoring organizations and contains the flexibility for experimental programs ranging from large engineering-scale development projects to bench-scale basic research programs

  1. Multinational Quality Assurance

    Science.gov (United States)

    Kinser, Kevin

    2011-01-01

    Multinational colleges and universities pose numerous challenges to the traditional models of quality assurance that are designed to validate domestic higher education. When institutions cross international borders, at least two quality assurance protocols are involved. To guard against fraud and abuse, quality assurance in the host country is…

  2. Computer software quality assurance

    International Nuclear Information System (INIS)

    The author defines some criteria for the evaluation of software quality assurance elements for applicability to the regulation of the nuclear industry. The author then analyses a number of software quality assurance (SQA) standards. The major extracted SQA elements are then discussed, and finally specific software quality assurance recommendations are made for the nuclear industry

  3. Quality assurance programs developed and implemented by the US Department of Energy`s Analytical Services Program for environmental restoration and waste management activities

    Energy Technology Data Exchange (ETDEWEB)

    Lillian, D.; Bottrell, D. [Dept. of Energy, Germntown, MD (United States)

    1993-12-31

    The U.S. Department of Energy`s (DOE`s) Office of Environmental Restoration and Waste Management (EM) has been tasked with addressing environmental contamination and waste problems facing the Department. A key element of any environmental restoration or waste management program is environmental data. An effective and efficient sampling and analysis program is required to generate credible environmental data. The bases for DOE`s EM Analytical Services Program (ASP) are contained in the charter and commitments in Secretary of Energy Notice SEN-13-89, EM program policies and requirements, and commitments to Congress and the Office of Inspector General (IG). The Congressional commitment by DOE to develop and implement an ASP was in response to concerns raised by the Chairman of the Congressional Environment, Energy, and Natural Resources Subcommittee, and the Chairman of the Congressional Oversight and Investigations Subcommittee of the Committee on Energy and Commerce, regarding the production of analytical data. The development and implementation of an ASP also satisfies the IG`s audit report recommendations on environmental analytical support, including development and implementation of a national strategy for acquisition of quality sampling and analytical services. These recommendations were endorsed in Departmental positions, which further emphasize the importance of the ASP to EM`s programs. In September 1990, EM formed the Laboratory Management Division (LMD) in the Office of Technology Development to provide the programmatic direction needed to establish and operate an EM-wide ASP program. In January 1992, LMD issued the {open_quotes}Analytical Services Program Five-Year Plan.{close_quotes} This document described LMD`s strategy to ensure the production of timely, cost-effective, and credible environmental data. This presentation describes the overall LMD Analytical Services Program and, specifically, the various QA programs.

  4. 44 CFR 7.9 - Assurances from institutions.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Assurances from institutions...) Nondiscrimination in FEMA-Assisted Programs-General § 7.9 Assurances from institutions. (a) In the case of any application for Federal financial assistance to an institution of higher education, the assurance required...

  5. Quality assurance for health and environmental chemistry: 1986

    International Nuclear Information System (INIS)

    This report documents the continuing quality assurance efforts of the Health and Environmental Chemistry Group at the Los Alamos National Laboratory. The philosophy, methodology, and computing resources used by the quality assurance program to encompass the diversity of analytical chemistry practiced in the group are described. Included in the report are all quality assurance reference materials used, along with their certified or consensus concentrations, and all analytical chemistry quality assurance measurements made by HSE-9 during 1986. 27 refs., 3 figs

  6. Prototype international quality assurance program

    International Nuclear Information System (INIS)

    The international community presently lacks the ability to determine the quality and credibility of environmental measurements that is required to make sound decisions in matters related to international security, public health, and investment-related considerations. The ultimate goal of the work described in this article is to develop a credible information base including measurement capability for determination of environmental contamination and the potential for proliferation of material components of chemical or nuclear weapons. This study compared the accuracy obtained by six Russian and six U.S. laboratories for samples representative of classes of trace metals, dioxing-furans, and radioactive substances. The results obtained in this work indicate that current estimates for laboratory accuracy are likely overly optimistic. The weaknesses discovered by this prototype U.S. - Russia study also exist within the broader international community of laboratories. Further work is proposed to address the urgent need for the international community to improve performance evaluations for analytical measurements. (author)

  7. SWiFT Software Quality Assurance Plan.

    Energy Technology Data Exchange (ETDEWEB)

    Berg, Jonathan Charles [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2016-01-01

    This document describes the software development practice areas and processes which contribute to the ability of SWiFT software developers to provide quality software. These processes are designed to satisfy the requirements set forth by the Sandia Software Quality Assurance Program (SSQAP). APPROVALS SWiFT Software Quality Assurance Plan (SAND2016-0765) approved by: Department Manager SWiFT Site Lead Dave Minster (6121) Date Jonathan White (6121) Date SWiFT Controls Engineer Jonathan Berg (6121) Date CHANGE HISTORY Issue Date Originator(s) Description A 2016/01/27 Jon Berg (06121) Initial release of the SWiFT Software Quality Assurance Plan

  8. Modality-dependent dose requirements in the Austrian breast cancer early detection program. First results from technical quality assurance; Geraeteabhaengiger Dosisbedarf im Oesterreichischen Brustkrebsfrueherkennungsprogramm. Erste Ergebnisse aus der technischen Qualitaetssicherung

    Energy Technology Data Exchange (ETDEWEB)

    Osanna-Elliott, A.; Semturs, F.; Menhart, S.; Schloegl, C.; Wildner, S.; Zwettler, G. [AGES, Wien (Austria). Referenzzentrum fuer technische Qualitaetssicherung im Brustkrebsfrueherkennungsprogramm

    2015-07-01

    The Austrian Breast Cancer Early Detection Program (BKFP) has officially started in January 2014. In order to ensure that all participating women can rely on a sufficient cancer detection rate while at the same time the required dose is as low as reasonably achievable, all participating radiology institutes (approx. 200) have to fulfill strict quality assurance requirements. The control and certification is performed by the Reference Center for Technical Quality Assurance (RefZQS), which has been developing the methods and tolerances in a pilot project since 2007. The limits are defined in the EUREF-Oeprotocol which is based on the European EPQC guidelines. From the requirement for optimized image quality while simultaneously following the ALARA principle, we found modality-dependent dose requirements, which we had expected but which have now been compiled for the first time for Austria.

  9. High assurance services computing

    CERN Document Server

    2009-01-01

    Covers service-oriented technologies in different domains including high assurance systemsAssists software engineers from industry and government laboratories who develop mission-critical software, and simultaneously provides academia with a practitioner's outlook on the problems of high-assurance software development

  10. Authentication Assurance Levels

    International Nuclear Information System (INIS)

    This Common Criteria approach has been applied to create a definition of Authentication Assurance Levels that can quantify the level of assurance reached for a system subject to a set of authentication procedures. The arms-control authentication application of the Common Criteria expands on more typical information security evaluations in that it must contend with information barriers and preclude sophisticated intentional subversion attempts.

  11. Quality Assurance for Operation of Nuclear Facilities

    International Nuclear Information System (INIS)

    This report describes QA activities performed within 'Quality Assurance for Nuclear facility project' and results thereof. Efforts were made to maintain and improve quality system of nuclear facilities. Varification activities whether quality system was implemented in compliance with requirements. QA department assisted KOLAS accredited testing and calibration laboratories, ISO 9001 quality system, establishment of QA programs for R and D, and carried out reviews and surveys for development of quality assurance technologies. Major items of this report are as follows : - Development and Improvement of QA Programs - QA Activities - Assessment of Effectiveness and Adequacy for QA Programs

  12. MCNP{trademark} Software Quality Assurance plan

    Energy Technology Data Exchange (ETDEWEB)

    Abhold, H.M.; Hendricks, J.S.

    1996-04-01

    MCNP is a computer code that models the interaction of radiation with matter. MCNP is developed and maintained by the Transport Methods Group (XTM) of the Los Alamos National Laboratory (LANL). This plan describes the Software Quality Assurance (SQA) program applied to the code. The SQA program is consistent with the requirements of IEEE-730.1 and the guiding principles of ISO 900.

  13. Software quality assurance handbook

    Energy Technology Data Exchange (ETDEWEB)

    1990-09-01

    There are two important reasons for Software Quality Assurance (SQA) at Allied-Signal Inc., Kansas City Division (KCD): First, the benefits from SQA make good business sense. Second, the Department of Energy has requested SQA. This handbook is one of the first steps in a plant-wide implementation of Software Quality Assurance at KCD. The handbook has two main purposes. The first is to provide information that you will need to perform software quality assurance activities. The second is to provide a common thread to unify the approach to SQA at KCD. 2 figs.

  14. Healthcare Software Assurance

    OpenAIRE

    Cooper, Jason G.; Pauley, Keith A.

    2006-01-01

    Software assurance is a rigorous, lifecycle phase-independent set of activities which ensure completeness, safety, and reliability of software processes and products. This is accomplished by guaranteeing conformance to all requirements, standards, procedures, and regulations. These assurance processes are even more important when coupled with healthcare software systems, embedded software in medical instrumentation, and other healthcare-oriented life-critical systems. The current Food and Dru...

  15. RAVEN Quality Assurance Activities

    Energy Technology Data Exchange (ETDEWEB)

    Cogliati, Joshua Joseph [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-01

    This report discusses the quality assurance activities needed to raise the Quality Level of Risk Analysis in a Virtual Environment (RAVEN) from Quality Level 3 to Quality Level 2. This report also describes the general RAVEN quality assurance activities. For improving the quality, reviews of code changes have been instituted, more parts of testing have been automated, and improved packaging has been created. For upgrading the quality level, requirements have been created and the workflow has been improved.

  16. RAVEN Quality Assurance Activities

    International Nuclear Information System (INIS)

    This report discusses the quality assurance activities needed to raise the Quality Level of Risk Analysis in a Virtual Environment (RAVEN) from Quality Level 3 to Quality Level 2. This report also describes the general RAVEN quality assurance activities. For improving the quality, reviews of code changes have been instituted, more parts of testing have been automated, and improved packaging has been created. For upgrading the quality level, requirements have been created and the workflow has been improved.

  17. Assuring structural integrity in Army systems

    Science.gov (United States)

    1985-01-01

    The object of this study was to recommend possible improvements in the manner in which structural integrity of Army systems is assured. The elements of a structural integrity program are described, and relevant practices used in various industries and government organizations are reviewed. Some case histories of Army weapon systems are examined. The mandatory imposition of a structural integrity program patterned after the Air Force Aircraft Structural Integrity Program is recommended and the benefits of such an action are identified.

  18. Quality assurance and organizational effectiveness in hospitals.

    Science.gov (United States)

    Hetherington, R W

    1982-01-01

    The purpose of this paper is to explore some aspects of a general theoretical model within which research on the organizational impacts of quality assurance programs in hospitals may be examined. Quality assurance is conceptualized as an organizational control mechanism, operating primarily through increased formalization of structures and specification of procedures. Organizational effectiveness is discussed from the perspective of the problem-solving theory of organizations, wherein effective organizations are those which maintain at least average performance in all four system problem areas simultaneously (goal-attainment, integration, adaptation and pattern-maintenance). It is proposed that through the realization of mutual benefits for both professionals and the bureaucracy, quality assurance programs can maximize such effective performance in hospitals.

  19. Quality assurance requirements for an institution with diverse technical activities at the Nevada test site (NTS)

    International Nuclear Information System (INIS)

    The author describes the Nevada test site's restructuring of its approach to quality assurance. Basic requirements are being expanded and augmented. The nature of the quality assurance program is discussed

  20. Vega flow assurance system

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Marit; Munaweera, Sampath

    2010-07-01

    Vega is a gas condensate field located at the west coast of Norway and developed as a tie-in to the Gjoea platform. Operator is Statoil, production startup is estimated to the end of 2010. Flow assurance challenges are high reservoir pressure and temperature, hydrate and wax control, liquid accumulation and monitoring the well/template production rates. The Vega Flow Assurance System (FAS) is a software that supports monitoring and operation of the field. The FAS is based FlowManagerTM designed for real time systems. This is a flexible tool with its own steady state multiphase- and flow assurance models. Due to the long flowlines lines and the dynamic behavior, the multiphase flow simulator OLGA is also integrated in the system. Vega FAS will be used as: - An online monitoring tool - An offline what-if simulation and validation tool - An advisory control system for well production allocation. (Author)

  1. Rastreabilidade das referências metrológicas em dose absorvida na água do Programa de Qualidade em Dosimetria Traceability of metrologic references of dose absorbed to water used in a Dosimetry Quality Assurance Program

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo de Almeida

    2005-06-01

    Full Text Available OBJETIVO: Este trabalho tem por objetivo apresentar a estrutura solidamente estabelecida de rastreabilidade dos padrões ionométricos e do sistema de medidas com dosímetros termoluminescentes, como parte da confiabilidade do Programa de Qualidade em Dosimetria (PQD, que visa a garantir o mais elevado nível de exatidão às suas medidas. MATERIAIS E MÉTODOS: A exemplo de outros programas, usaram-se dosímetros termoluminescentes (DTL 937 na forma de pó, colocados em uma cápsula de plástico, em "kits" específicos para cada aplicação, os quais foram enviados, por via postal, aos centros participantes. RESULTADOS: Os resultados da intercomparação realizada entre o Laboratório de Ciências Radiológicas da Universidade do Estado do Rio de Janeiro e o EQUAL-ESTRO para o feixe de raios gama de 60Co, expressos para (1sigma, e os resultados das medidas de dose absorvida, obtidos com as câmaras dp Programa EQUAL e as câmaras do PQD, apresentaram discordância menor que 0,5%. CONCLUSÃO: Dos resultados conclui-se que o PQD alcançou o nível desejado de confiabilidade, necessário à implementação do Programa.OBJECTIVE: To present the solidly established traceability structure for ionometric standards and for thermoluminescent dosimetry system that ensures reliability of the Dosimetry Quality Assurance Program and is aimed to certify the highest level of accuracy of the measurements. MATERIALS AND METHODS: Thermoluminescent powder dosimeters (DTL 937 placed into plastic capsules and packed in specific kits for each intended application were mailed to the participant centers. RESULTS: The results of the intercomparisons performed between "Laboratório de Ciências Radiológicas da Universidade do Estado do Rio de Janeiro" and EQUAL-ESTRO for the beam of 60Co gamma rays, expressed for (1sigma, and the results of the dose absorbed measurements obtained with the chambers of the Program EQUAL and the chambers of the Dosimetry Quality Assurance

  2. Quality assurance for health and environmental chemistry: 1989

    International Nuclear Information System (INIS)

    This report documents the continuing quality assurance efforts of the Health and Environmental Chemistry Group (HSE-9) at the Los Alamos National Laboratory. The philosophy, methodology, computing resources, and laboratory information management system used by the quality assurance program to encompass the diversity of analytical chemistry practiced in the group are described. Included in the report are all quality assurance reference materials used, along with their certified or consensus concentrations, and all analytical chemistry quality assurance measurements made by HSE-9 during 1989. 38 refs., 8 figs., 3 tabs

  3. Mentoring in Higher Education Should Be the Norm to Assure Success: Lessons Learned from the Faculty Mentoring Program, West Chester University, 2008-2011

    Science.gov (United States)

    Bean, Nadine M.; Lucas, Lisa; Hyers, Lauri L.

    2014-01-01

    Despite a wealth of qualitative and quantitative data regarding the positive effects of higher education mentoring programs on faculty satisfaction, retention, tenure, and promotion, mentoring programs are not widespread. The authors examine evaluative data from the first four years of the Faculty Mentoring Program at West Chester University. Of…

  4. Quality Assurance for All

    Science.gov (United States)

    Cheung, Peter P. T.; Tsui, Cecilia B. S.

    2010-01-01

    For higher education reform, most decision-makers aspire to achieving a higher participation rate and a respectable degree of excellence with diversity at the same time. But very few know exactly how. External quality assurance is a fair basis for differentiation but there can be doubt and resistance in some quarters. Stakeholder interests differ…

  5. Mission Operations Assurance

    Science.gov (United States)

    Faris, Grant

    2012-01-01

    Integrate the mission operations assurance function into the flight team providing: (1) value added support in identifying, mitigating, and communicating the project's risks and, (2) being an essential member of the team during the test activities, training exercises and critical flight operations.

  6. Basic Study of Establishment of Quality Assurance Processes to Develop an Integrated Quality Assurance System for Nuclear Power Plant Construction

    International Nuclear Information System (INIS)

    An integrated quality assurance system has necessitated carrying out quality assurance programs in a systematic manner because the opportunities to expand business in overseas markets have increased since the export of a nuclear power plant to UAE in 2009. In this study, we use PDCA method to systematically analyze the quality assurance procedures that were used in previous projects for constructing nuclear power plants. We reached a classification system of quality assurance processes at each phase of nuclear power plant construction by integrating similar work related to quality such as planning, design, equipment manufacturing, construction and start-up. We also established a hierarchy of quality assurance processes to develop an integrated quality assurance system as a technology goal to be developed later. To obtain most updated quality assurance activities, a quality assurance process is structured by integrating similar works analyzed from quality assurance procedures through PDCA cycle method. At the implementation phase of Hierarchy of quality processes and sequence of processes for constructing nuclear power plant are established in this study. Integrated quality assurance system is to be developed by connecting organizations as well as stakeholders such as owners, Architect engineering, suppliers, contractors, and sub-contractors to carry out assigned work efficiently

  7. Quality Assurance Source Requirements Traceability Database

    Energy Technology Data Exchange (ETDEWEB)

    MURTHY, R., NAYDENOVA, A., DEKLEVER, R., BOONE, A.

    2006-01-30

    At the Yucca Mountain Project the Project Requirements Processing System assists in the management of relationships between regulatory and national/industry standards source criteria, and Quality Assurance Requirements and Description document (DOE/R W-0333P) requirements to create compliance matrices representing respective relationships. The matrices are submitted to the U.S. Nuclear Regulatory Commission to assist in the commission's review, interpretation, and concurrence with the Yucca Mountain Project QA program document. The tool is highly customized to meet the needs of the Office of Civilian Radioactive Waste Management Office of Quality Assurance.

  8. Design quality assurance for plant modifications

    Energy Technology Data Exchange (ETDEWEB)

    Ankrum, G.T.; Norkin, D.P.; Architzel, R.

    1985-11-01

    The US Nuclear Regulatory Commission's Office of Inspection and Enforcement has conducted direct inspections of the technical aspects of the nuclear plant design process for several plants under construction. It has also evaluated independent design verification programs and engineering assurance programs at a number of other plants under construction. Many of the lessons learned from these construction phase efforts are directly applicable to operating plants undergoing major modifications.

  9. Quality assurance in radiochemical/radiopharmaceutical manufacturing

    International Nuclear Information System (INIS)

    A general overview of a good Quality Assurance program will be presented with specific references to Nordion International Inc.'s QA program. Topics to be covered will include: facilities, equipment, training, raw material testing, manufacturing control, finished product testing, records and archives. Nordion's audit procedures with resulting corrective actions and documentation procedures will be outlined. Examples will be given of statistical process control and the use of teams as a means of moving responsibility down the ladder

  10. Assuring quality in high-consequence engineering

    Energy Technology Data Exchange (ETDEWEB)

    Hoover, Marcey L.; Kolb, Rachel R.

    2014-03-01

    In high-consequence engineering organizations, such as Sandia, quality assurance may be heavily dependent on staff competency. Competency-dependent quality assurance models are at risk when the environment changes, as it has with increasing attrition rates, budget and schedule cuts, and competing program priorities. Risks in Sandia's competency-dependent culture can be mitigated through changes to hiring, training, and customer engagement approaches to manage people, partners, and products. Sandia's technical quality engineering organization has been able to mitigate corporate-level risks by driving changes that benefit all departments, and in doing so has assured Sandia's commitment to excellence in high-consequence engineering and national service.

  11. Quality assurance in clinical trials.

    NARCIS (Netherlands)

    Ottevanger, P.B.; Therasse, P.; Veld, C.J.H. van de; Bernier, J.; Krieken, J.H.J.M. van; Grol, R.P.T.M.; Mulder, P.H.M. de

    2003-01-01

    From the literature that was initially searched by electronic databases using the keywords quality, quality control and quality assurance in combination with clinical trials, surgery, pathology, radiotherapy, chemotherapy and data management, a comprehensive review is given on what quality assurance

  12. Quality assurance for gamma knives

    Energy Technology Data Exchange (ETDEWEB)

    Jones, E.D.; Banks, W.W.; Fischer, L.E. [Lawrence Livermore National Lab., CA (United States)

    1995-09-01

    This report describes and summarizes the results of a quality assurance (QA) study of the Gamma Knife, a nuclear medical device used for the gamma irradiation of intracranial lesions. Focus was on the physical aspects of QA and did not address issues that are essentially medical, such as patient selection or prescription of dose. A risk-based QA assessment approach was used. Sample programs for quality control and assurance are included. The use of the Gamma Knife was found to conform to existing standards and guidelines concerning radiation safety and quality control of external beam therapies (shielding, safety reviews, radiation surveys, interlock systems, exposure monitoring, good medical physics practices, etc.) and to be compliant with NRC teletherapy regulations. There are, however, current practices for the Gamma Knife not covered by existing, formalized regulations, standards, or guidelines. These practices have been adopted by Gamma Knife users and continue to be developed with further experience. Some of these have appeared in publications or presentations and are slowly finding their way into recommendations of professional organizations.

  13. Quality assurance for gamma knives

    International Nuclear Information System (INIS)

    This report describes and summarizes the results of a quality assurance (QA) study of the Gamma Knife, a nuclear medical device used for the gamma irradiation of intracranial lesions. Focus was on the physical aspects of QA and did not address issues that are essentially medical, such as patient selection or prescription of dose. A risk-based QA assessment approach was used. Sample programs for quality control and assurance are included. The use of the Gamma Knife was found to conform to existing standards and guidelines concerning radiation safety and quality control of external beam therapies (shielding, safety reviews, radiation surveys, interlock systems, exposure monitoring, good medical physics practices, etc.) and to be compliant with NRC teletherapy regulations. There are, however, current practices for the Gamma Knife not covered by existing, formalized regulations, standards, or guidelines. These practices have been adopted by Gamma Knife users and continue to be developed with further experience. Some of these have appeared in publications or presentations and are slowly finding their way into recommendations of professional organizations

  14. Quality assurance standards for purchasing and inventory control.

    Science.gov (United States)

    Soares, D P

    1985-03-01

    A process is described for quality assurance in pharmaceutical purchasing and inventory control. A quality assurance program should ensure that quality drugs are purchased at the lowest price, drug products are available when needed, the system is managed efficiently, internal controls are provided, drug products are stored under appropriate conditions, and laws, regulations, accreditation standards, and procedures are followed. To meet these objectives, product quality, vendor performance, the department's system of internal controls, purchasing data, and storage conditions should be monitored. A checklist for evaluating purchasing and inventory practices and a sample audit form listing quality assurance criteria, standards, procedures, and recommended actions are provided. A quality assurance program for pharmaceutical purchasing and inventory control should define institution-specific criteria and standards and use these standards for continual evaluation of all aspects of the purchasing and inventory control system. Documentation of quality assurance activities should be provided for use by the purchasing department, hospital administration, and regulatory bodies. PMID:3985026

  15. Creating Quality Assurance and International Transparency for Quality Assurance Agencies

    DEFF Research Database (Denmark)

    Kristoffersen, Dorte; Lindeberg, Tobias

    2004-01-01

    , on the one hand, to advance internationalisation of quality assurance of higher education, and on the other hand, allow for the differences in the national approaches to quality assurance. The paper will focus on two issues: first, the strength and weaknesses of the method employed and of the use of the ENQA......The paper presents the experiences gained in the pilot project on mutual recognition conducted by the quality assurance agencies in the Nordic countries and the future perspective for international quality assurance of national quality assurance agencies. The background of the project was the need...

  16. Creating quality assurance and international transparency for quality assurance agencies

    DEFF Research Database (Denmark)

    Lindeberg, Tobias Høygaard; Kristoffersen, Dorte

    2004-01-01

    , on the one hand, to advance internationalisation of quality assurance of higher education, and on the other hand, allow for the differences in the national approaches to quality assurance. The paper will focus on two issues: first, the strength and weaknesses of the method employed and of the use of the ENQA......The paper presents the experiences gained in the pilot project on mutual recognition conducted by the quality assurance agencies in the Nordic countries and the future perspective for international quality assurance of national quality assurance agencies. The background of the project was the need...

  17. 10 CFR 63.142 - Quality assurance criteria.

    Science.gov (United States)

    2010-01-01

    ... portion of the quality assurance program at any location where activities subject to 10 CFR part 63 are...: criticality physics, stress, thermal, hydraulic, and preclosure and postclosure analyses; compatibility...

  18. Revenue assurance in utilities

    OpenAIRE

    Rihar, Miha

    2010-01-01

    In recent times utility companies have to orient to effective business due to hard market conditions. Thus, companies want to diminish business expenses and increase the revenues. Effective revenue capture is, after all, the aim of revenue assurance. Actually the revenue capture is usually not perfect and without losses. A part of revenues are always lost on the way from a service to payment, which is called revenue leakage and causes a financial loss. The revenue leakage is above all the ...

  19. Introduction to quality assurance

    International Nuclear Information System (INIS)

    Safety requirements set forth in the regulatory requirement, codes, standards as well as other requirements for various aspects of nuclear power plant design and operation are strictly implemented through QA activities. The overall QA aim is to assure that the plant is soundly and correctly designed and that it is built, tested and operated in accordance with stringent quality standards and conservative engineering practices. In this way a high degree of freedom from faults and errors can be achieved. (orig.)

  20. Quality assurance in radiotherapy

    International Nuclear Information System (INIS)

    Good radiotherapy results and safety of treatment require the radiation to be optimally applied to a specified target area and the correct dose. According to international recommendations, the average uncertainty in therapeutic dose should not exceed 5%. The need for high precision in therapeutic dose requires quality assurance covering the entire radiotherapy process. Besides the physical and technical characteristics of the therapy equipment, quality assurance must include all radiotherapy equipment and procedures that are significant for the correct magnitude and precision of application of the therapeutic dose. The duties and responsibilities pertaining to various stages of treatment must also be precisely defined. These requirements may be best implemented through a quality system. The general requirements for supervision and quality assurance of medical radiation apparatus are prescribed in section 40 of the Radiation Act (592/1991, amendment 1142/1998) and in sections 18 and 32 of the Decree of the Ministry of Social Affairs and Health on the medical use of radiation (423/2000). Guide ST 2.2 imposes requirements on structural radiation shielding of radiotherapy equipment and the premises in which it is used, and on warning and safety arrangements. Guide ST 1.1 sets out the general safety principles for radiation practices and regulatory control procedure for the use of radiation. Guide ST 1.6 provides general requirements for operational measures in the use of radiation. This Guide sets out the duties of responsible parties (the party running a radiation practice) in respect of arranging and maintaining radiotherapy quality assurance. The principles set out in this Guide and Guide ST 6.3 may be applied to radionuclide therapy

  1. Power transformers quality assurance

    CERN Document Server

    Dasgupta, Indrajit

    2009-01-01

    About the Book: With the view to attain higher reliability in power system operation, the quality assurance in the field of distribution and power transformers has claimed growing attention. Besides new developments in the material technology and manufacturing processes of transformers, regular diagnostic testing and maintenance of any engineering product may be ascertained by ensuring: right selection of materials and components and their quality checks. application of correct manufacturing processes any systems engineering. the user`s awareness towards preventive maintenance. The

  2. Revenue assurance methodology

    OpenAIRE

    Filipová, Michaela

    2006-01-01

    Práce se zabývá návrhem uceleného teoreticko-metodologického rámce nové podnikové funkce revenue assurance pro telekomunikační společnosti, které usilují o systematický a koncepční přístup k zajištění a maximalizaci příjmů. Popsány jsou role revenue assurance funkce v podniku, cíle, vývojová stádia. Dále jsou popsány hrozby a konkrétní podoby úniků a nadhodnocení příjmů. Podrobně je rozebrána metodika pro plnění úkolů revenue assurance a techniky pro eliminaci úniků a nadhodnocení příjmů. Prá...

  3. Education for All in South Africa: Developing a National System for Quality Assurance.

    Science.gov (United States)

    Smith, William J.; Ngoma-Maema, Wendy Yolisa

    2003-01-01

    Draws on international research, policy, and practice relevant to quality assurance systems to analyze the development of a national framework for educational quality assurance in South Africa. Describes an emerging framework for quality assurance that encompasses evaluation of student achievement, quality audits and reviews, program and service…

  4. Quality Assurance Techniques in OpenUP (Open Unified Process)

    OpenAIRE

    Sardar, Raham; Fazal, Usman

    2011-01-01

    Agile methods change the software processes. Agile processes such as Scrum, ExtremeProgramming (XP), Open Unified Process (OpenUP) etc. have techniques that improve softwarequality. No doubt that the purpose of these techniques is to inject quality assurance into theproject under development. This thesis presents quality assurance techniques in Open UnifiedProcess (OpenUP) along with comparative study to extreme programming (XP) for agilesoftware development. OpenUP is an agile and unified pr...

  5. Quality assurance and radiofrequency heating

    International Nuclear Information System (INIS)

    One pf the potential problems and limitations of scanning at high field strength is the deposition or radiofrequency (RF) power into the body. This paper proposes an inexpensive means of assessing radiofrequency power deposition in a magnet. This is particularly important at 3T where sequences approach Food and Drug Administration approved RF limits. It will also be of interest to operators at 1.5 T as part of their ongoing quality assurance programs. At 3T, we found that the RF power deposited in the magnet was less than that read by the MR power monitor. All measurements were performed with a 2.51 perspex spherical phantom. Copyright (2002) Blackwell Science Pty Ltd

  6. Quality Assurance of Ultrasonic Diagnosis in Breast

    International Nuclear Information System (INIS)

    Sonography is a subjective diagnostic method which is highly dependent on the experience of the operator and the equipment quality which requires real-time adjustments. Breast screening examination currently consists of clinical examination and mammography. Breast sonography, either supplementary to mammography or independently, is indicated for the dense breast, especially in younger women. Breast sonography is especially applicable for Korean women because of the denser breast parenchyma and the approximately 10-year younger incidence rate of breast cancer of Korean women compared to western women. To avoid unnecessary breast biopsy because of the high rate of false positive lesions in breast parenchyma, which is different from other body organs such as the liver or the kidney, a quality assurance program for breast sonography is essential. The quality assurance of breast ultrasound involves quality assurance of the equipment, imaging display and acquisition of clinical images, personnel qualifications and other aspects such as unification of lexicon, guideline of diagnostic examination and reporting system; US BI-RAD reporting system, assessment items and organization, education program, medical audit, certification issues, and medicolegal issues. A breast sonographic quality assurance system should be established before a scheme to initiate governmental medical insurance for breast sonography

  7. Directory of Certificates of Compliance for radioactive materials packages: Report of NRC approved quality assurance programs for radioactive materials packages. Volume 3, Revision 15

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the front of Volumes 1 and 2. An alphabetical listing by user name is included in the back of Volume 3 of approved QA programs. The reports include a listing of all users of each package design and approved QA programs prior to the publication date.

  8. Directory of Certificates of Compliance for radioactive materials packages: Report of NRC approved quality assurance programs for radioactive materials packages. Volume 3, Revision 15

    International Nuclear Information System (INIS)

    The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the front of Volumes 1 and 2. An alphabetical listing by user name is included in the back of Volume 3 of approved QA programs. The reports include a listing of all users of each package design and approved QA programs prior to the publication date

  9. Quality assurance services

    International Nuclear Information System (INIS)

    For over 20 years the quality assurance services at the Springfields Laboratories have been concerned with manufacturing both simple and complex engineering products to the highest standard. The scientists working there have considerable expertise in the practical application of quality control and the development and design of inspection and non-destructive testing equipment. The folder contains six sheets or leaflets illustrating the work and equipment. The subjects are the mechanical standards laboratory, non-destructive testing, the digitising table, the peripheral camera, automated measurement, data handling and presentation, and the computer controlled three axis co-ordinate measuring machine. (U.K.)

  10. Reactor system safety assurance

    International Nuclear Information System (INIS)

    The philosophy of reactor safety is that design should follow established and conservative engineering practices, there should be safety margins in all modes of plant operation, special systems should be provided for accidents, and safety systems should have redundant components. This philosophy provides ''defense in depth.'' Additionally, the safety of nuclear power plants relies on ''safety systems'' to assure acceptable response to design basis events. Operating experience has shown the need to study plant response to more frequent upset conditions and to account for the influence of operators and non-safety systems on overall performance. Defense in depth is being supplemented by risk and reliability assessment

  11. Instructional Effects of a Systematically Developed Educational Product: Advanced Release of Quality Assurance Data for SWRL/Ginn Kindergarten Program Installation 1972-73.

    Science.gov (United States)

    Hanson, Ralph A.; Doherty, William J.

    The installation of the SWRL/Ginn Kindergarten Program on a wide-scale national basis provided an occasion to test the claim that important instructional outcomes may be attained reliably in a variety of school settings with a wide variety of pupils through the use of a systematically developed educational product. Characteristics of the…

  12. Assurance of U.S. Allies

    OpenAIRE

    Center on Contemporary Conflict

    2013-01-01

    FY 2013-2014. Project Lead: Ralph Cossa & Brad Glosserman Japan and South Korea_s (ROK) concerns about the reliability of the U.S. deterrent are increased by Chinese nuclear modernization and the North Korea nuclear weapons development program. As the United States embraces defense realignment and moves to reduce its nuclear stockpile, Japanese and South Korean thinking about extended deterrence is profoundly affected. It is increasingly important for the United States to assure its allian...

  13. Quality assurance of the computer code INDAR

    International Nuclear Information System (INIS)

    Detailed aquatic dispersion and radiation exposure models are required in order to assess the radiological impact of routine aquatic discharges from nuclear power stations in the United Kingdom. Such models have been developed and incorporated in the computer program INDAR. This report describes the quality assurance procedures adopted in producing and testing the first release of the code, which was complied in November 1988 and is currently stored in the production load module PROD.INDAR.V10. (author)

  14. Quality assurance records system

    International Nuclear Information System (INIS)

    This Safety Guide was prepared as part of the Agency's programme, referred to as the NUSS programme, for establishing Codes of Practice and Safety Guides relating to nuclear power plants. It supplements the IAEA Code of Practice on Quality Assurance for Safety in Nuclear Power Plants (IAEA Safety Series No.50-C-QA), which requires that for each nuclear power plant a system for the generation, identification, collection, indexing, filing, storing, maintenance and disposition of quality assurance records shall be established and executed in accordance with written procedures and instructions. The purpose of this Safety Guide is to provide assistance in the establishment and operation of such a system. An orderly established and maintained records system is considered to be part of the means of providing a basis for an appropriate level of confidence that the activities which affect the quality of a nuclear power plant have been performed in accordance with the specific requirements and that the required quality has been achieved and is maintained

  15. Radiological environmental monitoring program for Angra I: basis and methodology proposed for executing the requirements of the regulatory member and to assure the population safety

    International Nuclear Information System (INIS)

    It is presented, applyed to Angra-1, a methodology for implanting the monitoring program of the vicinity level radiation exposure to the installation. The method considers two kinds of radioactive effluents in the environment: gaseous (in the atmosphere) and liquid (in the marine aquatic environment). It is based on the generation and ordering of the important relation: radiation exposure pathway/radionuclide group. (M.C.K.)

  16. The case of sustainability assurance: constructing a new assurance service

    NARCIS (Netherlands)

    B. O'Dwyer

    2011-01-01

    This paper presents an in-depth longitudinal case study examining the processes through which practitioners in two Big 4 professional services firms have attempted to construct sustainability assurance (independent assurance on sustainability reports). Power’s (1996, 1997, 1999, 2003) theorization o

  17. Subsurface quality assurance practices

    International Nuclear Information System (INIS)

    This report addresses only the concept of applying Nuclear Quality Assurance (NQA) practices to repository shaft and subsurface design and construction; how NQA will be applied; and the level of detail required in the documentation for construction of a shaft and subsurface repository in contrast to the level of detail required in the documentation for construction of a traditional mine. This study determined that NQA practices are viable, attainable, as well as required. The study identified the appropriate NQA criteria and the repository's major structures, systems, items, and activities to which the criteria are applicable. A QA plan, for design and construction, and a list of documentation, for construction, are presented. 7 refs., 1 fig., 18 tabs

  18. Construction quality assurance report

    Energy Technology Data Exchange (ETDEWEB)

    Roscha, V.

    1994-09-08

    This report provides a summary of the construction quality assurance (CQA) observation and test results, including: The results of the geosynthetic and soil materials conformance testing. The observation and testing results associates with the installation of the soil liners. The observation and testing results associated with the installation of the HDPE geomembrane liner systems. The observation and testing results associated with the installation of the leachate collection and removal systems. The observation and testing results associated with the installation of the working surfaces. The observation and testing results associated with in-plant manufacturing process. Summary of submittal reviews by Golder Construction Services, Inc. The submittal and certification of the piping material specifications. The observation and verification associated of the Acceptance Test Procedure results of the operational equipment functions. Summary of the ECNs which are incorporated into the project.

  19. FESA Quality Assurance

    CERN Document Server

    CERN. Geneva

    2015-01-01

    FESA is a framework used by 100+ developers at CERN to design and implement the real-time software used to control the accelerators. Each new version must be tested and qualified to ensure that no backward compatibility issues have been introduced and that there is no major bug which might prevent accelerator operations. Our quality assurance approach is based on code review and a two-level testing process. The first level is made of unit-test (Python unittest & Google tests for C++). The second level consists of integration tests running on an isolated test environment. We also use a continuous integration service (Bamboo) to ensure the tests are executed periodically and the bugs caught early. In the presentation, we will explain the reasons why we took this approach, the results and some thoughts on the pros and cons.

  20. Concrete quality assurance

    Energy Technology Data Exchange (ETDEWEB)

    Holz, N. [Harza Engineering Company, Chicago, IL (United States)

    2000-08-01

    This short article reports on progress at the world's largest civil construction project, namely China's Three Gorges hydro project. Work goes on around the clock to put in place nearly 28 M m{sup 3} of concrete. At every stage of the work there is strong emphasis on quality assurance (QA) and concrete is no exception. The US company Harza Engineering has been providing QA since the mid-1980s and concrete QA has been based on international standards. Harza personnel work in the field with supervisors developing educational tools for supervising concrete construction and quality, as well as providing training courses in concrete technology. Some details on flood control, capacity, water quality and environmental aspects are given..

  1. Construction quality assurance report

    International Nuclear Information System (INIS)

    This report provides a summary of the construction quality assurance (CQA) observation and test results, including: The results of the geosynthetic and soil materials conformance testing. The observation and testing results associates with the installation of the soil liners. The observation and testing results associated with the installation of the HDPE geomembrane liner systems. The observation and testing results associated with the installation of the leachate collection and removal systems. The observation and testing results associated with the installation of the working surfaces. The observation and testing results associated with in-plant manufacturing process. Summary of submittal reviews by Golder Construction Services, Inc. The submittal and certification of the piping material specifications. The observation and verification associated of the Acceptance Test Procedure results of the operational equipment functions. Summary of the ECNs which are incorporated into the project

  2. Measurement quality assurance for radioassay laboratories

    Energy Technology Data Exchange (ETDEWEB)

    McCurdy, D.E. [Yankee Atomic Environmental Laboratory, Boston, MA (United States)

    1993-12-31

    Until recently, the quality of U.S. radioassay laboratory services has been evaluated by a limited number of governmental measurement assurance programs (MAPs). The major programs have been limited to the U.S. Department of Energy (DOE), the U.S. Environmental Protection Agency (EPA) and the U.S. Nuclear Regulatory Commission (NRC). In 1988, an industry MAP was established for the nuclear power utility industry through the U.S. Council for Energy Awareness/National Institute of Standards and Technology (USCEA/NIST). This program functions as both a MAP for utility laboratories and/or their commercial contractor laboratories, and as a traceability program for the U.S. radioactive source manufacturers and the utility laboratories. Each of these generic MAPs has been initiated and is maintained to serve the specific needs of the sponsoring agency or organization. As a result, there is diversification in their approach, scope, requirements, and degree of traceability to NIST. In 1987, a writing committee was formed under the American National Standards Institute (ANSI) N42.2 committee to develop a standard to serve as the basis document for the creation of a national measurement quality assurance (MQA) program for radioassay laboratories in the U.S. The standard is entitled, {open_quotes}Measurement Quality Assurance For Radioassay Laboratories.{open_quotes} The document was developed to serve as a guide for MQA programs maintained for the specialized sectors of the radioassay community, such as bioassay, routine environmental monitoring, environmental restoration and waste management, radiopharmaceuticals, and nuclear facilities. It was the intent of the writing committee to develop a guidance document that could be utilized to establish a laboratory`s specific data quality objectives (DQOs) that govern the operational requirements of the radioassay process, including mandated protocols and recommendations.

  3. Quality assurance plan, Westinghouse Nuclear Energy Systems Divisions

    International Nuclear Information System (INIS)

    The Quality Assurance Plan used by Westinghouse Nuclear Energy Systems Water Reactor Divisions is described. The purpose of the program is to assure that the design, materials, and workmanship on Nuclear Steam Supply System (NSSS) equipment meet applicable safety requirements, fulfill the requirements of the contracts with the applicants, and satisfy the applicable codes, standards, and regulatory requirements. This document replaces the contents of Chapter 17 Safety Analysis Reports, except for any special or unique requirements. (auth)

  4. Quality Assurance in a Computer-Based Outpatient Record

    OpenAIRE

    Colloff, Edwin; Morgan, Mary; Beaman, Peter; Justice, Norma; Kunstaetter, Robert; Barnett, G. Octo

    1980-01-01

    COSTAR, a COmputer-STored Ambulatory Record system, was developed at the Massachusetts General Hospital Laboratory of Computer Science. It can supplement or entirely replace the paper medical record with a highly encoded record. Although a computer-stored medical record provides a unique opportunity for quality assurance activities, it requires programming skills to examine the data. We have taken the dual approach of writing pre-specified quality assurance packages and developing a high leve...

  5. Quality assurance as a managerial innovation: a research perspective.

    Science.gov (United States)

    Kaluzny, A D

    1982-01-01

    Quality assurance is defined and concepts from innovation theory are applied to the study of quality assurance programs. Two distinct although not mutually exclusive perspectives on innovation are considered--the diffusion perspective, focusing on the innovation itself and its implementation, and the adoption perspective, highlighting factors characteristic of the adoption unit (i.e., the organization or individuals within it) that facilitate or impede the adoption process. Directions for future research are suggested. PMID:7118545

  6. Quality assurance as a managerial innovation: a research perspective.

    OpenAIRE

    Kaluzny, A D

    1982-01-01

    Quality assurance is defined and concepts from innovation theory are applied to the study of quality assurance programs. Two distinct although not mutually exclusive perspectives on innovation are considered--the diffusion perspective, focusing on the innovation itself and its implementation, and the adoption perspective, highlighting factors characteristic of the adoption unit (i.e., the organization or individuals within it) that facilitate or impede the adoption process. Directions for fut...

  7. Quality assurance of qualitative analysis

    DEFF Research Database (Denmark)

    Ríos, Ángel; Barceló, Damiá; Buydens, Lutgarde;

    2003-01-01

    and quality assurance. One important part of this document deals, therefore, with aspects involved in analytical quality assurance of qualitative analysis. This article shows the main conclusions reported in the document referring to the implementation of quality principles in qualitative analysis...

  8. Recent Trends in Quality Assurance

    Science.gov (United States)

    Amaral, Alberto; Rosa, Maria Joao

    2010-01-01

    In this paper we present a brief description of the evolution of quality assurance in Europe, paying particular attention to its relationship to the rising loss of trust in higher education institutions. We finalise by analysing the role of the European Commission in the setting up of new quality assurance mechanisms that tend to promote…

  9. Towards improvement in quality assurance

    International Nuclear Information System (INIS)

    This first document in the series of the International Nuclear Safety Advisory Group (INSAG) Technical Notes is a general guideline for the establishment of effective quality assurance procedures at nuclear facilities. It sets out primary requirements such as quality objectives, methods for measuring the effectiveness of the quality assurance programme, priority of activities in relation to importance of safety of items, motivation of personnel

  10. Implementation of a Quality Assurance Program in a new Radiotherapy Center taking as base the TG-40; Implementacion del programa de Garantia de Calidad en un Centro nuevo de Radioterapia tomando como base el TG-40

    Energy Technology Data Exchange (ETDEWEB)

    Marles, A.; Besa, P.; Hecht, P.; Arriagada, L.; Ruz, A.; Garay, C. [Pontificia Universidad Catolica de Chile, Centro de Cancer. Diagonal Paraguay, 319. Santiago (Chile)

    1998-12-31

    The recommended principles in the `Comprehensive QA for radiation oncology: Report of AAPM Radiation Therapy Committee Task Group 40`, TG-40, have been the base for implementation of the Quality Assurance Program of a modern Radiotherapy service. During its application has been necessary: to initiate its implementation before the equipment installation, assuming the costs of the contracts of the qualified personnel, realizing an initial investment adequate for equipment acquisition necessary for acceptation, commissioning and routinary control, the experienced formation of the personnel in the protocol philosophy, establishing procedures for day by day process which would allow the retrofeeding, the elaboration of templates and opening to changes and adjustments according to the necessities. The experience of two years had been demonstrated that the TG-40: a) It is feasible to be implemented but sometimes no strict totally and it is essential to have qualified personnel and the necessary material resources; b) It does not contains all the necessary for its practical implementation and must be completing with procedures and routine formats which facilitate their application; c) It allows the detection and opportune failure correction in the process; d) It is a continuous process that does not finishes. (Author)

  11. Quality assurance in the Antares laser fusion construction project

    International Nuclear Information System (INIS)

    The Antares CO2 laser facility came on line in November 1983 as an experimental physics facility; it is the world's largest CO2 laser fusion system. Antares is a major component of the Department of Energy's Inertial Confinement Fusion Program. Antares is a one-of-a-kind laser system that is used in an experimental environment. Given limited project funds and tight schedules, the quality assurance program was tailored to achieve project goals without imposing oppressive constraints. The discussion will review the Antares quality assurance program and the utility of various portions to completion of the project

  12. Quality assurance for environmental analytical chemistry at Los Alamos

    International Nuclear Information System (INIS)

    The basic structure philosophy of the program as it has evolved over the past five years is discussed with particular emphasis on traceability and use of certified reference materials. Typical summary results of the program and interactive computerized quality assurance system are presented

  13. Ballistic quality assurance

    International Nuclear Information System (INIS)

    This review describes the ballistic quality assurance for stereotactic intracranial irradiation treatments delivered with Gamma KnifeR either dedicated or adapted medical linear accelerators. Specific and periodic controls should be performed in order to check the mechanical stability for both irradiation and collimation systems. If this step remains under the responsibility of the medical physicist, it should be done in agreement with the manufacturer's technical support. At this time, there are no recent published guidelines. With technological developments, both frequency and accuracy should be assessed in each institution according to the treatment mode: single versus hypo-fractionated dose, circular collimator versus micro-multi-leaf collimators. In addition, 'end-to-end' techniques are mandatory to find the origin of potential discrepancies and to estimate the global ballistic accuracy of the delivered treatment. Indeed, they include frames, non-invasive immobilization devices, localizers, multimodal imaging for delineation and in-room positioning imaging systems. The final precision that could be reasonably achieved is more or less 1 mm. (authors)

  14. Workshop on measurement quality assurance for ionizing radiation: Proceedings

    International Nuclear Information System (INIS)

    This workshop was held to review the status of secondary level calibration accreditation programs, review related measurement accreditation programs, document lessons learned, and to present changes in programs due to new national priorities involving radioactivity measurements. Contents include: fundamentals of measurement quality assurance (MQA), standards for MQA programs; perspectives and policies; complete MQA programs; future MQA programs; QA/QC programs--radioactivity; QA/QC programs--dosimetry; laboratory procedures for QA/QC; in-house control of reference dosimetry laboratories; in-house controls of radioactivity laboratories; and poster session. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database

  15. Workshop on measurement quality assurance for ionizing radiation: Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Heath, J.A.; Swinth, K.L. [comps.

    1993-12-31

    This workshop was held to review the status of secondary level calibration accreditation programs, review related measurement accreditation programs, document lessons learned, and to present changes in programs due to new national priorities involving radioactivity measurements. Contents include: fundamentals of measurement quality assurance (MQA), standards for MQA programs; perspectives and policies; complete MQA programs; future MQA programs; QA/QC programs--radioactivity; QA/QC programs--dosimetry; laboratory procedures for QA/QC; in-house control of reference dosimetry laboratories; in-house controls of radioactivity laboratories; and poster session. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database.

  16. High-Assurance Software: LDRD Report.

    Energy Technology Data Exchange (ETDEWEB)

    Hulette, Geoffrey Compton

    2014-06-01

    This report summarizes our work on methods for developing high-assurance digital systems. We present an approach for understanding and evaluating trust issues in digital systems, and for us- ing computer-checked proofs as a means for realizing this approach. We describe the theoretical background for programming with proofs based on the Curry-Howard correspondence, connect- ing the field of logic and proof theory to programs. We then describe a series of case studies, intended to demonstrate how this approach might be adopted in practice. In particular, our stud- ies elucidate some of the challenges that arise with this style of certified programming, including induction principles, generic programming, termination requirements, and reasoning over infinite state spaces.

  17. Mission Assurance Modeling and Simulation: A Cyber Security Roadmap

    Science.gov (United States)

    Gendron, Gerald; Roberts, David; Poole, Donold; Aquino, Anna

    2012-01-01

    This paper proposes a cyber security modeling and simulation roadmap to enhance mission assurance governance and establish risk reduction processes within constrained budgets. The term mission assurance stems from risk management work by Carnegie Mellon's Software Engineering Institute in the late 19905. By 2010, the Defense Information Systems Agency revised its cyber strategy and established the Program Executive Officer-Mission Assurance. This highlights a shift from simply protecting data to balancing risk and begins a necessary dialogue to establish a cyber security roadmap. The Military Operations Research Society has recommended a cyber community of practice, recognizing there are too few professionals having both cyber and analytic experience. The authors characterize the limited body of knowledge in this symbiotic relationship. This paper identifies operational and research requirements for mission assurance M&S supporting defense and homeland security. M&S techniques are needed for enterprise oversight of cyber investments, test and evaluation, policy, training, and analysis.

  18. Quality assurance for radiochemical measurements and monitoring

    International Nuclear Information System (INIS)

    Since 1954, the Environmental Protection Agency (EPA) and its predecessor, the US Public Health Service, has operated an environmental radiation monitoring program in a 100,000 square mile region surrounding the Nevada Test Site and at former nuclear test sites in Alaska, Colorado, New Mexico, and Mississippi. This program is designed to measure levels and trends of radioactivity in the environment surrounding test areas, determine compliance with existing regulations, and protect the health and well-being of the public in the event of any accidental release of radioactive contaminants. Levels of radiation and radioactivity are assessed by sampling water, milk, and air; deploying thermoluminescent dosimeters (TLDs); measurements using pressurized ion chambers (PICs); and biological monitoring of both animals and humans. To ensure that all decisions and actions are supported by environmental measurement of known quality, the EPA requires a locally implemented quality assurance program. Elements of this program include: a quality assurance plan for each of the sampling networks; standard operating procedures for field monitors and analysts; and a routine review of all data by network auditors. To further test the validity of data, the radioanalytical laboratory regularly participates in EPA, Department of Energy (DOE), and World Health Organization (WHO) intercomparison studies

  19. Comprehensive quality assurance for stereotactic radiosurgery treatments

    Energy Technology Data Exchange (ETDEWEB)

    Ramaseshan, R [Radiation Physics Department, Princess Margaret Hospital, University Health Network, 610 University Avenue, Toronto, ON, M5G 2M9 (Canada); Heydarian, M [Department of Radiation Oncology, University of Toronto, Toronto, ON, M5G 2M9 (Canada)

    2003-07-21

    We have used a commercially available high precision Lucy{sup TM} phantom to perform comprehensive quality assurance for stereotactic radiosurgery treatments. The quantitative evaluation of system uncertainties included imaging, planning and treatment delivery systems. The quality assurance tests showed that the well-defined targets were identified to within {+-}1 mm in all the imaging modalities. The pre-known target volumes were reproduced within 2 cm{sup 3} in both MR and CT. The planned target was delivered within 2% of the prescribed dose and to within 2 mm accuracy. The inaccuracy in the isocentre position at the Linac was less than 1.2 mm. The maximum error observed in the depth helmet was 0.5 mm and the overall uncertainty was within 0.23 mm. We have also established a quality assurance program based on the study and proposed the tolerance and the frequency of the tests required to be carried out. The tests were carried out using a Radionics planning system and delivered on a Varian Clinac 2100 linear accelerator machine. These tests also established a base line for future comparisons. (note)

  20. Quality assurance within regulatory bodies

    International Nuclear Information System (INIS)

    The IAEA directed extensive efforts during the years 1991 to 1995 to the integral revision of all NUSS quality assurance publications, which were approved and issued as Safety Series No.50-C/SG-Q, Quality Assurance for Safety in Nuclear Power Plants and other Nuclear Installations (1996). When these quality assurance publications were developed, their prime focus was on requirements against which work performed by the licensees could be measured and assessed by the regulatory bodies. In this way, they only helped to facilitate the functions of regulators. No requirements or recommendations were provided on how the regulators should ensure the effective implementation of their own activities. The present publication is a first attempt to collect, integrate and offer available experience to directly support performance of regulatory activities. It presents a comprehensive compilation on the application of quality assurance principles and methods by regulatory bodies to their activities. The aim is consistent good performance of regulatory activities through a systematic approach

  1. Implementation of a quality assurance program for computerized treatment planning systems according to TRS 430; Implantacao de um programa de controle de qualidade para sistemas de planejamento de tratamento computadorizados de acordo com o TRS 430

    Energy Technology Data Exchange (ETDEWEB)

    Camargo, Priscilla Roberta Tavares Leite

    2006-07-01

    This work presents the guidelines and necessary tests tom implement a quality assurance program for Eclipse 7.3.10 from Varian at Hospital das Clinicas, Sao Paulo University School of Medicine - Brazil, in accordance with the new IAEA publication TRS 430. The recommended tests for the TRS 430 air mainly classified into acceptance tests, commissioning (dosimetric and non-dosimetric tests), and routine tests. The IAEA document's recommendations are being implemented at the hospital for two Varian linear accelerators - Clinac 600C e Clinac 2100C. The acceptance tests verified 'hardware', integration of network systems, data transfer and 'software' parameters. The results obtained are in a good agreement with the manufacturer's specifications. Measurements of absolute dose in several set-ups were made for the commissioning dosimetric tests. These data were compared to the absolute doses determined by the TPS. The great majority of the tests showed 90% to 80% of the analyzed data in acceptance levels, with a good agreement between the experimental data and the data determined by the TPS. Only settings with asymmetric fields presented significant discords, showing the need for a more detailed inquiry for these settings. The non-dosimetric commissioning tests have also presented excellent results, with virtually all the system tools and general performance in compliance with TRS 430. The acceptance criteria have been applied for a comparison between the values of MUs generated by TPS and the calculated manually ones. The beams have been characterized for Eclipse with data transferred from CadPlan and with data from recommissioning of accelerators, so for these tests it was found a difference of at least 3% for the conformal field shape for the data originated in the beams of recommissioning and at least 4% for the data proceeded from CadPlan. The tolerance level established by TRS 430 for this setting was 3%. (author)

  2. Quality Assurance: A Balancing Act

    OpenAIRE

    Žváčková Jitka

    2015-01-01

    Language Centre Quality Assurance can be used for a wide range of purposes, from audits of services and procedures to reflection on best practices and improvements of language education. Quality Assurance systems across Europe differ considerably. The Czech Republic, unlike the UK or Spain, applies no unified national standards, therefore, the Masaryk University Language Centre (CJV MU), in compliance with the Masaryk University strategic plan, is obliged to set its own standards and procedur...

  3. Thoughts on Internal and External Quality Assurance

    Science.gov (United States)

    Zhang, Jianxin

    2012-01-01

    Quality assurance of higher education is made up of two parts: internal quality assurance (IQA) and external quality assurance (EQA). Both belong to a union of the coexistence and balance of yin and yang. But in reality there exists a paradox of "confusion of quality assurance (QA) subject consciousness, singularity of social QA and lack of QA…

  4. Concepts of nuclear quality assurance

    International Nuclear Information System (INIS)

    While the safety record of the nuclear industry continues to be excellent, the forced outage rates for recent years continue to be 15% or more. Quality assurance, therefore, needs to be applied not only to nuclear safety matters, but to the goals of increased productivity and reduced construction and operating costs. Broadening the application of the general concept of quality assurance in this way leads to the introduction of reliability technology. The total activity might better be called reliability assurance. That effective quality assurance systems do pay off is described by examples from the utility industry, from a manufacturer of instruments and systems and from the experience of Westinghouse Electric Company's manufacturing divisions. The special situation of applying quality assurance to nuclear fuel is discussed. Problems include the lack of a fully developed regulatory policy in this area, incomplete understanding of the mechanism for pellet-clad interaction failures, incomplete access to manufacturers design and process information, inability to make desirable changes on a timely basis and inadequate feedback of irradiation experience. (author)

  5. Legacy Management CERCLA Sites. Quality Assurance Project Plan

    International Nuclear Information System (INIS)

    S.M. Stoller Corporation is the contractor for the Technical Assistance Contract (TAC) for the U.S. Department of Energy (DOE) Office of Legacy Management (LM) operations. Stoller employs a management system that applies to all programs, projects, and business management systems funded through DOE-LM task orders. The management system incorporates the philosophy, policies, and requirements of health and safety, environmental compliance, and quality assurance (QA) in all aspects of project planning and implementation. Health and safety requirements are documented in the Health and Safety Manual (STO 2), the Radiological Control Manual (STO 3), the Integrated Safety Management System Description (STO 10), and the Drilling Health and Safety Requirements (STO 14). Environmental compliance policy and requirements are documented in the Environmental Management Program Implementation Manual (STO 11). The QA Program is documented in the Quality Assurance Manual (STO 1). The QA Manual (STO 1) implements the specific requirements and philosophy of DOE Order 414.1C, Quality Assurance. This manual also includes the requirements of other standards that are regularly imposed by customers, regulators, or other DOE orders. Title 10 Code of Federal Regulations Part 830, 'Quality Assurance Requirements', ANSI/ASQC E4-2004, 'Quality Systems for Environmental Data and Technology Programs - Requirements with Guidance for Use', and ISO 14001-2004, 'Environmental Management Systems', have been included. These standards are similar in content. The intent of the QA Manual (STO 1) is to provide a QA management system that incorporates the requirements and philosophy of DOE and other customers within the QA Manual. Criterion 1, 'Quality Assurance Program', identifies the fundamental requirements for establishing and implementing the QA management system; QA Instruction (QAI) 1.1, 'QA Program Implementation', identifies the TAC organizations that have responsibility for implementing the QA

  6. Highly Integrated Quality Assurance – An Empirical Case

    Energy Technology Data Exchange (ETDEWEB)

    Drake Kirkham; Amy Powell; Lucas Rich

    2011-02-01

    Highly Integrated Quality Assurance – An Empirical Case Drake Kirkham1, Amy Powell2, Lucas Rich3 1Quality Manager, Radioisotope Power Systems (RPS) Program, Idaho National Laboratory, P.O. Box 1625 M/S 6122, Idaho Falls, ID 83415-6122 2Quality Engineer, RPS Program, Idaho National Laboratory 3Quality Engineer, RPS Program, Idaho National Laboratory Contact: Voice: (208) 533-7550 Email: Drake.Kirkham@inl.gov Abstract. The Radioisotope Power Systems Program of the Idaho National Laboratory makes an empirical case for a highly integrated Quality Assurance function pertaining to the preparation, assembly, testing, storage and transportation of 238Pu fueled radioisotope thermoelectric generators. Case data represents multiple campaigns including the Pluto/New Horizons mission, the Mars Science Laboratory mission in progress, and other related projects. Traditional Quality Assurance models would attempt to reduce cost by minimizing the role of dedicated Quality Assurance personnel in favor of either functional tasking or peer-based implementations. Highly integrated Quality Assurance adds value by placing trained quality inspectors on the production floor side-by-side with nuclear facility operators to enhance team dynamics, reduce inspection wait time, and provide for immediate, independent feedback. Value is also added by maintaining dedicated Quality Engineers to provide for rapid identification and resolution of corrective action, enhanced and expedited supply chain interfaces, improved bonded storage capabilities, and technical resources for requirements management including data package development and Certificates of Inspection. A broad examination of cost-benefit indicates highly integrated Quality Assurance can reduce cost through the mitigation of risk and reducing administrative burden thereby allowing engineers to be engineers, nuclear operators to be nuclear operators, and the cross-functional team to operate more efficiently. Applicability of this case

  7. Grading of quality assurance requirements

    International Nuclear Information System (INIS)

    The present Manual provides guidance and illustrative examples for applying a method by which graded quality assurance requirements may be determined and adapted to the items and services of a nuclear power plant in conformance with the requirements of the IAEA Nuclear Safety Standards (NUSS) Code and Safety Guides on quality assurance. The Manual replaces the previous publication IAEA-TECDOC-303 on the same subject. Various methods of grading quality assurance are available in a number of Member States. During the development of the present Manual it was not considered practical to attempt to resolve the differences between those methods and it was preferred to identify and benefit from the good practices available in all the methods. The method presented in this Manual deals with the aspects of management, documentation, control, verification and administration which affect quality. 1 fig., 4 tabs

  8. Quality assurance inspections for shipping and storage containers

    Energy Technology Data Exchange (ETDEWEB)

    Stromberg, H.M.; Roberts, G.D.; Bryce, J.H. [Lockheed Idaho Technologies Co., Idaho Falls, ID (United States)

    1996-04-01

    This is a guide for conducting quality assurance inspections of transportation packaging and dry spent fuel storage system suppliers. (Suppliers are defined as designers, fabricators, distributors, users or owners of those packaging and storage systems.) This guide may be used during inspection to determine regulatory compliance with 10 CFR, Part 71, Subpart H; 10 CFR, Part 72, Subpart G; 10 CFR, Part 21; and supplier`s quality assurance program commitments. It was developed to provide a structured, consistent approach to inspections. The guidance therein provides a framework for evaluation of transportation packaging and dry spent fuel storage systems quality assurance programs. Inspectors are provided with the flexibility to adapt the methods and concepts to meet inspection requirements for the particular facility. The method used in the guide treats each activity at a facility as a separate performance element and combines the activities within the framework of an ``inspection tree.``The method separates each performance element into several areas for inspection and identifies guidelines, based on regulatory requirements, to qualitatively evaluate each area. This guide also serves as a field manual to facilitate quality assurance inspection activities. This guide replaces an earlier one, NUREG/CR-5717 (Packing Supplier Inspection Guide). This replacement guide enhances the inspection activities for transportation packagings and adds the dry spent fuel storage system quality assurance inspection activities.

  9. The Science of Mission Assurance

    Directory of Open Access Journals (Sweden)

    Kamal Jabbour

    2011-01-01

    Full Text Available The intent of this article is to describe—and prescribe—a scientific framework for assuring mission essential functions in a contested cyber environment. Such a framework has profound national security implications as the American military increasingly depends on cyberspace to execute critical mission sets. In setting forth this prescribed course of action, the article will first decompose information systems into atomic processes that manipulate information at all six phases of the information lifecycle, then systematically define the mathematical rules that govern mission assurance.

  10. Quality assurance of endoscopy units.

    Science.gov (United States)

    Stebbing, John F

    2011-06-01

    This chapter reflects on how England has led the world in service development and quality assurance of endoscopy. It draws out themes of leadership, strategic vision and organisational culture. It emphasises the pivotal importance of focussing service improvement on enhancing the quality of a patient's experience of endoscopy. It describes the processes used here for quality assurance of endoscopy units and how these have dovetailed with other strands of work in transforming the English endoscopy service. The chapter presents discussion of the responses to accreditation processes and how the design of the JAG Accreditation process maximises its effectiveness. PMID:21764004

  11. Final Hanford Site Transuranic (TRU) Waste Characterization Qualit Assurance Project Plan

    International Nuclear Information System (INIS)

    The Transuranic Waste Characterization Quality Assurance Program Plan required each U.S. Department of Energy (DOE) site that characterizes transuranic waste to be sent the Waste Isolation Pilot Plan that addresses applicable requirements specified in the quality assurance project plan (QAPP)

  12. 40 CFR 75.21 - Quality assurance and quality control requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Quality assurance and quality control... PROGRAMS (CONTINUED) CONTINUOUS EMISSION MONITORING Operation and Maintenance Requirements § 75.21 Quality assurance and quality control requirements. (a) Continuous emission monitoring systems. The owner...

  13. Life Assurance Strategy for CANDU NPP

    International Nuclear Information System (INIS)

    Nuclear Plants have a nominal 'design life' that forms the basis of equipment specification, economic evaluations and licensing for some jurisdictions. Some component in the plant may require replacement, refurbishing and or rehabilitation during the plant 'design life'. Components which are extremely difficult or economically impossible to replace will place a limit on plant life. Rehabilitation programs completed to date on older CANDU plants to improve reliability of plant components, coupled with R and D programs, experimental data and advanced analytical methods form the basis for CANDU plant component life assurance. Life assurance is verified during plant operation by comprehensive in-service inspection programs and laboratory examinations. The paper provides an overview of the experiences to date on Refurbishment and Rehabilitation programs and some Canadian approaches on the main activities involved in scoping and managing nuclear plant life assurance. A number of proactive programs are underway to anticipate, detect and mitigate potential aging degradation at an early stage to ensure plant safety and reliability. Some of these programs include; systematic plant condition assessment, refurbishment and upgrading programs, environmental qualification programs and a program of examination of components from decommissioned reactors. These programs are part of an overall nuclear power plant maintenance strategy. Beyond life assurance, a longer term approach would be geared towards life extension as a viable option for the future. Recent CANDU designs have benefited from the early CANDU experience and are expected to require less rehabilitation. Examples of changes in CANDU 6 include fuel channel design and adopting a closed component cooling water system. New designs are based on 'design life' longer than that used for economic evaluations. The approach is to design for easy replace ability for components that can be economically replaced. Specific examples

  14. Operating the plant, quality assurance, and the job of the operating staff, Volume Twelve

    International Nuclear Information System (INIS)

    Subject matter includes operating the plant (the role of the operator, the control room, plant technical specifications, plant operating procedures, initial startup program, BWR/PWR plant startup, BWR/PWR steady state power operation, BWR/PWR transient operation, emergency operation), quality assurance (what is quality, what is quality control, quality assurance includes quality control, government regulation and quality assurance, administrative controls for nuclear power plants, the necessity of reviews and audits, practical quality assurance), and the job of the operating staff (the plant operating staff, plant safety, first aid and resuscitation, general plant hazards, personnel protective equipment, handling chemicals, handling compressed gas, equipment repair and maintenance, communicating with others

  15. Assurance of Learning and Study Abroad: A Case Study

    Science.gov (United States)

    Rexeisen, Richard J.; Al-Khatib, Jamal

    2009-01-01

    Most academic programs are now held accountable for measuring student-learning outcomes. This article reports the results of an assurance of learning (AOL) project designed to measure the impact of study abroad on the development of ethical reasoning, intercultural sensitivity, and environmental attitudes. The Association to Advance Collegiate…

  16. 42 CFR 440.390 - Assurance of transportation.

    Science.gov (United States)

    2010-10-01

    ... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS SERVICES: GENERAL PROVISIONS Benchmark Benefit and Benchmark-Equivalent Coverage § 440.390 Assurance of transportation. If a benchmark or benchmark-equivalent plan does... the benchmark or benchmark-equivalent plan, as required under § 431.53 of this chapter....

  17. Redefining and expanding quality assurance.

    Science.gov (United States)

    Robins, J L

    1992-12-01

    To meet the current standards of excellence necessary for blood establishments, we have learned from industry that a movement toward organization-wide quality assurance/total quality management must be made. Everyone in the organization must accept responsibility for participating in providing the highest quality products and services. Quality must be built into processes and design systems to support these quality processes. Quality assurance has been redefined to include a quality planning function described as the most effective way of designing quality into processes. A formalized quality planning process must be part of quality assurance. Continuous quality improvement has been identified as the strategy every blood establishment must support while striving for error-free processing as the long-term objective. The auditing process has been realigned to support and facilitate this same objective. Implementing organization-wide quality assurance/total quality management is one proven plan for guaranteeing the quality of the 20 million products that are transfused into 4 million patients each year and for moving toward the new order. PMID:1286566

  18. Quality Assurance 1992-2012

    Science.gov (United States)

    Brown, Roger

    2012-01-01

    As the author's contribution to a series marking the Golden Jubilee of the Association of University Administrators, he reflects on changes in quality assurance over the past twenty years and speculates on what the future may hold for quality as the association moves into a new and very different competitive regime. He begins by discussing the…

  19. Quality assurance during site construction

    International Nuclear Information System (INIS)

    Quality Assurance for Nuclear Power Plants under consideration of pipe assembling. Flow of Quality Requirements during: - Desing - Construction - Procurement - Prefabrication - Site. Organizational Requirements and Measurements during Erection: - Incoming Control - Material Storage - Surveillance of Tools - Weld Surveillance - Nondestructive Testing - Cleaning - Final Documentation. Qualification and Training of QA Personnel. (orig.)

  20. Quality Assurance Systems in Education and Training in Europe

    Science.gov (United States)

    Voinia, Claudiu Sorin; Tuşa, Ana; Simion, Carmen

    2014-11-01

    Member States have a duty to compare and learn more about the national education and professional training. The objectives of this paper were to identify specific characteristics, developments and highlighting key priorities in coordinating the development of specific quality assurance processes in the European Union. The aim of this work was to present the quality assurance systems in vocational education and training systems in the Member States of the European Union. The results were to identify the extent to which national initiatives of EU member States show interest in the quality of education. Data from research can be useful in developing strategic sector development programs, and local schools

  1. Management of government quality assurance functions for NASA contracts

    Science.gov (United States)

    1993-01-01

    This handbook sets forth requirements for NASA direction and management of government quality assurance functions performed for NASA contracts and is applicable to all NASA installations. These requirements will standardize management to provide the minimum oversight and effective use of resources. This handbook implements Federal Acquisition Regulation (FAR) Part 46, NASA FAR Supplement 18-46, Quality Assurance, and NMI 7410.1. Achievement of established quality and reliability goals at all levels is essential to the success of NASA programs. Active participation by NASA and other agency quality assurance personnel in all phases of contract operations, including precontract activity, will assist in the economic and timely achievement of program results. This involves broad participation in design, development, procurement, inspection, testing, and preventive and corrective actions. Consequently, government, as well as industry, must place strong emphasis on the accomplishment of all functions having a significant bearing on quality and reliability from program initiation through end-use of supplies and services produced. For purposes of implementing NASA and other agency agreements, and to provide for uniformity and consistency, the terminology and definitions prescribed herein and in a future handbook shall be utilized for all NASA quality assurance delegations and subsequent redelegations.

  2. Quality assurance for environmental analytical chemistry: 1980

    Energy Technology Data Exchange (ETDEWEB)

    Gladney, E.S.; Goode, W.E.; Perrin, D.R.; Burns, C.E.

    1981-09-01

    The continuing quality assurance effort by the Environmental Surveillance Group is presented. Included are all standard materials now in use, their consensus or certified concentrations, quality control charts, and all quality assurance measurements made by H-8 during 1980.

  3. Chemical identification and its quality assurance

    CERN Document Server

    Milman, Boris L

    2013-01-01

    Chemical Identification and its Quality Assurance shows how to apply the principles of quality assurance for qualitative chemical analysis. The principles of identification and metrological basics are presented, in addition to the reliability and errors involved with chemical identification.

  4. Quality assurance - how to involve the employees

    DEFF Research Database (Denmark)

    Jørgensen, Michael Søgaard

    1996-01-01

    An overview of strategies for involvement of employees in quality assurance developement and implementation.......An overview of strategies for involvement of employees in quality assurance developement and implementation....

  5. Quality assurance manual: Volume 2, Appendices

    International Nuclear Information System (INIS)

    This paper contains quality assurance information on departments of the Stanford Linear Accelerator Center. Particular quality assurance policies and standards discussed are on: Mechanical Systems; Klystron and Microwave Department; Electronics Department; Plant Engineering; Accelerator Department; Purchasing; and Experimental Facilities Department

  6. NIF Projects Controls and Information Systems Software Quality Assurance Plan

    International Nuclear Information System (INIS)

    Quality achievement for the National Ignition Facility (NIF) and the National Ignition Campaign (NIC) is the responsibility of the NIF Projects line organization as described in the NIF and Photon Science Directorate Quality Assurance Plan (NIF QA Plan). This Software Quality Assurance Plan (SQAP) is subordinate to the NIF QA Plan and establishes quality assurance (QA) activities for the software subsystems within Controls and Information Systems (CIS). This SQAP implements an activity level software quality assurance plan for NIF Projects as required by the LLNL Institutional Software Quality Assurance Program (ISQAP). Planned QA activities help achieve, assess, and maintain appropriate quality of software developed and/or acquired for control systems, shot data systems, laser performance modeling systems, business applications, industrial control and safety systems, and information technology systems. The objective of this SQAP is to ensure that appropriate controls are developed and implemented for management planning, work execution, and quality assessment of the CIS organization's software activities. The CIS line organization places special QA emphasis on rigorous configuration control, change management, testing, and issue tracking to help achieve its quality goals.

  7. NIF Projects Controls and Information Systems Software Quality Assurance Plan

    Energy Technology Data Exchange (ETDEWEB)

    Fishler, B

    2011-03-18

    Quality achievement for the National Ignition Facility (NIF) and the National Ignition Campaign (NIC) is the responsibility of the NIF Projects line organization as described in the NIF and Photon Science Directorate Quality Assurance Plan (NIF QA Plan). This Software Quality Assurance Plan (SQAP) is subordinate to the NIF QA Plan and establishes quality assurance (QA) activities for the software subsystems within Controls and Information Systems (CIS). This SQAP implements an activity level software quality assurance plan for NIF Projects as required by the LLNL Institutional Software Quality Assurance Program (ISQAP). Planned QA activities help achieve, assess, and maintain appropriate quality of software developed and/or acquired for control systems, shot data systems, laser performance modeling systems, business applications, industrial control and safety systems, and information technology systems. The objective of this SQAP is to ensure that appropriate controls are developed and implemented for management planning, work execution, and quality assessment of the CIS organization's software activities. The CIS line organization places special QA emphasis on rigorous configuration control, change management, testing, and issue tracking to help achieve its quality goals.

  8. Automating linear accelerator quality assurance

    Energy Technology Data Exchange (ETDEWEB)

    Eckhause, Tobias; Thorwarth, Ryan; Moran, Jean M., E-mail: jmmoran@med.umich.edu [Department of Radiation Oncology, University of Michigan, Ann Arbor, Michigan 48109-5010 (United States); Al-Hallaq, Hania; Farrey, Karl [Department of Radiation Oncology and Cellular Oncology, The University of Chicago, Chicago, Illinois 60637 (United States); Ritter, Timothy [Ann Arbor VA Medical Center, Ann Arbor, Michigan 48109 (United States); DeMarco, John [Department of Radiation Oncology, Cedars-Sinai Medical Center, Los Angeles, California, 90048 (United States); Pawlicki, Todd; Kim, Gwe-Ya [UCSD Medical Center, La Jolla, California 92093 (United States); Popple, Richard [Department of Radiation Oncology, University of Alabama Birmingham, Birmingham, Alabama 35249 (United States); Sharma, Vijeshwar; Park, SungYong [Karmanos Cancer Institute, McLaren-Flint, Flint, Michigan 48532 (United States); Perez, Mario; Booth, Jeremy T. [Royal North Shore Hospital, Sydney, NSW 2065 (Australia)

    2015-10-15

    Purpose: The purpose of this study was 2-fold. One purpose was to develop an automated, streamlined quality assurance (QA) program for use by multiple centers. The second purpose was to evaluate machine performance over time for multiple centers using linear accelerator (Linac) log files and electronic portal images. The authors sought to evaluate variations in Linac performance to establish as a reference for other centers. Methods: The authors developed analytical software tools for a QA program using both log files and electronic portal imaging device (EPID) measurements. The first tool is a general analysis tool which can read and visually represent data in the log file. This tool, which can be used to automatically analyze patient treatment or QA log files, examines the files for Linac deviations which exceed thresholds. The second set of tools consists of a test suite of QA fields, a standard phantom, and software to collect information from the log files on deviations from the expected values. The test suite was designed to focus on the mechanical tests of the Linac to include jaw, MLC, and collimator positions during static, IMRT, and volumetric modulated arc therapy delivery. A consortium of eight institutions delivered the test suite at monthly or weekly intervals on each Linac using a standard phantom. The behavior of various components was analyzed for eight TrueBeam Linacs. Results: For the EPID and trajectory log file analysis, all observed deviations which exceeded established thresholds for Linac behavior resulted in a beam hold off. In the absence of an interlock-triggering event, the maximum observed log file deviations between the expected and actual component positions (such as MLC leaves) varied from less than 1% to 26% of published tolerance thresholds. The maximum and standard deviations of the variations due to gantry sag, collimator angle, jaw position, and MLC positions are presented. Gantry sag among Linacs was 0.336 ± 0.072 mm. The

  9. Automating linear accelerator quality assurance

    International Nuclear Information System (INIS)

    Purpose: The purpose of this study was 2-fold. One purpose was to develop an automated, streamlined quality assurance (QA) program for use by multiple centers. The second purpose was to evaluate machine performance over time for multiple centers using linear accelerator (Linac) log files and electronic portal images. The authors sought to evaluate variations in Linac performance to establish as a reference for other centers. Methods: The authors developed analytical software tools for a QA program using both log files and electronic portal imaging device (EPID) measurements. The first tool is a general analysis tool which can read and visually represent data in the log file. This tool, which can be used to automatically analyze patient treatment or QA log files, examines the files for Linac deviations which exceed thresholds. The second set of tools consists of a test suite of QA fields, a standard phantom, and software to collect information from the log files on deviations from the expected values. The test suite was designed to focus on the mechanical tests of the Linac to include jaw, MLC, and collimator positions during static, IMRT, and volumetric modulated arc therapy delivery. A consortium of eight institutions delivered the test suite at monthly or weekly intervals on each Linac using a standard phantom. The behavior of various components was analyzed for eight TrueBeam Linacs. Results: For the EPID and trajectory log file analysis, all observed deviations which exceeded established thresholds for Linac behavior resulted in a beam hold off. In the absence of an interlock-triggering event, the maximum observed log file deviations between the expected and actual component positions (such as MLC leaves) varied from less than 1% to 26% of published tolerance thresholds. The maximum and standard deviations of the variations due to gantry sag, collimator angle, jaw position, and MLC positions are presented. Gantry sag among Linacs was 0.336 ± 0.072 mm. The

  10. 40 CFR 31.45 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Quality assurance. 31.45 Section 31.45... Requirements Reports, Records, Retention, and Enforcement § 31.45 Quality assurance. If the grantee's project... quality assurance practices consisting of policies, procedures, specifications, standards,...

  11. Final Hanford Site Transuranic (TRU) Waste Characterization Quality Assurance Project Plan

    International Nuclear Information System (INIS)

    The Transuranic Waste Characterization Quality Assurance Program Plan required each US Department of Energy (DOE) site that characterizes transuranic waste to be sent the Waste Isolation Pilot Plan that addresses applicable requirements specified in the QAPP

  12. Power Supplies for Space Systems Quality Assurance by Sandia Laboratories

    Science.gov (United States)

    Hannigan, R. L.; Harnar, R. R.

    1976-07-01

    The Sandia Laboratories` participation in Quality Assurance programs for Radioisotopic Thermoelectric Generators which have been used in space systems over the past 10 years is summarized. Basic elements of this QA program are briefly described and recognition of assistance from other Sandia organizations is included. Descriptions of the various systems for which Sandia has had the QA responsibility are presented, including SNAP 19 (Nimbus, Pioneer, Viking), SNAP 27 (Apollo), Transit, Multi Hundred Watt (LES 8/9 and MJS), and a new program, High Performance Generator Mod 3. The outlook for Sandia participation in RTG programs for the next several years is noted.

  13. Quality assurance in the design

    International Nuclear Information System (INIS)

    System- and product-related quality assurance measures are completing one another. Certainly it is possible to detect a lot of defects in the single technical document by well controlled product related quality inspections and to avoid the consequences of these defects; but also a not unimportant part of defects and deviations has its origin in system linked deficiencies. The latter can be detected more easily and more securely by means of system related reviews (System audit, Product audit). But also the sole implementation of system related quality assurance measures keeps the danger to get stuck only in formality and to loose all references to the specific characteristics of the product. (orig./RW)

  14. Requirement Assurance: A Verification Process

    Science.gov (United States)

    Alexander, Michael G.

    2011-01-01

    Requirement Assurance is an act of requirement verification which assures the stakeholder or customer that a product requirement has produced its "as realized product" and has been verified with conclusive evidence. Product requirement verification answers the question, "did the product meet the stated specification, performance, or design documentation?". In order to ensure the system was built correctly, the practicing system engineer must verify each product requirement using verification methods of inspection, analysis, demonstration, or test. The products of these methods are the "verification artifacts" or "closure artifacts" which are the objective evidence needed to prove the product requirements meet the verification success criteria. Institutional direction is given to the System Engineer in NPR 7123.1A NASA Systems Engineering Processes and Requirements with regards to the requirement verification process. In response, the verification methodology offered in this report meets both the institutional process and requirement verification best practices.

  15. What dentition assures oral function?

    DEFF Research Database (Denmark)

    Gotfredsen, Klaus; Walls, Angus W G

    2007-01-01

    OBJECTIVE: To evaluate the relationship between dentition and oral function. MATERIAL AND METHODS: A search of the English literature was undertaken using PubMed and appropriate keywords. Citations were identified and hand sorted to confirm their validity against our inclusion criteria. Four spec...... for the year 2000, namely to maintain a natural dentition of not less than 20 teeth throughout life, is substantiated by the current literature review as this proposed dentition will assure an acceptable level of oral function....

  16. Role of quality assurance vs project manager's responsibility for waste projects

    International Nuclear Information System (INIS)

    This paper takes a project manager's perspective and discusses the role of the quality assurance organization in the development, implementation and interface related to the QA program for waste projects. The author describes the role which the QA program plays in allowing project management to assure that the project manager knows what is placed in the repository and the characteristics of the surrounding environment meet closure requirements

  17. SAPHIRE 8 Volume 6 - Quality Assurance

    Energy Technology Data Exchange (ETDEWEB)

    C. L. Smith; R. Nims; K. J. Kvarfordt

    2011-03-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) Version 8 is a software application developed for performing a complete probabilistic risk assessment using a personal computer running the Microsoft Windows™ operating system. SAPHIRE 8 is funded by the U.S. Nuclear Regulatory Commission (NRC). The role of the INL in this project is that of software developer and tester. This development takes place using formal software development procedures and is subject to quality assurance (QA) processes. The purpose of this document is to describe how the SAPHIRE software QA is performed for Version 8, what constitutes its parts, and limitations of those processes. In addition, this document describes the Independent Verification and Validation that was conducted for Version 8 as part of an overall QA process.

  18. Quality assurance for particle beam therapy

    International Nuclear Information System (INIS)

    In radiation therapy, it is essential that a prescribed target area is irradiated with the prescribed dose concentration to reduce the possibility cancer reoccurrence or to mitigate its side effects. Particle beam therapy is a high accuracy radiation therapy, which has superior characteristics. Specifically, a high dose region, namely, Bragg peak formed around the beam stopping point can be adjusted to the target volume. The routine of particle beam therapy should be performed with various verifications, called quality assurance(QA), at its each step, i.e., treatment planning, dosimetry, patient positioning and respiratory gating system. Each particle beam therapy facility should have and conduct its own QA program. Methods and materials for the QA should be developed according to the progress of techniques in particle beam therapy. (author)

  19. [Quality and quality assurance, a European problem].

    Science.gov (United States)

    Schmitt, H

    1994-01-01

    The problem of quality and quality assurance for the free exchange of blood and blood products in Europe is discussed. The background of all discussion of quality is the categorical theory of Aristoteles. The philosophical basis is described. The fundamental law of the daily work of a blood center has to be a philosophy of quality which depends on the sociodemographic situation in the region. This basic varies from country to country in Europe. The importance of the supranational bodies in Europe is mentioned. The weightness of the Code of Ethics is discussed. Virus safety, purity and validity of blood and blood products are described as parameters of the quality aspects. Finally it is confirmed that a well running blood program is a multicategorical problem.

  20. Nuclear power plant safety and reliability assurance

    International Nuclear Information System (INIS)

    The philosophy of nuclear power plant safety is that design should follow established and conservative engineering practices, there should be safety margins in all modes of plant operations, special systems should be provided for response to accidents, and safety systems should have redundant components. This philosophy provides ''defense in depth.'' In recent years, with the accumulation of operating experience and the unexpected complexity of the present generation of light water reactors, the defense in depth philosophy has been supplemented by risk and reliability assessments. Reliability assurance programs based on these probabilistic engineering assessments provide a means of integrating design review, maintenance, testing, replacement of parts, failure reporting, and corrective action, so that the protection of the plant and the public can be systematically ensured

  1. Quality assurance of custom software solutions

    OpenAIRE

    Herblan, Miha

    2014-01-01

    In thesis we look at problem of software quality assurance, especially when it comes to custom solutions projects. First we look at what quality assurance is, how do we mesure it and specialty why we do it. Afterwards we go through main principles, that apply when dealing with quality assurance in general. Since quality assurance is extensive topic, we take more detailed look on one part of quality assurance that is mostly used, that is testing of software. Because we are talking about softwa...

  2. An approach to applying quality assurance to nuclear fuel waste disposal

    International Nuclear Information System (INIS)

    An approach to developing and applying a quality assurance program for a nuclear fuel waste disposal facility is described. The proposed program would be based on N286-series standards used for quality assurance programs in nuclear power plants, and would cover all aspects of work across all stages of the project, from initial feasibility studies to final closure of the vault. A quality assurance manual describing the overall quality assurance program and its elements would be prepared at the outset. Planning requirements of the quality assurance program would be addressed in a comprehensive plan for the project. Like the QA manual, this plan would be prepared at the outset of the project and updated at each stage. Particular attention would be given to incorporating the observational approach in procedures for underground engineering, where the ability to adapt designs and mining techniques to changing ground conditions would be essential. Quality verification requirements would be addressed through design reviews, peer reviews, inspections and surveillance, equipment calibration and laboratory analysis checks, and testing programs. Regular audits and program reviews would help to assess the state of implementation, degree of conformance to standards, and effectiveness of the quality assurance program. Audits would be particularly useful in assessing the quality systems of contractors and suppliers, and in verifying the completion of work at the end of stages. Since a nuclear fuel waste disposal project would span a period of about 90 years, a key function of the quality assurance program would be to ensure the continuity of knowledge and the transfer of experience from one stage to another This would be achieved by maintaining a records management system throughout the life of the project, by ensuring that work procedures were documented and kept current with new technologies and practices, and by instituting training programs that made use of experience gained

  3. Assuring Competency in Nuclear Power Plants: Regulatory Policy and Practice

    International Nuclear Information System (INIS)

    approaches to assuring competency, these include: Implementing new programs; Requiring a systematic approach to training (SAT); Responding to audit findings using the IAEA guidelines on training programs; Anticipating and addressing potential problems; Assuring licensee remains an intelligent customer; Assuring competence after organizational changes; Building a new facility: 'pre-regulation' concerns. Outcomes of proactive inspections: Checking on a new regulation; Checking contractor qualifications before an outage; Checking qualifications of managers: two examples; Checking training after a modification; Checking training as part of a quality system review; Outcomes of reactive inspections: In depth evaluation of incident leads to increased attention to competence; Deteriorating performance traced to poor training program; Licensee needs training in root cause analysis; Two licensees lose function that tracks training in safety related positions; The authors noted the following as concluding remarks: Regulators seem to be moving towards more process based regulations and/or process based inspection methods for the oversight of competency. There is increasing attention to training and qualifications of personnel outside of operations, particularly those in maintenance positions. Competency specialists are concerned about the effects of two trends that seem to be increasing - downsizing, and the increased use of contractors. While there is an increased emphasis on human factors areas in nuclear power regulation, there is still an emphasis on technical systems and hardware by regulators and utilities. There is also concern about inadequate availability of expertise in the area of human factors in nuclear power regulators and industry

  4. Underground Test Area Quality Assurance Project Plan Nevada National Security Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Irene Farnham

    2011-05-01

    This Quality Assurance Project Plan (QAPP) provides the overall quality assurance (QA) program requirements and general quality practices to be applied to the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office (NNSA/NSO) Underground Test Area (UGTA) Sub-Project (hereafter the Sub-Project) activities. The requirements in this QAPP are consistent with DOE Order 414.1C, Quality Assurance (DOE, 2005); U.S. Environmental Protection Agency (EPA) Guidance for Quality Assurance Project Plans for Modeling (EPA, 2002); and EPA Guidance on the Development, Evaluation, and Application of Environmental Models (EPA, 2009). The QAPP Revision 0 supersedes DOE--341, Underground Test Area Quality Assurance Project Plan, Nevada Test Site, Nevada, Revision 4.

  5. Developing a Service Oriented Process Management System for University Quality Assurance

    Directory of Open Access Journals (Sweden)

    Prof. Dr. Taher Tawfek Hamza

    2010-01-01

    Full Text Available Quality assurance in universities is an increasing interest in quality and standards reflecting both the growth of higher education and its cost. Institutions should have a policy and associated processes for the assurance of the quality and standards of their programs. To achieve this, institutions should develop and implement a strategy for the continuous enhancement of quality. Formal policies and processes provide a framework within which higher education institutions can develop and monitor the effectiveness of their quality assurance systems.Process management is most suitable model for automating quality assurance in university. Process management isabout modeling, design, execution, and monitoring. In this paper we describe quality assurance process managementsystem built on service oriented architecture (SOA. SOA has been chosen for the transparently, scalability, andIntegrity of this architecture.

  6. Information security assurance lifecycle research

    Institute of Scientific and Technical Information of China (English)

    XIE Cheng-shan; XUJIA Gu-yue; WANG Li

    2007-01-01

    This article proposes that problems of information security are mainly caused by the ineffective integration of people, operation, and technology, and not merely by the poor use of technology. Based on the information lifecycle, a model of the information security assurance lifecycle is presented. The crucial parts of the model are further discussed, with the information risk value and protect level, and the solution in each step of the lifecycle is presented with an ensured information risk level, in term of the integration of people, operation, and technology.

  7. Quality assurance in digital radiography

    International Nuclear Information System (INIS)

    At present, there is no standard way of evaluating performance characteristics of digital radiography systems. Continuous measurements of performance parameters are necessary in order to obtain images of high quality. Parameters of quality assurance in digital radiography, which can be evaluated with simple, quick methods, are spatial resolution, low-contrast detectability, dynamic range and exposure dose. Spatial resolution was determined by a lead bar pattern, whereas the other parameters were measured by commercially available phantoms. Performance measurements of 10 digital subtraction angiography (DSA) units and one digital radiography system for unsubtracted digital radiography were assessed. From these results, recommendations for performance parameter levels will be discussed. (author)

  8. Graded quality assurance in procurement

    International Nuclear Information System (INIS)

    The Code of Federal Regulations, Part 50, Appendix B, requires every applicant for an operating license to include in its final safety analysis report information pertaining to the managerial and administrative controls to be used to ensure safe operation. This appendix establishes quality assurance requirements for the design, construction, and operation of those structures, systems, and components (SSC) that perform safety-related functions. The activities affecting safety-related SSC functions include designing, purchasing, fabricating, and so forth, Title 10 CFR 50.65 established requirements to ensure that the maintenance activities conducted by licensees are effective. This is also known as the maintenance rule

  9. Quality assurance and statistical control

    DEFF Research Database (Denmark)

    Heydorn, K.

    1991-01-01

    In scientific research laboratories it is rarely possible to use quality assurance schemes, developed for large-scale analysis. Instead methods have been developed to control the quality of modest numbers of analytical results by relying on statistical control: Analysis of precision serves...... through the origo. Calibration control is an essential link in the traceability of results. Only one or two samples of pure solid or aqueous standards with accurately known content need to be analyzed. Verification is carried out by analyzing certified reference materials from BCR, NIST, or others...

  10. Performance assurance for IT systems

    CERN Document Server

    King, Brian

    2004-01-01

    INDIVIDUAL AREAS OF INTERESTPreparing for the ChallengeAbstractIntroductionIn the BeginningThe Need to Address New ApplicationsDefinition of PerformanceThe Required SkillsPerformance Assurance Within a Project LifecycleSummaryCaveat Emptor (Let the Buyer Beware)AbstractSoftware Product LifecycleHardware Product LifecycleMarketingTechnical Reviews of ProductsLies, Damned Lies and BenchmarksAbstractIntroductionIndustry BenchmarksVendor BenchmarksIndependent BenchmarkingIn-House Benchmarking""Tricks of the Trade""Using Benchmarks Non-Functional Requirements and SolutionsAbstractIntroductionThe Pr

  11. Radiation Hardness Assurance (RHA) Guideline

    Science.gov (United States)

    Campola, Michael J.

    2016-01-01

    Radiation Hardness Assurance (RHA) consists of all activities undertaken to ensure that the electronics and materials of a space system perform to their design specifications after exposure to the mission space environment. The subset of interests for NEPP and the REAG, are EEE parts. It is important to register that all of these undertakings are in a feedback loop and require constant iteration and updating throughout the mission life. More detail can be found in the reference materials on applicable test data for usage on parts.

  12. Legacy Management CERCLA Sites. Quality Assurance Project Plan

    Energy Technology Data Exchange (ETDEWEB)

    Riddle, Donna L.

    2007-05-03

    S.M. Stoller Corporation is the contractor for the Technical Assistance Contract (TAC) for the U.S. Department of Energy (DOE) Office of Legacy Management (LM) operations. Stoller employs a management system that applies to all programs, projects, and business management systems funded through DOE-LM task orders. The management system incorporates the philosophy, policies, and requirements of health and safety, environmental compliance, and quality assurance (QA) in all aspects of project planning and implementation. Health and safety requirements are documented in the Health and Safety Manual (STO 2), the Radiological Control Manual (STO 3), the Integrated Safety Management System Description (STO 10), and the Drilling Health and Safety Requirements (STO 14). Environmental compliance policy and requirements are documented in the Environmental Management Program Implementation Manual (STO 11). The QA Program is documented in the Quality Assurance Manual (STO 1). The QA Manual (STO 1) implements the specific requirements and philosophy of DOE Order 414.1C, Quality Assurance. This manual also includes the requirements of other standards that are regularly imposed by customers, regulators, or other DOE orders. Title 10 Code of Federal Regulations Part 830, “Quality Assurance Requirements,” ANSI/ASQC E4-2004, “Quality Systems for Environmental Data and Technology Programs – Requirements with Guidance for Use,” and ISO 14001-2004, “Environmental Management Systems,” have been included. These standards are similar in content. The intent of the QA Manual (STO 1) is to provide a QA management system that incorporates the requirements and philosophy of DOE and other customers within the QA Manual. Criterion 1, “Quality Assurance Program,” identifies the fundamental requirements for establishing and implementing the QA management system; QA Instruction (QAI) 1.1, “QA Program Implementation,” identifies the TAC organizations that have responsibility for

  13. Analysis on the Influencing Factors of Food Enterprises Implementing Quality Assurance Program Based on the Theory of Planned Behavior%基于计划行为理论的食品企业实施质量保证项目影响因素分析

    Institute of Scientific and Technical Information of China (English)

    张君; 姜启军

    2015-01-01

    文章通过对上海市219家食品加工制造企业的调研,运用计划行为理论,从获利态度、主观规范和知觉行为控制三方面分析食品企业实施质量保证项目的影响因素,构建 Logistic 回归模型,进行实证研究。研究结果表明,知觉行为控制对质量保证项目实施具有显著负向影响,企业资源禀赋越差、内部运营障碍越大,越不利于质量保证项目的实施;主观规范有显著正向影响,外部不确定性越大,越有利于质量保证项目的实施;获利态度对项目的实施无显著影响。%By the survey of 219 food processing and manufacturing enterprises in Shanghai,this paper constructs a Logistic re-gression model based on the theory of planned behavior and conducts a empirical study on the influencing factors of food enterpri-ses implementing quality assurance program from profitability attitude,subjective norm and perceived behavioral control.The re-sult shows that perceived behavior control has significant negative influence on quality assurance program implementation.The worse the enterprise resources endowment and the greater the obstacle of enterprise internal operation are,the more difficult the implementation of quality assurance program is.Subjective norm has significant positive influence,and greater external uncer-tainty is conducive to the program implementation.However,profitability attitude has no significant effect on it.

  14. Static and Dynamic Quality Assurance by Aspect Oriented Techniques

    OpenAIRE

    Knabe, Christoph

    2010-01-01

    The overall goal of the described research project was to create applicable quality assurance patterns for Java software systems using the aspect-oriented programming language extension AspectJ 5. We tried to develop aspects to check static quality criteria as a variable mutator convention and architectural layering rules. We successfully developed aspects for automating the following dynamic quality criteria: Parameterized Exception Chaining, Comfortable Declaration of Parameterized Exceptio...

  15. Quality assurance in diagnostic ultrasound

    Energy Technology Data Exchange (ETDEWEB)

    Sipilae, Outi, E-mail: outi.sipila@hus.fi [HUS Helsinki Medical Imaging Center, Helsinki University Central Hospital, P.O. Box 340, 00029 HUS (Finland); Mannila, Vilma, E-mail: vilma.mannila@hus.fi [HUS Helsinki Medical Imaging Center, Helsinki University Central Hospital, P.O. Box 340, 00029 HUS (Finland); Department of Physics, University of Helsinki, P.O. Box 64, 00014 Helsinki University (Finland); Vartiainen, Eija, E-mail: eija.vartiainen@hus.fi [HUS Helsinki Medical Imaging Center, Helsinki University Central Hospital, P.O. Box 750, 00029 HUS (Finland)

    2011-11-15

    Objective: To setup a practical ultrasound quality assurance protocol in a large radiological center, results from transducer tests, phantom measurements and visual checks for physical faults were compared. Materials and methods: Altogether 151 transducers from 54 ultrasound scanners, from seven different manufacturers, were tested with a Sonora FirstCall aPerio{sup TM} system (Sonora Medical Systems, Inc., Longmont, CO, USA) to detect non-functional elements. Phantom measurements using a CIRS General Purpose Phantom Model 040 (CIRS Tissue Simulation and Phantom Technology, VA, USA) were available for 135 transducers. The transducers and scanners were also checked visually for physical faults. The percentages of defective findings in these tests were computed. Results: Defective results in the FirstCall tests were found in 17% of the 151 transducers, and in 16% of the 135 transducers. Defective image quality resulted with 15% of the transducers, and 25% of the transducers had a physical flaw. In 16% of the scanners, a physical fault elsewhere than in the transducer was found. Seven percent of the transducers had a concurrent defective result both in the FirstCall test and in the phantom measurements, 8% in the FirstCall test and in the visual check, 4% in the phantom measurements and in the visual check, and 2% in all three tests. Conclusion: The tested methods produced partly complementary results and seemed all to be necessary. Thus a quality assurance protocol is forced to be rather labored, and therefore the benefits and costs must be closely followed.

  16. Quality assurance in the ambulatory care setting.

    Science.gov (United States)

    Tyler, R D

    1989-01-01

    One of the most utilitarian developments in the field of quality assurance in health care has been the introduction of industrial concepts of quality management. These concepts, coupled with buyer demand for accountability, are bringing new perspectives to health care quality assurance. These perspectives provide a new view of quality assurance as a major responsibility and strategic opportunity for management; a competitive and marketable commodity; and a method of improving safety, effectiveness, and satisfaction with medical care.

  17. The design and implementation of state underground storage tank assurance funds

    International Nuclear Information System (INIS)

    Congress has required owners and operators of underground storage tanks (USTs) containing petroleum to demonstrate financial ability to pay for corrective action and third-party liability costs. This paper discusses these state funds. The first section contributes background information on the federal financial responsibility requirements several alternative types of state financial responsibility programs are discussed next: traditional programs that rely on private assurance, state reinsurance programs, and loan and other financial assistance programs. The next section describes variants of state assurance funds, the primary option adopted by state. The final section analyses several major issues faced by state in implementing their UST funds

  18. The Assurance of CHRIST to His followers

    OpenAIRE

    Asumadu-Sarkodie, Samuel

    2012-01-01

    The Assurance of CHRIST to His followers. Assurance: grk. Hupostasis meaning: full and sustained confidence and trust; unwavering conviction. There is a favourite Ghanaian proverb which says "if a naked man says he will clothe you, listen to him quietly". Before someone could assure you of something, he must be self-reliant or independent. Christ Jesus has assured His followers because He is capable, has done it before, continues to do it and will do it. Isaiah 50:4-9a; talks about the qualif...

  19. Professionalism, Profession and Quality Assurance Practitioners in External Quality Assurance Agencies in Higher Education

    Science.gov (United States)

    Cheung, Jordan C. M.

    2015-01-01

    This article seeks to spark a dialectic discussion on the establishment of a set of professional competencies for quality assurance practitioners who serve in external quality assurance agencies in higher education. Such a need is identified due to the shortage of relevant and sufficient coverage in the quality assurance literature. To…

  20. Islay development flow assurance challenges

    Energy Technology Data Exchange (ETDEWEB)

    Helingoe, Mark; Greder, Hugues

    2010-07-01

    The Islay field is located in the Northern North Sea UK sector in the vicinity of the Alwyn Platforms. This gas condensate Brent structure is planned to be developed subsea with first gas in 2011. The main development challenge for this HPHT field comes from the early expected formation water production which is the source of major hydrate related flow assurance issues. As continuous inhibition is not feasible, Total has progressed a development scenario based on seabed conditioning prior to pipe laying so that water can be collected and temporarily inhibited at specific low points after a shut-down. It is also intended to heat trace the pipeline as a back-up solution to avoid hydrate formation. Heat tracing has so far never been implemented in Subsea developments. The Islay pilot could open the path to a new hydrate management philosophy for future developments. (Author)

  1. Handbook of software quality assurance techniques applicable to the nuclear industry

    International Nuclear Information System (INIS)

    Pacific Northwest Laboratory is conducting a research project to recommend good engineering practices in the application of 10 CFR 50, Appendix B requirements to assure quality in the development and use of computer software for the design and operation of nuclear power plants for NRC and industry. This handbook defines the content of a software quality assurance program by enumerating the techniques applicable. Definitions, descriptions, and references where further information may be obtained are provided for each topic

  2. Calibrations and evaluation of the quality assurance during 1999 at the National Laboratory for ionising radiation

    International Nuclear Information System (INIS)

    The Swedish Radiation Protection Institute is the National Laboratory for the dosimetric quantities kerma, absorbed dose and dose equivalent. The activity is based on established calibration procedures and a quality assurance program for the used standards. This report gives a brief summary of the calibrations performed during 1999 and a more detailed description and analysis of the quality assurance during this year. The report makes it easier to draw conclusions about the long-term stability and possible malfunctions

  3. Overview of quality assurance in diagnostic medical x-ray examinations

    International Nuclear Information System (INIS)

    Quality assurance is defined as reduction of patient exposure and improvement in film quality. The history of quality assurance programs is briefly reviewed. The Dental Exposure Normalization Technique for improving dental practices and dental equipment is discussed. Data on exposure of patients to medical radiation show wide variations. Some causes of poor film quality are inconsistent machine output, poor beam alignment, timer inaccuracy, improper film-screen combination, and poor film-screen contact

  4. Handbook of software quality assurance techniques applicable to the nuclear industry

    Energy Technology Data Exchange (ETDEWEB)

    Bryant, J.L.; Wilburn, N.P.

    1987-08-01

    Pacific Northwest Laboratory is conducting a research project to recommend good engineering practices in the application of 10 CFR 50, Appendix B requirements to assure quality in the development and use of computer software for the design and operation of nuclear power plants for NRC and industry. This handbook defines the content of a software quality assurance program by enumerating the techniques applicable. Definitions, descriptions, and references where further information may be obtained are provided for each topic.

  5. Tool Use Within NASA Software Quality Assurance

    Science.gov (United States)

    Shigeta, Denise; Port, Dan; Nikora, Allen P.; Wilf, Joel

    2013-01-01

    As space mission software systems become larger and more complex, it is increasingly important for the software assurance effort to have the ability to effectively assess both the artifacts produced during software system development and the development process itself. Conceptually, assurance is a straightforward idea - it is the result of activities carried out by an organization independent of the software developers to better inform project management of potential technical and programmatic risks, and thus increase management's confidence in the decisions they ultimately make. In practice, effective assurance for large, complex systems often entails assessing large, complex software artifacts (e.g., requirements specifications, architectural descriptions) as well as substantial amounts of unstructured information (e.g., anomaly reports resulting from testing activities during development). In such an environment, assurance engineers can benefit greatly from appropriate tool support. In order to do so, an assurance organization will need accurate and timely information on the tool support available for various types of assurance activities. In this paper, we investigate the current use of tool support for assurance organizations within NASA, and describe on-going work at JPL for providing assurance organizations with the information about tools they need to use them effectively.

  6. 40 CFR 30.54 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, AND OTHER NON-PROFIT ORGANIZATIONS Post-Award Requirements Reports and Records § 30.54 Quality assurance. If the... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Quality assurance. 30.54 Section...

  7. Quality Assurance in Chinese Higher Education

    Science.gov (United States)

    Li, Yuan

    2010-01-01

    Quality assurance has been integrated into the fabric of higher education in China, with the issue of quality in higher education--how to evaluate it and how to enhance it--now taking centre stage in Chinese higher education. In the past decade, the development of quality assurance in Chinese higher education has covered a broad spectrum of…

  8. Quality assurance manual: Volume 2, Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Oijala, J.E.

    1988-06-01

    This paper contains quality assurance information on departments of the Stanford Linear Accelerator Center. Particular quality assurance policies and standards discussed are on: Mechanical Systems; Klystron and Microwave Department; Electronics Department; Plant Engineering; Accelerator Department; Purchasing; and Experimental Facilities Department. (LSP)

  9. 30 CFR 7.7 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Quality assurance. 7.7 Section 7.7 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND APPROVAL OF MINING PRODUCTS TESTING BY APPLICANT OR THIRD PARTY General § 7.7 Quality assurance. Applicants...

  10. 30 CFR 15.8 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Quality assurance. 15.8 Section 15.8 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND APPROVAL OF... § 15.8 Quality assurance. (a) Applicants granted an approval or an extension of approval under...

  11. 40 CFR 194.22 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... COMPLIANCE WITH THE 40 CFR PART 191 DISPOSAL REGULATIONS Compliance Certification and Re-certification General Requirements § 194.22 Quality assurance. (a)(1) As soon as practicable after April 9, 1996, the... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Quality assurance. 194.22 Section...

  12. 30 CFR 14.8 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Quality assurance. 14.8 Section 14.8 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND APPROVAL OF... Quality assurance. Applicants granted an approval or an extension of approval under this Part must: (a)...

  13. 48 CFR 2453.246 - Quality Assurance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Quality Assurance. 2453.246 Section 2453.246 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS FORMS Prescription of Forms 2453.246 Quality Assurance....

  14. 30 CFR 74.9 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... CFR part 51. Persons may obtain a copy from the International Organization for Standardization at the... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Quality assurance. 74.9 Section 74.9 Mineral... DUST SAMPLING DEVICES Requirements for Continuous Personal Dust Monitors § 74.9 Quality assurance....

  15. Quality Assurance in Sub-Saharan Africa

    Science.gov (United States)

    Materu, Peter; Righetti, Petra

    2010-01-01

    This article assesses the status and practice of higher education quality assurance in sub-Saharan Africa, focusing on degree-granting tertiary institutions. A main finding is that structured national-level quality assurance processes in African higher education are a very recent phenomenon and that most countries face major capacity constraints.…

  16. Hungary Higher Education Quality Assurance System

    Directory of Open Access Journals (Sweden)

    Che Ru-shan

    2013-07-01

    Full Text Available Higher education quality assurance system has drawn much attention since 1980s. Most countries are committed to build the higher education quality assurance system to meet international standards. Under such an international trend, Hungary also actively promotes higher education reform, and established Hungarian Accreditation Committee and in order to ensure the quality of higher education.

  17. Quality assurance in the transport of UF{sub 6}

    Energy Technology Data Exchange (ETDEWEB)

    Ravenscroft, N.L. [Edlow International Company, Washington, DC (United States)

    1991-12-31

    Edlow International`s primary business is the international transportation of radioactive materials. Therefore, Edlow has the responsibility to ensure that shipments are performed in compliance with regulatory requirements. In this regard, Edlow maintains a Quality Assurance (QA) Program. A major part of this Program is the establishment and use of QA Procedures. This paper addresses QA procedural requirements and how they are applied to a routine international shipment of low enriched UF{sub 6}. Only the major requirements for scheduling shipments will be addressed.

  18. Technical and quality assurance specifications for dosimetry services

    International Nuclear Information System (INIS)

    The Canadian Atomic Energy Control Board (AECB) requires its licensees to establish a program to determine or estimate the radiation doses received by workers exposed to radiation as a result of the licensee's activities. The determination of radiation dose is a two-part process. First a measurement is made; then this measurement is used in a dosimetric model to calculate the dose. This document is concerned only with the first step of the process. It gives guidance on the technical specifications for dosimetry services and the quality assurance program that provides confidence that these specifications are achieved. (L.L.)

  19. Reinforcing Quality Assurance in Romanian Higher Education

    Directory of Open Access Journals (Sweden)

    Ana-Maria Dima

    2010-07-01

    Full Text Available Since 1993, the quality assurance system in Romania has gained considerable experience. This experience was recently recognized in 2008 by the ENQA: European Association for Quality Assurance in Higher Education through the admission of ARACIS as a full member of EQAR: the European Quality Assurance Register. The Board of ENQA agreed to grant ARACIS’s full membership of ENQA for five years from 2 June 2009. This article explores the benefits of membership for the Romanian Agency for Quality Assurance in Higher Education – ARACIS, comparing to other regional and global quality assurance agencies networks. The common features and differences between ARACIS and other European agencies are questioned through the frameworks of ENQA and INQAAHE as a case study.

  20. EMERGENCY READINESS ASSURANCE PLAN (ERAP) FOR FISCAL YEAR (FY) 2014

    Energy Technology Data Exchange (ETDEWEB)

    Bush, Shane

    2014-09-01

    This Emergency Readiness Assurance Plan (ERAP) for Fiscal Year (FY) 2014 in accordance with DOE O 151.1C, “Comprehensive Emergency Management System.” The ERAP documents the readiness of the INL Emergency Management Program using emergency response planning and preparedness activities as the basis. It describes emergency response planning and preparedness activities, and where applicable, summarizes and/or provides supporting information in tabular form for easy access to data. The ERAP also provides budget, personnel, and planning forecasts for FY-15. Specifically, the ERAP assures the Department of Energy Idaho Operations Office that stated emergency capabilities at INL are sufficient to implement PLN-114, “INL Emergency Plan/RCRA Contingency Plan.

  1. Radiation Dosimetry Management: Quality Assurance and Investigations

    International Nuclear Information System (INIS)

    Full text: In a litigation-prone society, it is prudent for any business to evaluate its potential exposure to legal action, initiated by either an employee or a member of the general public. This potential is exacerbated when the phobia of radiation exposure and radioactive materials is interjected into the equation. This phobia is fuelled by the perceived risks of radiation exposure, be they fact or fantasy. With the current cancer incidence rate being approximately 1 in every 2.5 individuals (for all types of cancer), it is imperative that all facilities take a proactive look at their business vulnerability. When radiation exposure is the issue, records documentation is a critical factor, and a significant amount of effort should be expended to implement a comprehensive records management system. A comprehensive Radiation Dosimetry Management Program is essential if a business is going to mitigate any regulatory or legal intervention. This lecture will address appropriate Records Quality Assurance, and, the appropriate requirements for investigations of dosimetry results. (author)

  2. 40 CFR 144.63 - Financial assurance for plugging and abandonment.

    Science.gov (United States)

    2010-07-01

    ... worth less than 2.0; a ratio of the sum of net income plus depreciation, depletion, and amortization to... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Financial assurance for plugging and... PROGRAMS (CONTINUED) UNDERGROUND INJECTION CONTROL PROGRAM Financial Responsibility: Class I...

  3. Up-Stream Dissolved Oxygen TMDL Project Quality Assurance ProjectPlan

    Energy Technology Data Exchange (ETDEWEB)

    Stringfellow, William T.

    2005-05-13

    A quality assurance project plan (QAPP) for the execution of an ecosystem level monitoring and research program examining algal ecology in highly impaired rivers. Procedures for executing both field and laboratory surface water quality and flow analysis are described. The procedures described here are compatible with the California Surface Water Ambient Monitoring program (SWAMP).

  4. Up-Stream Dissolved Oxygen TMDL Project Quality Assurance Project Plan

    OpenAIRE

    Stringfellow, William T.

    2005-01-01

    A quality assurance project plan (QAPP) for the execution of an ecosystem level monitoring and research program examining algal ecology in highly impaired rivers. Procedures for executing both field and laboratory surface water quality and flow analysis are described. The procedures described here are compatible with the California Surface Water Ambient Monitoring program (SWAMP).

  5. Quality assurance for screening mammography data collection systems in 22 countries.

    NARCIS (Netherlands)

    Klabunde, C.N.; Sancho-Garnier, H.; Broeders, M.E.A.C.; Thoresen, S.; Rodrigues, V.J.; Ballard-Barbash, R.

    2001-01-01

    OBJECTIVES: To document the mammography data that are gathered by the organized screening programs participating in the International Breast Cancer Screening Network (IBSN), the nature of their procedures for data quality assurance, and the measures used to assess program performance and impact. MET

  6. E-Learning Quality Assurance: A Perspective of Business Teacher Educators and Distance Learning Coordinators

    Science.gov (United States)

    Chapman, Betty F.; Henderson, Ronda G.

    2010-01-01

    Background: Business teacher educators and distance learning coordinators have the responsibility to deliver quality online courses and programs. Therefore, they must make sure that quality assurance benchmarks are present in online business education courses and programs. Purpose: The purpose of this study was to examine the extent to which…

  7. Short and medium-term effects of an education self-management program for individuals with osteoarthritis of the knee, designed and delivered by health professionals: A quality assurance study

    OpenAIRE

    Prince Richard; Conroy Heather; Briffa Kathryn; Coleman Sophie; Carroll Graeme; McQuade Jean

    2008-01-01

    Abstract Background Self-management (SM) programs are effective for some chronic conditions, however the evidence for arthritis SM is inconclusive. The aim of this case series project was to determine whether a newly developed specific self-management program for people with osteoarthritis of the knee (OAK), implemented by health professionals could achieve and maintain clinically meaningful improvements. Methods Participants: 79 participants enrolled; mean age 66, with established osteoarthr...

  8. Hanford analytical services quality assurance requirements documents

    Energy Technology Data Exchange (ETDEWEB)

    Hyatt, J.E.

    1997-09-25

    Hanford Analytical Services Quality Assurance Requirements Document (HASQARD) is issued by the Analytical Services, Program of the Waste Management Division, US Department of Energy (US DOE), Richland Operations Office (DOE-RL). The HASQARD establishes quality requirements in response to DOE Order 5700.6C (DOE 1991b). The HASQARD is designed to meet the needs of DOE-RL for maintaining a consistent level of quality for sampling and field and laboratory analytical services provided by contractor and commercial field and laboratory analytical operations. The HASQARD serves as the quality basis for all sampling and field/laboratory analytical services provided to DOE-RL through the Analytical Services Program of the Waste Management Division in support of Hanford Site environmental cleanup efforts. This includes work performed by contractor and commercial laboratories and covers radiological and nonradiological analyses. The HASQARD applies to field sampling, field analysis, and research and development activities that support work conducted under the Hanford Federal Facility Agreement and Consent Order Tri-Party Agreement and regulatory permit applications and applicable permit requirements described in subsections of this volume. The HASQARD applies to work done to support process chemistry analysis (e.g., ongoing site waste treatment and characterization operations) and research and development projects related to Hanford Site environmental cleanup activities. This ensures a uniform quality umbrella to analytical site activities predicated on the concepts contained in the HASQARD. Using HASQARD will ensure data of known quality and technical defensibility of the methods used to obtain that data. The HASQARD is made up of four volumes: Volume 1, Administrative Requirements; Volume 2, Sampling Technical Requirements; Volume 3, Field Analytical Technical Requirements; and Volume 4, Laboratory Technical Requirements. Volume 1 describes the administrative requirements

  9. Assuring Known Good Die (KGD) for reliable, cost effective MCMs

    Science.gov (United States)

    Daskiewich, Daniel E.

    1994-10-01

    A key requirement for achieving high yield multichip modules (MCM's) is assuring that the individual dice are known good devices (KGD). A KGD is defined as a bare die available at the same quality and reliability as the equivalent single chip packaged parts. Integrated circuits (IC's) that are Known Good will function over a specified temperature range, are compatible with the MCM approach utilized, and contain no short-term or long-term reliability hazards. The application of reliability and testability techniques at all levels of MCM development, particularly at the chip level, will maximize MCM yield. Today's testing and qualification requirements, defined by MIL-STD-883 Methods 5008 and 2010, are not capable of assuring KGD as defined above. The development of cost effective requirements for achieving 99.9 percent yields poses a challenge which requires new and novel approaches and better methods for bare die testing, wafer level burn-in, tape automated bonding (TAB), temporary packaging, at-speed device testing at the wafer, die, and MCM level. Also of great importance are the methods for built-in self test (BIST), built-in test (BIT), and boundary scan. New standards in very large scale integration (VLSI) device testing must be developed in order for MCM's to be reliable and economical. Rome Laboratory (RL) has funded a program to address and develop these requirements. The objectives of the RL program are to: research and evaluate current and proposed burn-in, electrical and interconnect test techniques for assuring known good VLSI circuits at wafer and die level; and evaluate various methods of incorporating testability features which will decrease test time and cost. In addition, MCM-level reliability and performance assessment procedures will be evaluated to determine appropriate testing concepts and procedures that will assure the procurement of reliable, cost effective MCM's for DOD/NASA applications. The program consists of two phases: Phase One will

  10. Software quality assurance for safety analysis and risk management at the Savannah River Site

    International Nuclear Information System (INIS)

    As part of its Reactor Operations Improvement Program at the Savannah River Site (SRS), Westinghouse Savannah River Company (WSRC), in cooperation with the Westinghouse Hanford Company, has developed and implemented quality assurance for safety-related software for technical programs essential to the safety and reliability of reactor operations. More specifically, the quality assurance process involved the development and implementation of quality standards and attendant procedures based on industry software quality standards. These procedures were then applied to computer codes in reactor safety and probabilistic risk assessment analyses. This paper provides a review of the major aspects of the WSRC safety-related software quality assurance. In particular, quality assurance procedures are described for the different life cycle phases of the software that include the Requirements, Software Design and Implementation, Testing and Installation, Operation and Maintenance, and Retirement Phases. For each phase, specific provisions are made to categorize the range of activities, the level of responsibilities, and the documentation needed to assure the control of the software. The software quality assurance procedures developed and implemented are evolutionary in nature, and thus, prone to further refinements. These procedures, nevertheless, represent an effective controlling tool for the development, production, and operation of safety-related software applicable to reactor safety and probabilistic risk assessment analyses

  11. Medical aspects of quality assurance in the United States

    International Nuclear Information System (INIS)

    Three powerful national programs have been developed, and their acceptance and utilization in the United States have been accelerated by the recent development of managed competition. The first program was a model quality assurance program for day to day use in an individual radiation oncology facility. In addition to maintaining the physical aspects of the department, the medical side includes indicator items in patient evaluation and treatment and other measures that are periodically monitored. The entire process is comprehensive and is accepted by the Joint Commission on Hospital Accreditation as being satisfactory evidence of ongoing quality assurance and quality improvement. The second program was the development of a set of standards for radiation oncology in the United States. These standards were developed in the past and have recently been expanded into a more comprehensive document that describes the appropriate performance by this specialty. The third program was a Practice Accreditation program. The Practice Accreditation program is an on-site review of structure and processes of patient care by a radiation oncologist and data manager. This intense on-site review generated data that is then compared to similar facilities and to national averages to judge the adequacy of patient management in the facility. We have observed recently that various managed care programs require this practice accreditation before their patients can be treated in contracting facilities. Lastly, the Council of the American College of Radiology has made some extremely positive statements in support of improving radiation oncology practice, and the positive effects of these council resolutions can be clearly shown on the practice

  12. NOTE: Comprehensive quality assurance for stereotactic radiosurgery treatments

    Science.gov (United States)

    Ramaseshan, R.; Heydarian, M.

    2003-07-01

    We have used a commercially available high precision LucyTM phantom to perform comprehensive quality assurance for stereotactic radiosurgery treatments. The quantitative evaluation of system uncertainties included imaging, planning and treatment delivery systems. The quality assurance tests showed that the well-defined targets were identified to within +/-1 mm in all the imaging modalities. The pre-known target volumes were reproduced within 2 cm3 in both MR and CT. The planned target was delivered within 2% of the prescribed dose and to within 2 mm accuracy. The inaccuracy in the isocentre position at the Linac was less than 1.2 mm. The maximum error observed in the depth helmet was 0.5 mm and the overall uncertainty was within 0.23 mm. We have also established a quality assurance program based on the study and proposed the tolerance and the frequency of the tests required to be carried out. The tests were carried out using a Radionics planning system and delivered on a Varian Clinac 2100 linear accelerator machine. These tests also established a base line for future comparisons.

  13. Large hadron collider (LHC) project quality assurance plan

    Energy Technology Data Exchange (ETDEWEB)

    Gullo, Lisa; Karpenko, Victor; Robinson, Kem; Turner, William; Wong, Otis

    2002-09-30

    The LHC Quality Assurance Plan is a set of operating principles, requirements, and practices used to support Berkeley Lab's participation in the Large Hadron Collider Project. The LHC/QAP is intended to achieve reliable, safe, and quality performance in the LHC project activities. The LHC/QAP is also designed to fulfill the following objectives: (1) The LHC/QAP is Berkeley Lab's QA program document that describes the elements necessary to integrate quality assurance, safety management, and conduct of operations into the Berkeley Lab's portion of the LHC operations. (2) The LHC/QAP provides the framework for Berkeley Lab LHC Project administrators, managers, supervisors, and staff to plan, manage, perform, and assess their Laboratory work. (3) The LHC/QAP is the compliance document that conforms to the requirements of the Laboratory's Work Smart Standards for quality assurance (DOE O 414.1, 10 CFR 830.120), facility operations (DOE O 5480.19), and safety management (DOE P 450.4).

  14. Large hadron collider (LHC) project quality assurance plan

    International Nuclear Information System (INIS)

    The LHC Quality Assurance Plan is a set of operating principles, requirements, and practices used to support Berkeley Lab's participation in the Large Hadron Collider Project. The LHC/QAP is intended to achieve reliable, safe, and quality performance in the LHC project activities. The LHC/QAP is also designed to fulfill the following objectives: (1) The LHC/QAP is Berkeley Lab's QA program document that describes the elements necessary to integrate quality assurance, safety management, and conduct of operations into the Berkeley Lab's portion of the LHC operations. (2) The LHC/QAP provides the framework for Berkeley Lab LHC Project administrators, managers, supervisors, and staff to plan, manage, perform, and assess their Laboratory work. (3) The LHC/QAP is the compliance document that conforms to the requirements of the Laboratory's Work Smart Standards for quality assurance (DOE O 414.1, 10 CFR 830.120), facility operations (DOE O 5480.19), and safety management (DOE P 450.4)

  15. 40 CFR 191.14 - Assurance requirements.

    Science.gov (United States)

    2010-07-01

    ..., HIGH-LEVEL AND TRANSURANIC RADIOACTIVE WASTES Environmental Standards for Disposal § 191.14 Assurance... Commission (see 10 CFR Part 60 for comparable provisions applicable to facilities regulated by the...

  16. Evaluation of financial assurance alternatives of licensees

    International Nuclear Information System (INIS)

    The Uranium and Thorium Mining Regulations of the Atomic Energy Control Act require that applicants/licensees indicate to the AECB what financial assurance plans they have made to fund the decommissioning plan they propose to put in place. We have determined through our own business knowledge from other projects, as well as information provided by contacts in the banking, accounting, legal, investment and insurance communities, what financial assurance plans might be available. We have tabulated these alternatives, included explanations of how each might be implemented, and recorded advantages and disadvantages of each alternative to both the AECB and the applicant/licensee. In addition we have ranked the alternatives in order of most suitable to least suitable, from the AECB's perspective. Although these financial assurance mechanisms have been tabulated with a view to decommissioning of a uranium mine, they could be used in other licence or business arrangements that require financial assurance. (author). 3 tabs., 1 fig

  17. Causal Models for Safety Assurance Technologies Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Fulfillment of NASA's System-Wide Safety and Assurance Technology (SSAT) project at NASA requires leveraging vast amounts of data into actionable knowledge. Models...

  18. International Thermonuclear Experimental Reactor U.S. Home Team Quality Assurance Plan

    Energy Technology Data Exchange (ETDEWEB)

    Sowder, W. K.

    1998-10-01

    The International Thermonuclear Experimental Reactor (ITER) project is unique in that the work is divided among an international Joint Central Team and four Home Teams, with the overall responsibility for the quality of activities performed during the project residing with the ITER Director. The ultimate responsibility for the adequacy of work performed on tasks assigned to the U.S. Home Team resides with the U.S. Home Team Leader and the U.S. Department of Energy Office of Fusion Energy (DOE-OFE). This document constitutes the quality assurance plan for the ITER U.S. Home Team. This plan describes the controls exercised by U.S. Home Team management and the Performing Institutions to ensure the quality of tasks performed and the data developed for the Engineering Design Activities assigned to the U.S. Home Team and, in particular, the Research and Development Large Projects (7). This plan addresses the DOE quality assurance requirements of 10 CFR 830.120, "Quality Assurance." The plan also describes U.S. Home Team quality commitments to the ITER Quality Assurance Program. The ITER Quality Assurance Program is based on the principles described in the International Atomic Energy Agency Standard No. 50-C-QA, "Quality Assurance for Safety in Nuclear Power Plants and Other Nuclear Facilities." Each commitment is supported with preferred implementation methodology that will be used in evaluating the task quality plans to be submitted by the Performing Institutions. The implementing provisions of the program are based on guidance provided in American National Standards Institute/American Society of Mechanical Engineers NQA-1 1994, "Quality Assurance." The individual Performing Institutions will implement the appropriate quality program provisions through their own established quality plans that have been reviewed and found to comply with U.S. Home Team quality assurance plan commitments to the ITER Quality Assurance Program. The extent of quality program provisions

  19. Dose Assurance in Radiation Processing Plants

    DEFF Research Database (Denmark)

    Miller, Arne; Chadwick, K.H.; Nam, J.W.

    1983-01-01

    Radiation processing relies to a large extent on dosimetry as control of proper operation. This applies in particular to radiation sterilization of medical products and food treatment, but also during development of any other process. The assurance that proper dosimetry is performed at the...... radiation processing plant can be obtained through the mediation of an international organization, and the IAEA is now implementing a dose assurance service for industrial radiation processing....

  20. Dose assurance in radiation processing plants

    International Nuclear Information System (INIS)

    Radiation processing relies to a large extent on dosimetry as control of proper operation. This applies in particular to radiation sterilization of medical products and food treatment, but also during development of any other process. The assurance that proper dosimetry is performed at the radiation processing plant can be obtained through the mediation of an international organization, and the IAEA is now implementing a dose assurance service for industrial radiation processing. (author)

  1. Dose assurance in radiation processing plants

    Science.gov (United States)

    Miller, A.; Chadwick, K. H.; Nam, J. W.

    Radiation processing relies to a large extent on dosimetry as control of proper operation. This applies in particular to radiation sterilization of medical products and food treatment, but also during development of any other process. The assurance that proper dosimetry is performed at the radiation processing plant can be obtained through the mediation of an international organization, and the IAEA is now implementing a dose assurance service for industrial radiation processing.

  2. Flow assurance studies for CO2 transport

    OpenAIRE

    Veltin, J.; Belfroid, S.P.C.

    2013-01-01

    In order to compensate for the relative lack of experience of the CCTS community, Flow Assurance studies of new CO2 pipelines and networks are a very important step toward reliable operation. This report details a typical approach for Flow Assurance study of CO2 transport pipeline. Considerations to take during the design of a pipeline are highlighted, with an emphasis on operability of the system. The steady state aspects of a pipeline operation are first addressed, putting some highlight in...

  3. Not Convinced: Lecturers' Conceptions of Quality Assurance

    OpenAIRE

    Sullivan, Hugh

    2012-01-01

    This dissertation is an investigation into how lecturers' conceptions of quality differ from the way quality is constructed by the quality assurance systems and procedures responsible for it. Lecturers opinions about these systems are also explored. Primary research was conducted in a research intensive Irish University with a view to uncovering lecturers' views about quality assurance. This was done through semistructured interviews which were then thematically analysed and compared with...

  4. Fault Management Architectures and the Challenges of Providing Software Assurance

    Science.gov (United States)

    Savarino, Shirley; Fitz, Rhonda; Fesq, Lorraine; Whitman, Gerek

    2015-01-01

    The satellite systems Fault Management (FM) is focused on safety, the preservation of assets, and maintaining the desired functionality of the system. How FM is implemented varies among missions. Common to most is system complexity due to a need to establish a multi-dimensional structure across hardware, software and operations. This structure is necessary to identify and respond to system faults, mitigate technical risks and ensure operational continuity. These architecture, implementation and software assurance efforts increase with mission complexity. Because FM is a systems engineering discipline with a distributed implementation, providing efficient and effective verification and validation (VV) is challenging. A breakout session at the 2012 NASA Independent Verification Validation (IVV) Annual Workshop titled VV of Fault Management: Challenges and Successes exposed these issues in terms of VV for a representative set of architectures. NASA's IVV is funded by NASA's Software Assurance Research Program (SARP) in partnership with NASA's Jet Propulsion Laboratory (JPL) to extend the work performed at the Workshop session. NASA IVV will extract FM architectures across the IVV portfolio and evaluate the data set for robustness, assess visibility for validation and test, and define software assurance methods that could be applied to the various architectures and designs. This work focuses efforts on FM architectures from critical and complex projects within NASA. The identification of particular FM architectures, visibility, and associated VVIVV techniques provides a data set that can enable higher assurance that a satellite system will adequately detect and respond to adverse conditions. Ultimately, results from this activity will be incorporated into the NASA Fault Management Handbook providing dissemination across NASA, other agencies and the satellite community. This paper discusses the approach taken to perform the evaluations and preliminary findings from the

  5. Programs.

    Science.gov (United States)

    Community College Journal, 1996

    1996-01-01

    Includes a collection of eight short articles describing model community college programs. Discusses a literacy program, a mobile computer classroom, a support program for at-risk students, a timber-harvesting program, a multimedia presentation on successful women graduates, a career center, a collaboration with NASA, and an Israeli engineering…

  6. A process for establishing a financial assurance plan for LLW disposal facilities

    International Nuclear Information System (INIS)

    This document describes a process by which an effective financial assurance program can be developed for new low-level radioactive waste (LLW) disposal facilities. The report identifies examples of activities that might cause financial losses and the types of losses they might create, discusses mechanisms that could be used to quantify and ensure against the various types of potential losses identified and describes a decision process to formulate a financial assurance program that takes into account the characteristics of both the potential losses and available mechanisms. A sample application of the concepts described in the report is provided

  7. A process for establishing a financial assurance plan for LLW disposal facilities

    Energy Technology Data Exchange (ETDEWEB)

    Smith, P. [EG and G Idaho, Inc., Idaho Falls, ID (United States). National Low-Level Waste Management Program

    1993-04-01

    This document describes a process by which an effective financial assurance program can be developed for new low-level radioactive waste (LLW) disposal facilities. The report identifies examples of activities that might cause financial losses and the types of losses they might create, discusses mechanisms that could be used to quantify and ensure against the various types of potential losses identified and describes a decision process to formulate a financial assurance program that takes into account the characteristics of both the potential losses and available mechanisms. A sample application of the concepts described in the report is provided.

  8. Quality assurance in performance assessments

    Energy Technology Data Exchange (ETDEWEB)

    Maul, P.R.; Watkins, B.M.; Salter, P.; Mcleod, R [QuantiSci Ltd, Henley-on-Thames (United Kingdom)

    1999-01-01

    Following publication of the Site-94 report, SKI wishes to review how Quality Assurance (QA) issues could be treated in future work both in undertaking their own Performance Assessment (PA) calculations and in scrutinising documents supplied by SKB (on planning a repository for spent fuels in Sweden). The aim of this report is to identify the key QA issues and to outline the nature and content of a QA plan which would be suitable for SKI, bearing in mind the requirements and recommendations of relevant standards. Emphasis is on issues which are specific to Performance Assessments for deep repositories for radioactive wastes, but consideration is also given to issues which need to be addressed in all large projects. Given the long time over which the performance of a deep repository system must be evaluated, the demonstration that a repository is likely to perform satisfactorily relies on the use of computer-generated model predictions of system performance. This raises particular QA issues which are generally not encountered in other technical areas (for instance, power station operations). The traceability of the arguments used is a key QA issue, as are conceptual model uncertainty, and code verification and validation; these were all included in the consideration of overall uncertainties in the Site-94 project. Additionally, issues which are particularly relevant to SKI include: How QA in a PA fits in with the general QA procedures of the organisation undertaking the work. The relationship between QA as applied by the regulator and the implementor of a repository development programme. Section 2 introduces the discussion of these issues by reviewing the standards and guidance which are available from national and international organisations. This is followed in Section 3 by a review of specific issues which arise from the Site-94 exercise. An outline procedure for managing QA issues in SKI is put forward as a basis for discussion in Section 4. It is hoped that

  9. Quality Assurance in Physical Education

    Science.gov (United States)

    Richards, K. Andrew R.; Wilson, Wesley J.

    2012-01-01

    In an economic and political climate marked by the continued reduction of physical education programs, the authors believe that advocacy is now a professional responsibility that all physical educators have a duty to perform. Despite support from the Centers for Disease Control and Prevention (2010), the National Association for Sport and Physical…

  10. Study on the Operating Mechanism and Practice concerning Undergraduate Teaching Quality Assurance in the Chinese Agriculture-related Colleges and Universities

    OpenAIRE

    Shen, Zhongming

    2015-01-01

    This paper analyzes the connotation of the undergraduate teaching quality assurance system in agriculture-related colleges and universities, and takes Southwest University Rongchang Campus for example to probe into the long-term operating mechanism of multidimensional integrated quality assurance system as well as the sound teaching quality monitoring and management system building assurance system and operational practice effect involving personnel training programs, teaching element control...

  11. Geography Undergraduate Program Assessment

    Science.gov (United States)

    Estaville, Lawrence E.; Brown, Brock J.; Caldwell, Sally

    2006-01-01

    Assessment of geography undergraduate programs, which incorporate external reviews and concomitant departmental self-studies, attempt to assure pedagogical excellence within uncompromising commitments to successful student learning outcomes, currency of the knowledge and skills imparted, and continuous programmatic improvement. Programmatic…

  12. Isotopic power supplies for space and terrestrial systems: quality assurance by Sandia National Laboratories

    Energy Technology Data Exchange (ETDEWEB)

    Hannigan, R.L.; Harnar, R.R.

    1981-09-01

    The Sandia National Laboratories participation in Quality Assurance (QA) programs for Radioisotopic Thermoelectric Generators which have been used in space and terrestrial systems over the past 15 years is summarized. Basic elements of the program are briefly described and recognition of assistance from other Sandia organizations is included. Descriptions of the various systems for which Sandia has had the QA responsibility are also presented. In addition, the outlook for Sandia participation in RTG programs for the next several years is noted.

  13. Quality assurance strategies in hospitals: Development, implementation and impact of quality assurance methods in Iranian hospitals

    NARCIS (Netherlands)

    A. Aghaei Hashjin

    2015-01-01

    This thesis concentrates on the subject of quality assurance strategies in hospitals; exploring the development, implementation and impact of quality assurance (QA) methods in Iranian hospitals. A series of descriptive and analytical studies using qualitative and quantitative data were performed. Th

  14. Seeking legitimacy for new assurance forms: The case of assurance on sustainability reporting

    NARCIS (Netherlands)

    B. O'Dwyer; D. Owen; J. Unerman

    2011-01-01

    Based on the development of a more refined conception of legitimacy than has been used in prior audit/assurance and sustainability accounting research, this paper analyses how the legitimation processes adopted by sustainability assurance practitioners in a large professional services firm have co-e

  15. US nuclear regulatory commission quality assurance roles and responsibilities for radioactive material transport

    International Nuclear Information System (INIS)

    The U.S. Nuclear Regulatory Commission's regulations include requirements for quality assurance (QA) programs for entities that engage in activities involving the transportation of radioactive materials in Type B and fissile material packages. Prior to commencing activities subject to the QA requirements, a QA program description must be submitted to the NRC for review and approval. The QA program user must also develop implementing procedures for the user's QA program to ensure compliance with the NRC's QA requirements. The NRC conducts independent periodic inspections of QA program users to assess the adequacy of program implementation

  16. U.S. Nuclear Regulatory Commission quality assurance roles and responsibilities for radioactive material transport

    International Nuclear Information System (INIS)

    The U.S. Nuclear Regulatory Commission's regulations include requirements for quality assurance (QA) programs for entities that engage in activities involving the transportation of radioactive materials in Type B and fissile material packages. Prior to commencing activities subject to the QA requirements, a QA program description must be submitted to the NRC for review and approval. The QA program user must also develop implementing procedures for the user's QA program to ensure compliance with the NRC's QA requirements. The NRC conducts independent periodic safety and compliance inspections of QA program users to assess the adequacy of program implementation. (author)

  17. Quality-assurance plan for water-resources activities of the U.S. Geological Survey in Idaho

    Science.gov (United States)

    Packard, F.A.

    1996-01-01

    To ensure continued confidence in its products, the Water Resources Division of the U.S. Geological Survey implemented a policy that all its scientific work be performed in accordance with a centrally managed quality-assurance program. This report establishes and documents a formal policy for current (1995) quality assurance within the Idaho District of the U.S. Geological Survey. Quality assurance is formalized by describing district organization and operational responsibilities, documenting the district quality-assurance policies, and describing district functions. The districts conducts its work through offices in Boise, Idaho Falls, Twin Falls, Sandpoint, and at the Idaho National Engineering Laboratory. Data-collection programs and interpretive studies are conducted by two operating units, and operational and technical assistance is provided by three support units: (1) Administrative Services advisors provide guidance on various personnel issues and budget functions, (2) computer and reports advisors provide guidance in their fields, and (3) discipline specialists provide technical advice and assistance to the district and to chiefs of various projects. The district's quality-assurance plan is based on an overall policy that provides a framework for defining the precision and accuracy of collected data. The plan is supported by a series of quality-assurance policy statements that describe responsibilities for specific operations in the district's program. The operations are program planning; project planning; project implementation; review and remediation; data collection; equipment calibration and maintenance; data processing and storage; data analysis, synthesis, and interpretation; report preparation and processing; and training. Activities of the district are systematically conducted under a hierarchy of supervision an management that is designed to ensure conformance with Water Resources Division goals quality assurance. The district quality-assurance

  18. Safety Assurance in NextGen

    Science.gov (United States)

    HarrisonFleming, Cody; Spencer, Melissa; Leveson, Nancy; Wilkinson, Chris

    2012-01-01

    The generation of minimum operational, safety, performance, and interoperability requirements is an important aspect of safely integrating new NextGen components into the Communication Navigation Surveillance and Air Traffic Management (CNS/ATM) system. These requirements are used as part of the implementation and approval processes. In addition, they provide guidance to determine the levels of design assurance and performance that are needed for each element of the new NextGen procedures, including aircraft, operator, and Air Navigation and Service Provider. Using the enhanced Airborne Traffic Situational Awareness for InTrail Procedure (ATSA-ITP) as an example, this report describes some limitations of the current process used for generating safety requirements and levels of required design assurance. An alternative process is described, as well as the argument for why the alternative can generate more comprehensive requirements and greater safety assurance than the current approach.

  19. A pioneering application of NQA-1 quality assurance standards in the development of software

    International Nuclear Information System (INIS)

    One reason for systematically applying quality assurance to computer software is the extensive use of results from computer programs to characterize potential sited for nuclear waste repositories leading ultimately to important policy making decisions. Because data from these programs characterize the likely radioactivity profile for many hundreds of years, experimental validation is not feasible. The Sensitivity and Uncertainty Analysis Methods Development Project (SUAMDP) was developed to formulate and utilize efficient and comprehensive methods for determining sensitivities of calculated results with respect to changes in all input parameters. The computerized methodology was embodied in the Gradient Enhanced Software System (GRESS). Due to the fact that GRESS was to be used in the site characterization for waste storage, stringent NQA-1 requirements were imposed by the sponsor. A working relationship between the Oak Ridge National Laboratory (ORNL) Quality Department and the research scientists developing GRESS was essential in achieving understanding and acceptance of the quality assurance requirements as applied to the SUAMDP. The relationship resulted in the SUAMDP becoming the first software project at ORNL to develop a comprehensive NQA-1 Quality Assurance Plan; this plan now serves as a model for software quality assurance at ORNL. This paper describes the evolution of this plan and its impact on the application of quality assurance procedures to software. 2 refs

  20. Quality assurance plan for the Objective Supply Capability Adaptive Redesign (OSCAR) project

    Energy Technology Data Exchange (ETDEWEB)

    Stewart, K.A.; Rasch, K.A.; Reid, R.W.

    1996-11-01

    This document establishes the Quality Assurance Plan (QAP) for the National Guard Bureau Objective Supply Capability Adaptive Redesign (OSCAR) project activities under the Oak Ridge National Laboratory (ORNL) management. It defines the requirements and assigns responsibilities for ensuring, with a high degree of confidence, that project objectives will be achieved as planned. The QAP outlined herein is responsive to and meets the Quality Assurance Program standards for the U.S. Department of Energy (DOE), Lockheed Martin Energy Research Corporation and ORNL and the ORNL Computing, Robotics, and Education Directorate (CRE). This document is intended to be in compliance with DOE Order 5700.6C, Quality Assurance Program, and the ORNL Standard Practice Procedure, SPP X-QA-8, Quality Assurance for ORNL Computing Software. This standard allows individual organizations to apply the stated requirements in a flexible manner suitable to the type of activity involved. Section I of this document provides an introduction to the OSCAR project QAP; Sections 2 and 3 describe the specific aspects of quality assurance as applicable to the OSCAR project. Section 4 describes the project approach to risk management. The Risk Management Matrix given in Appendix A is a tool to assess, prioritize, and prevent problems before they occur. Therefore, the matrix will be reviewed and revised on a periodic basis.

  1. Quality assurance program of a respiratory gating irradiation system based on external and internal fiducial markers; Programa de garantia de calidad de un sistema de irradiacion con control respiratorio basado en marcadores fiduciales externos e internos

    Energy Technology Data Exchange (ETDEWEB)

    Zucca Aparicio, D.; Perez Moreno, J. M.; Fernandez Leton, P.; Garcia Ruiz-Zorrilla, J.; Minambres Moro, A.

    2011-07-01

    Respiratory Gating involves the administration of radiation during treatment delivery within a particular portion of the patients breathing cycle, so the absorbed dose administration with respiratory control techniques requires specific quality control to ensure the correctness of the delivered dose. The establishment of a Quality Control Program (QC) is proposed for the Respiratory Gating based techniques in order to have a better understanding of how this system works and to know its associated dosimetric impact. The influence of the CT acquisition under respiratory motion conditions has been analyzed for the treatment isocenter localization, using internal and external fiducial markers with IGRT techniques that allow the correlation of the isocenter positioning with the phase of the respiratory cycle. Radiation delivery in the presence of intra fraction organ motion causes an averaging or blurring of the static dose distribution over the path of motion increasing the beam penumbra of the radiation field and reducing the therapeutic region when the irradiation is not breath controlled. The feasibility of intensity modulated treatments (IMRT) for both static and dynamic techniques, managed by respiratory control has been tested, demonstrating the possibility of synchronizing the movement of the leaves in the microfluorimeter collimator (mMLC) with the gated beam irradiation. (Author) 45 refs.

  2. Adopting Self-Accreditation in Response to the Diversity of Higher Education: Quality Assurance in Taiwan and Its Impact on Institutions

    Science.gov (United States)

    Chen, Karen Hui-Jung; Hou, Angela Yung-Chi

    2016-01-01

    In 2012, Taiwan implemented a dual-track quality assurance system comprising accreditation and self-accreditation in higher education institutions. Self-accrediting institutions can accredit their programs without requiring approval from external quality assurance agencies. In contrast to other countries, the Ministry of Education of Taiwan…

  3. 78 FR 41075 - Federal Housing Administration (FHA): Single Family Quality Assurance-Solicitation of Information...

    Science.gov (United States)

    2013-07-09

    ... URBAN DEVELOPMENT Federal Housing Administration (FHA): Single Family Quality Assurance--Solicitation of... process (QAP). The objective of FHA's QAP is to promote quality lending practices by FHA's approved...://portal.hud.gov/hudportal/HUD?src=/program_offices/administration/hudclips/handbooks/hsgh/4060.1 ....

  4. Experiencing and Measuring the Unteachable: Achieving AACSB Learning Assurance Requirements in Business Ethics

    Science.gov (United States)

    Lawrence, Katherine E.; Reed, Kendra L.; Locander, William

    2011-01-01

    The AACSB requires continuous improvement of business school outcomes through a comprehensive Assurance of Learning program. Measuring ethical decision making poses an interesting challenge for schools making it central to their mission. The authors provide an innovative and effective approach to assessing ethical decision making and closing the…

  5. The Major Field Test in Business: A Solution to the Problem of Assurance of Learning Assessment?

    Science.gov (United States)

    Green, Jeffrey J.; Stone, Courtenay Clifford; Zegeye, Abera

    2014-01-01

    Colleges and universities are being asked by numerous sources to provide assurance of learning assessments of their students and programs. Colleges of business have responded by using a plethora of assessment tools, including the Major Field Test in Business. In this article, the authors show that the use of the Major Field Test in Business for…

  6. Implementation of a Quality Assurance Review System for the Scalable Development of Online Courses

    Science.gov (United States)

    Ozdemir, Devrim; Loose, Rich

    2014-01-01

    With the growing demand for quality online education in the US, developing quality online courses and online programs, and more importantly maintaining this quality, have been an inevitable concern for higher education institutes. Current literature on quality assurance in online education mostly focuses on the development of review models and…

  7. Models for Information Assurance Education and Outreach: A Report on Year 2 Implementation

    Science.gov (United States)

    Wang, Jianjun

    2014-01-01

    "Models for Information Assurance Education and Outreach" (MIAEO) is an NSF-funded, three-year project to support hands-on explorations in "network security" and "cryptography" through Research Experience Vitalizing Science-University Program (REVS-UP) at California State University, Bakersfield. In addition, the…

  8. Using TQM and ISO 9000 Principles in Assuring Education Service Quality.

    Science.gov (United States)

    Kabashkin, Igor; Michnev, Boris; Utchin, Georgy

    1998-01-01

    Describes Riga Aviation University's movement from a controlled professional-education program to a system of contract relations with students as education service customers. Discusses a study of students' demands, requirements, and issues and the development of a quality assurance system based on Total Quality Management and ISO 9000 standards.…

  9. FDA quality assurance for radioactivity in foods and radiopharmaceuticals

    International Nuclear Information System (INIS)

    The Food and Drug Administration (FDA) has regulatory responsibility for radionuclides in foods and radiopharmaceuticals and must maintain an ongoing Quality Assurance Program. These Quality Control Programs involve the U.S. Environmental Protection Agency (EPA) and the National Institute of Standards and Technology (NIST), who supply the necessary reference materials and standards to ensure that the measurements are accurate and reproduceable. Data from EPA (1987 to 1991) and from a NIST 'Blind' Source study (1985 to 1991) show the results are accurate with an average variation from NIST values of 1.8%. The use of standard materials with the same matrices as the samples being analyzed provides credibility to the measurements. (orig.)

  10. One complex tool and three simple approaches to the improvement of quality assurance and safety in external beam radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Salinas, F.; Sansogne, R.; Arbiser, S.; Suarez, V., E-mail: flavio.salinas@rtp.com.ar [Vidt Centro Medico (Argentina); Franco, M., E-mail: mauricio.franco@rtp.com.ar [Centro de Radioterapia San Juan (Argentina); Escobar, J., E-mail: jorge.escobar@iprc.com.ar [Instituto Privado de Radioterapia Cuyo, Buenos Aires (Argentina)

    2013-10-01

    Quality assurance and safety controls in radiation therapy delivery processes that involve the Physics Department of an institution are commonly time consuming tasks. Carrying out daily controls in very busy clinics without compromising patient schedule is challenging. This work describes the usage of Electronic Portal Imaging Devices in combination with some in-house software to simplify and systematize three different tasks of the Physics Department Quality Assurance Program, improving the easiness, reliability and velocity of daily tests. (author)

  11. Private sector delivery of health services in developing countries: a mixed-methods study on quality assurance in social franchises

    Directory of Open Access Journals (Sweden)

    Schlein Karen

    2013-01-01

    Full Text Available Abstract Background Across the developing world health care services are most often delivered in the private sector and social franchising has emerged, over the past decade, as an increasingly popular method of private sector health care delivery. Social franchising aims to strengthen business practices through economies of scale: branding clinics and purchasing drugs in bulk at wholesale prices. While quality is one of the established goals of social franchising, there is no published documentation of how quality levels might be set in the context of franchised private providers, nor what quality assurance measures can or should exist within social franchises. The aim of this study was to better understand the quality assurance systems currently utilized in social franchises, and to determine if there are shared standards for practice or quality outcomes that exist across programs. Methods The study included three data sources and levels of investigation: 1 Self-reported program data; 2 Scoping telephone interviews; and 3 In-depth field interviews and clinic visits. Results Social Franchises conceive of quality assurance not as an independent activity, but rather as a goal that is incorporated into all areas of franchise operations, including recruitment, training, monitoring of provider performance, monitoring of client experience and the provision of feedback. Conclusions These findings are the first evidence to support the 2002 conceptual model of social franchising which proposed that the assurance of quality was one of the three core goals of all social franchises. However, while quality is important to franchise programs, quality assurance systems overall are not reflective of the evidence to-date on quality measurement or quality improvement best practices. Future research in this area is needed to better understand the details of quality assurance systems as applied in social franchise programs, the process by which quality assurance

  12. Assurance on sustainability reporting: An auditor's view

    NARCIS (Netherlands)

    Philip Wallage

    2000-01-01

    This article discusses initial experiences with a new assurance service: the verification of sustainability reports providing assertions regarding financial, environmental, and social issues. For illustration purposes, references to the verification ofThe Shell Report 2000 are made. Because of the n

  13. Dose Assurance in Radiation Processing Plants

    DEFF Research Database (Denmark)

    Miller, Arne; Chadwick, K.H.; Nam, J.W.

    1983-01-01

    Radiation processing relies to a large extent on dosimetry as control of proper operation. This applies in particular to radiation sterilization of medical products and food treatment, but also during development of any other process. The assurance that proper dosimetry is performed at the radiat...

  14. Quality Assurance in University Guidance Services

    Science.gov (United States)

    Simon, Alexandra

    2014-01-01

    In Europe there is no common quality assurance framework for the delivery of guidance in higher education. Using a case study approach in four university career guidance services in England, France and Spain, this article aims to study how quality is implemented in university career guidance services in terms of strategy, standards and models,…

  15. Sustainability performance and assurance: Influence on reputation

    OpenAIRE

    Alon, Anna; Vidovic, M.

    2015-01-01

    The positive impact of sustainability on reputation has been assumed but not sufficiently examined. This study probes the veracity of these claims by applying legitimacy and signaling perspectives to examine whether sustainability performance and assurance contribute to corporate reputation. We find superior sustainability performance has a positive association with sustainability reputation. Companies with better performance are also more likely to obtain external ...

  16. Modifiers for quality assurance in group facilitation

    NARCIS (Netherlands)

    Kolfschoten, G.L.; Grünbacher, P.; Briggs, R.O.

    2011-01-01

    A key task of a professional facilitator is to assure the quality of the knowledge products created through collaborative effort. To manage the quality of the knowledge a group generates, facilitators attend to, judge, and question the quality of the contributions a group makes, the decisions it mak

  17. On the development of quality assurance

    DEFF Research Database (Denmark)

    Andersen, Jens

    2014-01-01

    Contemporary research in quality assurance indicates that large uncertainties observed in interlaboratory comparisons to a large extent originate from a lack of competence of laboratory staff. This explanation is challenged by the present article for which six technologies and multiple series...

  18. 43 CFR 17.4 - Assurances required.

    Science.gov (United States)

    2010-10-01

    ... financial assistance to an institution of higher education (including assistance for construction, for... treatment of students. (2) The assurance required with respect to an institution of higher education, or any... encumber the real property as security for financing construction of new, or improvement of...

  19. 45 CFR 1110.4 - Assurances required.

    Science.gov (United States)

    2010-10-01

    ... case of any application for Federal financial assistance to an institution of higher education... of higher education or any other institution, insofar as the assurance relates to the institution's... mortgage or otherwise encumber the real property as security for financing construction of new,...

  20. 45 CFR 80.4 - Assurances required.

    Science.gov (United States)

    2010-10-01

    ... institution of higher education (including assistance for construction, for research, for special training... assurance required with respect to an institution of higher education, hospital, or any other institution... security for financing construction of new, or improvement of existing, facilities on such property for...

  1. Quality Assurance in Higher Education in Zimbabwe

    Science.gov (United States)

    Garwe, Evelyn Chiyevo

    2014-01-01

    The purpose of this paper is to furnish local and global stakeholders with detailed information regarding the development and current status of quality assurance in the Zimbabwean higher education sector. The study used document analysis, observation and interviews with key informants as sources of data. This paper addresses the dearth of…

  2. APPROACH TO QUALITY ASSURANCE IN HIGHER EDUCATION

    Directory of Open Access Journals (Sweden)

    Zora Arsovski

    2007-03-01

    Full Text Available Quality assurance in higher education is streamed in two interconnected concepts: (1 quality management according to ISO 9000 and (2 Bologna process. In this paper both concepts are presented, with point on internal state and term plan activities for quality improvement in higher education in Serbia.

  3. From quality assurance to total quality management

    OpenAIRE

    Andreea Ionică

    2003-01-01

    Quality assurance is broadly the prevention of quality problems through planned and systematic activities. These will include the establishment of a good quality management system and the assessment of its adequacy, the audit of the operation of the system, and the review of the system itself

  4. Ensuring Quality Assurance in Vocational Education

    Science.gov (United States)

    Idialu, Ethel E.

    2013-01-01

    Vocational education emphasises skill acquisition. Quality assurance in vocational education is a concept that is concerned with high performance involving activities with vocational education such as teaching, learning, infrastructures, students' behaviour and the entire academic process. Quality vocational education refers to input and output of…

  5. 36 CFR 6.10 - Financial assurance.

    Science.gov (United States)

    2010-07-01

    ... has established a bond under 40 CFR 258.74(b). (b) The Regional Director will not require a bond or... the estimated cost to accomplish all closure and post-closure care requirements as described in 40 CFR... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Financial assurance....

  6. Quality Assurance in Distance Learning Libraries

    Science.gov (United States)

    Tripathi, Manorama; Jeevan, V. K. J.

    2009-01-01

    Purpose: The paper aims to study how the present distance learning libraries can improve upon their existing services and introduce new ones to enhance quality of services to distance learners. Design/methodology/approach: The paper includes a review of literature on quality assurance in open and distance education in general and student support…

  7. Operations quality assurance for nuclear power plants

    International Nuclear Information System (INIS)

    This standard covers the quality assurance of all activities concerned with the operation and maintenance of plant equipment and systems in CANDU-based nuclear power plants during the operations phase, the period between the completion of commissioning and the start of decommissioning

  8. Issues Associated with IAEA Involvement in Assured Nuclear Fuel Supply Arrangements

    Energy Technology Data Exchange (ETDEWEB)

    Kessler, Carol E.; Mathews, Carrie E.

    2008-02-08

    Assured nuclear fuel supply has been discussed at various times as a mechanism to help limit expansion of enrichment and reprocessing (E&R) capability beyond current technology holders. Given the events in the last few years in North Korea and Iran, concern over weapons capabilities gained from acquisition of E&R capabilities has heightened and brought assured nuclear fuel supply (AFS) again to the international agenda. Successful AFS programs can be valuable contributions to strengthening the nonproliferation regime and helping to build public support for expanding nuclear energy.

  9. Software quality assurance plan for the National Ignition Facility integrated computer control system

    International Nuclear Information System (INIS)

    Quality achievement is the responsibility of the line organizations of the National Ignition Facility (NIF) Project. This Software Quality Assurance Plan (SQAP) applies to the activities of the Integrated Computer Control System (ICCS) organization and its subcontractors. The Plan describes the activities implemented by the ICCS section to achieve quality in the NIF Project's controls software and implements the NIF Quality Assurance Program Plan (QAPP, NIF-95-499, L-15958-2) and the Department of Energy's (DOE's) Order 5700.6C. This SQAP governs the quality affecting activities associated with developing and deploying all control system software during the life cycle of the NIF Project

  10. Measurement Assurance for End-Item Users

    Science.gov (United States)

    Mimbs, Scott M.

    2008-01-01

    The goal of a Quality Management System (QMS) as specified in ISO 9001 and AS9100 is to assure the end product meets specifications and customer requirements. Measuring devices, often called measuring and test equipments (MTE), provide the evidence of product conformity to the prescribed requirements. Therefore the processes which employ MTE can become a weak link to the overall QMS if proper attention is not given to development and execution of these processes. Traditionally, calibration of MTE is given more focus in industry standards and process control efforts than the equally important proper usage of the same equipment. It is a common complaint of calibration laboratory personnel that MTE users are only interested in "a sticker." If the QMS requires the MTE "to demonstrate conformity of the product," then the quality of the measurement process must be adequate for the task. This leads to an ad hoc definition; measurement assurance is a discipline that assures that all processes, activities, environments, standards, and procedures involved in making a measurement produce a result that can be rigorously evaluated for validity and accuracy. To evaluate that the existing measurement processes are providing an adequate level of quality to support the decisions based upon this measurement data, an understanding of measurement assurance basics is essential. This topic is complimentary to the calibration standard, ANSI/NCSL Z540.3-2006, which targets the calibration of MTE at the organizational level. This paper will discuss general measurement assurance when MTE is used to provide evidence of product conformity, therefore the target audience of this paper is end item users of MTE. A central focus of the paper will be the verification of tolerances and the associated risks, so calibration professionals may find the paper useful in communication with their customers, MTE users.

  11. Los Alamos National Laboratory transuranic waste quality assurance project plan. Revision 1

    International Nuclear Information System (INIS)

    This Transuranic (TRU) Waste Quality Assurance Project Plan (QAPjP) serves as the quality management plan for the characterization of transuranic waste in preparation for certification and transportation. The Transuranic Waste Characterization/Certification Program (TWCP) consists of personnel who sample and analyze waste, validate and report data; and provide project management, quality assurance, audit and assessment, and records management support, all in accordance with established requirements for disposal of TRU waste at the Waste Isolation Pilot Plant (WIPP) facility. This QAPjP addresses how the TWCP meets the quality requirements of the Carlsbad Area Office (CAO) Quality Assurance Program Description (QAPD) and the technical requirements of the Transuranic Waste Characterization Quality Assurance Program Plan (QAPP). The TWCP characterizes and certifies retrievably stored and newly generated TRU waste using the waste selection, testing, sampling, and analytical techniques and data quality objectives (DQOs) described in the QAPP, the Los Alamos National Laboratory Transuranic Waste Certification Plan (Certification Plan), and the CST Waste Management Facilities Waste Acceptance Criteria and Certification [Los Alamos National Laboratory (LANL) Waste Acceptance Criteria (WAC)]. At the present, the TWCP does not address remote-handled (RH) waste

  12. Construction quality assurance closure report, Lawrence Livermore National Laboratory Site 300, Pits 1 and 7

    International Nuclear Information System (INIS)

    This document presents the Final Construction Quality Assurance (CQA) report for the closure cover system of two mixed, low-level radioactive and hazardous waste landfills (pits) at Site 300. Site 300, operated by the Lawrence Livermore National Laboratory (LLNL), is located in the Altamont Hills, approximately 15 miles southeast of Livermore, California. The purpose of this report is to document the CQA program established to assure that construction is completed in accordance with the design intent and the approved Closure and Post Closure Plans dated May 1989 and revised January 1990 (EPA ID Number: CA 2890090002). Inclusive within the Closure and Post Closure Plan were the CQA Plan and the Technical Specifications for the final cover system. This report contains a complete narrative with photographic documentation of the construction activities and progress, problems encountered and solutions utilized, and third party testing and monitoring results, thus establishing the verification of compliance with the Quality Assurance Plan for the project

  13. The new advances in radiotherapy technique challenges of quality assurance

    International Nuclear Information System (INIS)

    What is Quality Assurance (QA)? This is all those planned and systematic actions necessary to provide confidence that a product or service will satisfy given requirements for quality. ISO 9000. It is the overall process which is supported by quality control activities. While, quality control describes the actual mechanisms and procedures by which one can assure quality. Consequences for radiotherapy A good acceptance testing and commissioning program is fundamental for any QA activities QA applies to both physical and clinical aspects of the treatment Treatment records must be kept of all relevant aspects of the treatment - including -Session and Summary Record information -Records all treatment parameters -Dose Calculations -Dose Measurements Particular emphasis is placed on QA of dosimetry A QA system itself and its outcomes must be critically reviewed. External audits are recommended to verify that the checks are not only done but that they also achieve what they are supposed to do Every good system requires an independent look at times A Comprehensive QA Program typically comprises Quality Assurance Committee, Policies and Procedures Manual, Quality Assurance team, Quality audit, Resources Introduction,..OBI in general. The On-Board Imager system is designed to correct for motion and setup errors of patients undergoing radiation therapy. It provides three imaging modes: Two-dimensional 2-D radiographic acquisition, Fluoroscopic image acquisition, and Three-dimensional 3-D cone-beam computed tomography CBCT acquisition. The fluoroscopic images are used to verify the gating thresholds of the respiratory gating system to account for intra-fraction i.e. respiratory motion. The radiographic images manage inter-fractional motion and setup errors. Using the 2D2DMatch and 3D3DMatch analysis tools a user can register the acquired kV or CBCT images with their associated reference image like DRR or planning CT for CBCT. Couch corrections are then downloaded to the linear

  14. 10 CFR 71.103 - Quality assurance organization.

    Science.gov (United States)

    2010-01-01

    ... management level that assures that the required authority and organizational freedom, including sufficient... location or locations where activities are performed, the organizational structure for executing the... the organizational structure, the individual(s) assigned the responsibility for assuring...

  15. Lunar RFC Reliability Testing for Assured Mission Success

    Science.gov (United States)

    Bents, David J.

    2008-01-01

    NASA's Constellation program has selected the closed cycle hydrogen oxygen Polymer Electrolyte Membrane (PEM) regenerative Fuel Cell (RFC) as its baseline solar energy storage system for the lunar outpost and manned rover vehicles. Since the outpost and manned rovers are "human-rated", these energy storage systems will have to be of proven reliability exceeding 99 percent over the length of the mission. Because of the low (TRL=5) development state of the closed cycle hydrogen oxygen PEM RFC at present, and because there is no equivalent technology base in the commercial sector from which to draw or infer reliability information from, NASA will have to spend significant resources developing this technology from TRL 5 to TRL 9, and will have to embark upon an ambitious reliability development program to make this technology ready for a manned mission. Because NASA would be the first user of this new technology, NASA will likely have to bear all the costs associated with its development. When well-known reliability estimation techniques are applied to the hydrogen oxygen RFC to determine the amount of testing that will be required to assure RFC unit reliability over life of the mission, the analysis indicates the reliability testing phase by itself will take at least 2 yr, and could take up to 6 yr depending on the number of QA units that are built and tested and the individual unit reliability that is desired. The cost and schedule impacts of reliability development need to be considered in NASA's Exploration Technology Development Program (ETDP) plans, since life cycle testing to build meaningful reliability data is the only way to assure "return to the moon, this time to stay, then on to Mars" mission success.

  16. A computerized system for assuring work force reliability and security

    International Nuclear Information System (INIS)

    The US Department of Energy (DOE), the US Nuclear Regulatory Commission (NRC), and other federal and state agencies are markedly increasing their requirements for applicant screening, certification, and ongoing personnel monitoring and assessment. The DOE's recently announced Personnel Security Assurance Program 10CFR5631.6 of the Code of Federal Regulations and the NRC's proposed Fitness-For-Duty Rule 10CFR26 and anticipated Access Authorization Rule are examples. A computer-based system that integrates all of the required information and yet is flexible enough to (a) permit an organization to tailor it to their specific requirements and (b) control data access on a need-to-know basis, appears to offer the only feasible solution to what is emerging as an administrative burden. The FLOW GEMINI Personnel Assurance System (PASS) is a computer-based software system designed to support personnel hiring, assignment, evaluation, and termination decisions. They can be as simple as routine preemployment processing or as complex as security processing for unescorted access status. PASS consists of a predefined data base, standard reports and expert systems, and several tools for tailoring the standard system and developing additional reports and queries

  17. Review of quality assurance criteria for nuclear power plants in Japan

    International Nuclear Information System (INIS)

    The present quality assurance guide of Japan Electric Association, JEAG-4101, was prepared in 1972 for the purpose of establishing the safety functions, insuring the public and employees' health, improving operational reliability and maintaining power supply. This guide reflects the state of nuclear power generation of those days. It stands on the point of recognition that quality assurance is controlled by the builders of plants. However, its contents are very simple, and do not mention the concrete means and methods of the items to be conducted, though the items are clear. Since then, international cooperation has progressed in nuclear power industries, and it may be natural that quality assurance criteria are eagerly required to be internationally adaptable. Thus it was decided to do the work for revising JEAG-4101 considering the matching with the Cord of Practice of IAEA. The scope is the quality assurance activity in design, manufacture, installation and trial operation, while operation practice is omitted because it is covered by the present ''security regulations''. The contents of the revised draft include the general description, quality assurance program, organization, document control, design control, procurement control, material and equipment control, manufacture and installation control, inspection and testing control, disqualification control and audit. (Wakatsuki, Y.)

  18. The assurance of sustainability reporting of hotel companies

    OpenAIRE

    Sandra Janković; Dubravka Krivačić

    2014-01-01

    Purpose – The aim of this paper is to set out the nature of the assurance of sustainability reporting and its key principles. Further aim is to identify the potential benefits of the assurance of sustainability reporting for hotel companies, and also to discuss the conditions necessary for integrating assurance of sustainability reporting into organisation activities. Design – The paper explores assurance of hotels’ sustainability reporting with special focus on the hotels that implement GRI ...

  19. Technical Reference Suite Addressing Challenges of Providing Assurance for Fault Management Architectural Design

    Science.gov (United States)

    Fitz, Rhonda; Whitman, Gerek

    2016-01-01

    Research into complexities of software systems Fault Management (FM) and how architectural design decisions affect safety, preservation of assets, and maintenance of desired system functionality has coalesced into a technical reference (TR) suite that advances the provision of safety and mission assurance. The NASA Independent Verification and Validation (IV&V) Program, with Software Assurance Research Program support, extracted FM architectures across the IV&V portfolio to evaluate robustness, assess visibility for validation and test, and define software assurance methods applied to the architectures and designs. This investigation spanned IV&V projects with seven different primary developers, a wide range of sizes and complexities, and encompassed Deep Space Robotic, Human Spaceflight, and Earth Orbiter mission FM architectures. The initiative continues with an expansion of the TR suite to include Launch Vehicles, adding the benefit of investigating differences intrinsic to model-based FM architectures and insight into complexities of FM within an Agile software development environment, in order to improve awareness of how nontraditional processes affect FM architectural design and system health management. The identification of particular FM architectures, visibility, and associated IV&V techniques provides a TR suite that enables greater assurance that critical software systems will adequately protect against faults and respond to adverse conditions. Additionally, the role FM has with regard to strengthened security requirements, with potential to advance overall asset protection of flight software systems, is being addressed with the development of an adverse conditions database encompassing flight software vulnerabilities. Capitalizing on the established framework, this TR suite provides assurance capability for a variety of FM architectures and varied development approaches. Research results are being disseminated across NASA, other agencies, and the

  20. QA programs in nuclear power plants

    International Nuclear Information System (INIS)

    As an overview of quality assurance programs in nuclear power plants, the energy picture as it appears today is reviewed. Nuclear power plants and their operations are described and an attempt is made to place in proper perspective the alleged ''threats'' inherent in nuclear power. Finally, the quality assurance programs being used in the nuclear industry are described

  1. Operational excellence (six sigma) philosophy: Application to software quality assurance

    Energy Technology Data Exchange (ETDEWEB)

    Lackner, M.

    1997-11-01

    This report contains viewgraphs on operational excellence philosophy of six sigma applied to software quality assurance. This report outlines the following: goal of six sigma; six sigma tools; manufacturing vs administrative processes; Software quality assurance document inspections; map software quality assurance requirements document; failure mode effects analysis for requirements document; measuring the right response variables; and questions.

  2. 34 CFR 303.127 - Assurance regarding expenditure of funds.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Assurance regarding expenditure of funds. 303.127 Section 303.127 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF... Assurance regarding expenditure of funds. The statement must include an assurance satisfactory to...

  3. Quality Assurance in Transnational Higher Education. ENQA Workshop Report 11

    Science.gov (United States)

    Bennett, Paul; Bergan, Sjur; Cassar, Daniela; Hamilton, Marlene; Soinila, Michele; Sursock, Andree; Uvalic-Trumbic, Stamenka; Williams, Peter

    2010-01-01

    The present report is the product of an ENQA (European Association for Quality Assurance in Higher Education) Bologna Seminar "Quality Assurance in Transnational Education: from words to action" hosted by the Quality Assurance Agency (QAA, UK) in London in December, 2008. The seminar discussed the current trends in Transnational landscapes, the…

  4. Development of an Instructional Quality Assurance Model in Nursing Science

    Science.gov (United States)

    Ajpru, Haruthai; Pasiphol, Shotiga; Wongwanich, Suwimon

    2011-01-01

    The purpose of this study was to develop an instructional quality assurance model in nursing science. The study was divided into 3 phases; (1) to study the information for instructional quality assurance model development (2) to develop an instructional quality assurance model in nursing science and (3) to audit and the assessment of the developed…

  5. Quality Assurance in Postgraduate Education. ENQA Workshop Report 12

    Science.gov (United States)

    Bitusikova, Alexandra; Bohrer, Janet; Borosic, Ivana; Costes, Nathalie; Edinsel, Kerim; Hollander, Karoline; Jacobsson, Gunilla; Jakopovic, Ivan Filip; Kearney, Mary-Louise; Mulder, Fred; Negyesi, Judith; Pietzonka, Manuel

    2010-01-01

    The present report follows an ENQA (European Association for Quality Assurance in Higher Education) Workshop on Quality Assurance and Postgraduate Education, hosted by the Romanian Agency for Quality Assurance in Higher Education (ARACIS) in Brasov, Romania on 12-13 March 2009. The workshop was an excellent opportunity for ENQA members to exchange…

  6. 75 FR 57956 - Draft Revision of the Federalwide Assurance

    Science.gov (United States)

    2010-09-23

    ... HUMAN SERVICES Draft Revision of the Federalwide Assurance AGENCY: Department of Health and Human... Assistant Secretary for Health, is announcing the availability of the draft revised Federalwide Assurance (FWA) form and Terms of Assurance, and is seeking comment on these draft documents. OHRP is...

  7. Quality Assurance and School Monitoring in Hong Kong

    Science.gov (United States)

    Mok, Magdalena Mo Ching

    2007-01-01

    This study reports on the Hong Kong education quality assurance and school monitoring system. Three research questions were addressed: (1) Who controls the quality of school education in Hong Kong? (2) What strategies are used in the Hong Kong school education quality assurance process? (3) Agenda for Future Research on quality assurance and…

  8. Quality Assurance of Assessment and Moderation Discourses Involving Sessional Staff

    Science.gov (United States)

    Grainger, Peter; Adie, Lenore; Weir, Katie

    2016-01-01

    Quality assurance is a major agenda in tertiary education. The casualisation of academic work, especially in teaching, is also a quality assurance issue. Casual or sessional staff members teach and assess more than 50% of all university courses in Australia, and yet the research in relation to the role sessional staff play in quality assurance of…

  9. 42 CFR 93.303 - Assurances for small institutions.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Assurances for small institutions. 93.303 Section... POLICIES ON RESEARCH MISCONDUCT Responsibilities of Institutions Compliance and Assurances § 93.303 Assurances for small institutions. (a) If an institution is too small to handle research...

  10. Internal Quality Assurance System and Its Implementation in Kaunas College

    Science.gov (United States)

    Misiunas, Mindaugas

    2007-01-01

    The article discusses the internal system of quality assurance and its implementation methods in Kaunas College. The issues of quality assurance are reviewed in the context of the European higher education area covering the three levels: European, national and institutional. The importance of quality assurance and its links with external…

  11. [Quality assurance in occupational health services].

    Science.gov (United States)

    Michalak, J

    1996-01-01

    The general conditions influencing the quality assurance and audit in Polish occupational health services are presented. The factors promoting or hampering the implementation of quality assurance and audits are also discussed. The major influence on the transformation of Polish occupational health services in exorted by employers who are committed to cover the costs of the obligatory prophylactic examination of their employees. This is the factor which also contributes to the improvement of quality if services. The definitions of the most important terms are reviewed to highlight their accordance with the needs of occupational health services in Poland. The examples of audit are presented and the elements of selected methods of auditing are suggested to be adopted in Poland. PMID:8760511

  12. Management of National Nuclear Power Programs for assured safety

    International Nuclear Information System (INIS)

    Topics discussed in this report include: nuclear utility organization; before the Florida Public Service Commission in re: St. Lucie Unit No. 2 cost recovery; nuclear reliability improvement and safety operations; nuclear utility management; training of nuclear facility personnel; US experience in key areas of nuclear safety; the US Nuclear Regulatory Commission - function and process; regulatory considerations of the risk of nuclear power plants; overview of the processes of reliability and risk management; management significance of risk analysis; international and domestic institutional issues for peaceful nuclear uses; the role of the Institute of Nuclear Power Operations (INPO); and nuclear safety activities of the International Atomic Energy Agency (IAEA)

  13. Waste Management Project Quality Assurance Program Plan (QAPP)

    International Nuclear Information System (INIS)

    The Waste Management Project (WMP) is committed to excellence in our work and to delivering quality products and services to our customers, protecting our employees and the public and to being good stewards of the environment. We will continually strive to understand customer requirements, perform services, and activities that meet or exceed customer expectations, and be cost-effective in our performance. The WMP maintains an environment that fosters continuous improvement in our processes, performance, safety and quality. The achievement of quality will require the total commitment of all WMP employees to our ethic that Quality, Health and Safety, and Regulatory Compliance must come before profits. The successful implementation of this policy and ethic requires a formal, documented management quality system to ensure quality standards are established and achieved in all activities. The following principles are the foundation of our quality system. Senior management will take full ownership of the quality system and will create an environment that ensures quality objectives are met, standards are clearly established, and performance is measured and evaluated. Line management will be responsible for quality system implementation. Each organization will adhere to all quality system requirements that apply to their function. Every employee will be responsible for their work quality, to work safely and for complying with the policies, procedures and instructions applicable to their activities. Quality will be addressed and verified during all phases of our work scope from proposal development through closeout including contracts or projects. Continuous quality improvement will be an ongoing process. Our quality ethic and these quality principles constantly guide our actions. We will meet our own quality expectations and exceed those of our customers with vigilance, commitment, teamwork, and persistence

  14. Management of National Nuclear Power Programs for assured safety

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, T.J. (ed.)

    1985-01-01

    Topics discussed in this report include: nuclear utility organization; before the Florida Public Service Commission in re: St. Lucie Unit No. 2 cost recovery; nuclear reliability improvement and safety operations; nuclear utility management; training of nuclear facility personnel; US experience in key areas of nuclear safety; the US Nuclear Regulatory Commission - function and process; regulatory considerations of the risk of nuclear power plants; overview of the processes of reliability and risk management; management significance of risk analysis; international and domestic institutional issues for peaceful nuclear uses; the role of the Institute of Nuclear Power Operations (INPO); and nuclear safety activities of the International Atomic Energy Agency (IAEA).

  15. Quality Assurance Program Plan (QAPP) Waste Management Project

    Energy Technology Data Exchange (ETDEWEB)

    HORHOTA, M.J.

    2000-12-21

    The Waste Management Project (WMP) is committed to excellence in our work and to delivering quality products and services to our customers, protecting our employees and the public and to being good stewards of the environment. We will continually strive to understand customer requirements, perform services, and activities that meet or exceed customer expectations, and be cost-effective in our performance. The WMP maintains an environment that fosters continuous improvement in our processes, performance, safety and quality. The achievement of quality will require the total commitment of all WMP employees to our ethic that Quality, Health and Safety, and Regulatory Compliance must come before profits. The successful implementation of this policy and ethic requires a formal, documented management quality system to ensure quality standards are established and achieved in all activities. The following principles are the foundation of our quality system. Senior management will take full ownership of the quality system and will create an environment that ensures quality objectives are met, standards are clearly established, and performance is measured and evaluated. Line management will be responsible for quality system implementation. Each organization will adhere to all quality system requirements that apply to their function. Every employee will be responsible for their work quality, to work safely and for complying with the policies, procedures and instructions applicable to their activities. Quality will be addressed and verified during all phases of our work scope from proposal development through closeout including contracts or projects. Continuous quality improvement will be an ongoing process. Our quality ethic and these quality principles constantly guide our actions. We will meet our own quality expectations and exceed those of our customers with vigilance, commitment, teamwork, and persistence.

  16. A program for assuring the competence of radiation protection supervisors

    International Nuclear Information System (INIS)

    Baker Hughes Incorporated is a service company providing drilling, formation evaluation and production technology to the oil and gas industry. The corporation is the combination of many innovative companies, some dating back to the early 1900s, that have developed and introduced technology to serve the global petrochemical industry. Every day in oil fields around the world, Baker Hughes engineers, geo-scientists and field service personnel apply the latest technology to find reserves, develop fields and produce oil and gas. Baker Hughes INTEQ, a division of Baker Hughes Inc., provides a range of services associated with drilling operations. A major product line utilises sealed radioactive sources to obtain real-time information on the formation being drilled. This is done by use of a technique called measurement while drilling (MWD). A nuclear MWD operation on a drilling rig involves the use of a 185 GBq Am-241/Be neutron source and a 74 GBq Cs-137 gamma ray source. INTEQ's Eastern Hemisphere operations have provided MWD services in more than 50 countries in the last 10 years, from its major support bases in the UK, Norway, Nigeria, Dubai and Singapore. Baker Hughes INTEQ takes the safety of its work with radioactive sources extremely seriously and, when developing these services, put a lot of thought into how this could be ensured. An essential factor was deemed to be the competence of the personnel providing the services at the rig site, most importantly, the radiation protection supervisor (RPS). The RPS is responsible for ensuring that the specified working procedures are observed at all times. In doing so, the RPS will ensure that the work being done with the radioactive sources proceeds in a manner which is fully compliant with the regulations for radiation protection in the country in which the work is being undertaken

  17. Emergence Of A Quality Assurance Program For Probiotic Supplemented Foods

    OpenAIRE

    Sarkar, S.

    2013-01-01

    In recent year consumer’s inclination towards natural and health-promoting foods have led to projection of probiotics as a new ingredient in functional food market. In absence of any worldwide regulation, probiotic containing foods available in the market are often of poor quality and did not meet the desired level of viable microorganisms, required for exhibiting health benefits. Presently, no globally accepted regulations for probiotic containing foods have been establi...

  18. ABACC laboratories quality assurance through Secondary Standards Exchange Program

    International Nuclear Information System (INIS)

    In September 1999, the Brazilian-Argentine Agency for Accounting and Control of Nuclear Materials (ABACC), with assistance from the New Brunswick Laboratory (NBL) of the U.S. Department of Energy, started a new cooperative activity with, among other objectives, the production and characterization of a traceable uranium secondary standard and the performance of the Third Round Robin for ABACC's laboratory network. Brazil and Argentina have fabricated UO2 pellets for use as a secondary standard. Samples from the two batches were sent to NBL for the determination of the reference values for both uranium concentration (%U) and isotopic composition for each batch. ABACC and NBL then organized the Third ABACC Round Robin for Brazilian and Argentine laboratories that are part of the ABACC network. The laboratories comprising the network can be used to analyze real samples collected during the ABACC inspections. The Brazilian and Argentine pellets were distributed to all the laboratories together with the protocol to be followed for the uranium concentration analysis, the forms for reporting the measurement results, and natural UO2 pellets (CETAMA OU1) to be used as reference material. For the laboratories with capability of measuring isotopics, NBL reference material CRM 125-A was provided. Several laboratories from each country provided results. As soon as the measurement results were sent to the organizers, they were statistically evaluated by NBL. During a meeting held at ABACC headquarters with the participation of NBL representatives, the ABACC technical support officer, and representatives of all the participant laboratories, the results were discussed and compared with the reference values. All the laboratories had the occasion, in an open discussion, to explain and show the difficulties and problems they faced during the exercise. ABACC had the opportunity not only to judge the quality of the measurements these laboratories performed, but also to determine possible improvements in their measurement processes. (author)

  19. 10 CFR 72.144 - Quality assurance program.

    Science.gov (United States)

    2010-01-01

    ... NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSING REQUIREMENTS FOR THE INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE Quality... holder, and applicant for a CoC shall identify the structures, systems, and components to be covered...

  20. Spent nuclear fuel project quality assurance program plan

    Energy Technology Data Exchange (ETDEWEB)

    Lacey, R.E.

    1997-05-09

    This main body of this document describes how the requirements of 10 CFR 830.120 are met by the Spent Nuclear Fuel Project through implementation of WHC-SP-1131. Appendix A describes how the requirements of DOE/RW-0333P are met by the Spent Nuclear Fuel Project through implementation of specific policies, manuals, and procedures.

  1. Control mechanisms for assuring better IS quality:

    OpenAIRE

    Pivka, Marjan

    1998-01-01

    The software domain is faced with a number of quality assurance and process improvement models. Business managers are under pressure from many different kinds of assessments for their operations, products and services. Accounting departments are audited by financial auditors. What about information systems? Do we have a universal model on how to achieve required IS quality? This paper deals with the definition of IS quality and the influence of different control mechanisms on IS. The results ...

  2. Assurance: the power behind PCASSO security.

    OpenAIRE

    Baker, D. B.; Masys, D. R.; Jones, R L; Barnhart, R. M.

    1999-01-01

    The need for security protection in Internet-based healthcare applications is generally acknowledged. Most healthcare applications that use the Internet have at least implemented some kind of encryption. Most applications also enforce user authentication and access control policies, and many audit user actions. However, most fall short on providing strong assurances that the security mechanisms are behaving as expected and that they cannot be subverted. While no system can claim to be totally...

  3. Optimal Quality Assurance Systems for Agricultural Outputs

    OpenAIRE

    Miguel Carriquiry; Babcock, Bruce A.; Roxana Carbone

    2003-01-01

    New quality assurance systems (QASs) are being put in place to facilitate the flow of information about agricultural and food products. But what constitutes a proper mix of public and private efforts in setting up QASs is an unsettled question. A better understanding of private sector incentives for setting up such systems will help clarify what role the public sector might have in establishing standards. We contribute to this understanding by modeling the optimal degree of "stringency" or as...

  4. PACKAGING QUALITY ASSURANCE IN SUPPLY CHAIN

    OpenAIRE

    Agnieszka Cholewa-Wójcik; Agnieszka Kawecka

    2014-01-01

    Packaging is a very important element in products quality maintenance that is why quality of packaging has great influence and its quality assurance is necessary. Physical flow in supply chain may deteriorate some of packaging features, so their monitoring and proper conditions of storage, transport and suitable protection are important.The main goal of the paper was to present model of packaging supply chain with elements that are most influencing packaging quality. In the model are consider...

  5. Quality Assurance in the Japanese Universities

    OpenAIRE

    Sorin-George Toma; Shinji Naruo

    2009-01-01

    The higher education system represents a vital means for a country to nurture its economic development and social cohesion. All over the world there has been an increasing interest in quality assurance (QA) in higher education, reflecting both the growing importance of higher education services and their valuable contribution to societies. As higher education services moves beyond national borders, the need for international cooperation in QA have increased in the last decades. Moreover, ther...

  6. Quality assurance programme and quality control

    International Nuclear Information System (INIS)

    The paper analyses the requirements for the quality assurance and control in nuclear power plant projects which are needed to achieve safe, reliable and economic plants. The author describes the structure for the establishment of a nuclear programme at the national level and the participation of the different bodies involved in a nuclear power plant project. The paper ends with the study of a specific case in Spain. (NEA)

  7. Safety and Mission Assurance Knowledge Management Retention

    Science.gov (United States)

    Johnson, Teresa A.

    2006-01-01

    This viewgraph presentation reviews the issues surrounding the management of knowledge in regards to safety and mission assurance. The JSC workers who were hired in the 1960's are slated to retire in the next two to three years. The experiences and knowledge of these NASA workers must be identified, and disseminated. This paper reviews some of the strategies that the S&MA is developing to capture that valuable institutional knowledge.

  8. Evolving Principles of Office Quality Assurance

    OpenAIRE

    Norman, Lee A.

    1988-01-01

    The application of medical quality assurance principles to ambulatory patient care using the traditional methods of medical chart audit, process review, and physician education has yielded generally disappointing results in improving patient care and physician performance. Newer methods assist physicians by providing patient and medical reference data at the time of a patient's visit. Techniques for tracking treatment outcomes and patients' test results and for providing instructions to patie...

  9. Quality assurance of outsourced outlier mining

    OpenAIRE

    Zhang, Yongjin; Liu, Ruilin; Wang, Hui Wendy; Monreale, Anna; Pedreschi, Dino; Giannotti, Fosca; Guo, Wenge

    2011-01-01

    Spurred by developments such as in cloud computing, there has been considerable recent interest in the paradigm of data mining-as-service. A company (data owner) lacking in expertise or computational resources can outsource its mining needs to a third-party service provider. However, as the service providers may not be fully trusted, a dishonest service provider may return inaccurate mining results to the database owner. In this paper, we study the problem of providing quality assurance for o...

  10. Implementing quality assurance with multiple contractors under changing regulations

    International Nuclear Information System (INIS)

    This paper discusses the tools and techniques used to establish the responsibilities for quality implementation on the California Low-Level Radioactive Waste Disposal Project. The project is structured to use the traditional nuclear-oriented quality assurance criteria in the non-traditional application of scientific investigations required for site characterization activities. It has required a careful blending of approaches and mentalities from backgrounds in both nuclear QA and EPA QA as well as the selective application of guidance from both of the agencies. As a significant portion of the work was subcontracted to organizations which ranged from a small group of college professors to a multi-national corporation, the program needed to be versatile, easy to implement but yet definitive. The author describes some of the misconceptions encountered and areas of weakness to be identified and strengthened

  11. Automated techniques for quality assurance of radiological image modalities

    Science.gov (United States)

    Goodenough, David J.; Atkins, Frank B.; Dyer, Stephen M.

    1991-05-01

    This paper will attempt to identify many of the important issues for quality assurance (QA) of radiological modalities. It is of course to be realized that QA can span many aspects of the diagnostic decision making process. These issues range from physical image performance levels to and through the diagnostic decision of the radiologist. We will use as a model for automated approaches a program we have developed to work with computed tomography (CT) images. In an attempt to unburden the user, and in an effort to facilitate the performance of QA, we have been studying automated approaches. The ultimate utility of the system is its ability to render in a safe and efficacious manner, decisions that are accurate, sensitive, specific and which are possible within the economic constraints of modern health care delivery.

  12. Assuring both quality and creativity in basic research

    Energy Technology Data Exchange (ETDEWEB)

    Bodnarczuk, M.

    1990-04-12

    How does one assure that both quality and creativity are obtained in basic research environments QA theoreticians have attempted to develop workable definitions of quality, but in more reflective moments, these definitions often fail to capture the deeper essence of the idea of quality.'' This paper asserts that creativity (as a product of the human mind) is a concrete interface between perfunctory definitions of quality (conformance to specifications) and more philosophical speculations about the nature of quality- related ultimates'' like elegance or beauty. In addition, we describe the distinction between creative ideas and creative acts and highlight one of the major inhibitors of creativity, fear. Finally we show that highly creative people often have an irreverent attitude toward boundaries and established authority, and discuss how one can allow for this when designing a QA program in a basic research environment.

  13. Waste management and quality assurance: Reasonable co-existence?

    Energy Technology Data Exchange (ETDEWEB)

    Bresson, J.F.

    1989-11-01

    Implementing Chapter 3, Low-Level Waste Management, of DOE Order 5820-2, ``Radioactive Waste Management`` has created a major change in the operating philosophy of DOE`s prime contractors. So has the decision of May 1, 1987, when it was made clear that EPA has regulatory authority over DOE`s mixed waste. Suddenly two additional items became clear. First, DOE and its contractors were going to learn more about composition of low-level and low-level mixed waste than ever before. Second, low-level waste management was about to become a more focused, formal program, complete with needs for: (1) waste form identification, (2) program documentation; and (3) assurance that DOE`s waste does in fact comply with applicable requirements. The importance of the above items is clearly emphasized by the inclusion of Data Quality Objectives in the Waste Acceptance Criteria section of DOE 5820-2 Chapter 3 guidance called Data Quality Objectives, (DQO). Simply put, the purpose of the DQO is to identify the quality (and quantity) of information necessary to convince a regulator or decision maker that enough is known about DOE`s low-level and low-level mixed waste to allow safe disposal. The main objectives of the DOE and EPA shallow land burial requirements are to: (1) generate, with documented evidence, waste forms which are chemically inert and immobile, such that the waste will not tend to move about in the disposal medium; (2) select a disposal medium which would not let the wastes move about anyway; and (3) build some barriers around the wastes as emplaced in burial grounds, to provide additional assurance that buried wastes will stay in place. Compliance with these requirements must be demonstrated by quality data which describes the entire series of compliance activities.

  14. Flight Dynamics Mission Support and Quality Assurance Process

    Science.gov (United States)

    Oh, InHwan

    1996-01-01

    This paper summarizes the method of the Computer Sciences Corporation Flight Dynamics Operation (FDO) quality assurance approach to support the National Aeronautics and Space Administration Goddard Space Flight Center Flight Dynamics Support Branch. Historically, a strong need has existed for developing systematic quality assurance using methods that account for the unique nature and environment of satellite Flight Dynamics mission support. Over the past few years FDO has developed and implemented proactive quality assurance processes applied to each of the six phases of the Flight Dynamics mission support life cycle: systems and operations concept, system requirements and specifications, software development support, operations planing and training, launch support, and on-orbit mission operations. Rather than performing quality assurance as a final step after work is completed, quality assurance has been built in as work progresses in the form of process assurance. Process assurance activities occur throughout the Flight Dynamics mission support life cycle. The FDO Product Assurance Office developed process checklists for prephase process reviews, mission team orientations, in-progress reviews, and end-of-phase audits. This paper will outline the evolving history of FDO quality assurance approaches, discuss the tailoring of Computer Science Corporations's process assurance cycle procedures, describe some of the quality assurance approaches that have been or are being developed, and present some of the successful results.

  15. Análises de protocolos de braquiterapia, por alta taxa de dose, do controle de qualidade de alguns serviços locais, baseados no TG40, TG56 e ARCAL XXX Analysis of the high dose rate brachytherapy protocols of quality assurance programs of some local services, based on TG40, TG56 and ARCAL XXX.

    Directory of Open Access Journals (Sweden)

    Carmen S. Guzmán Calcina

    2001-08-01

    Full Text Available A braquiterapia por alta taxa de dose está recebendo atenção considerável na maioria dos países. Por isso, nos serviços que utilizam este equipamento exige-se que o desenvolvimento de um programa de controle de qualidade seja cada vez mais rigoroso, para garantir não apenas a segurança aos pacientes, mas também aos operadores e demais envolvidos. Este trabalho tem por objetivos fazer um levantamento dos tipos de testes para um equipamento de braquiterapia por alta taxa de dose, propostos pelos protocolos oficiais publicados (TG40, TG56 e ARCAL XXX e avaliar os tipos de testes que atualmente são realizados por alguns serviços de radioterapia, comparando-os com aqueles apresentados nos protocolos citados. Das análises feitas, observou-se que: a quanto aos protocolos oficiais, o TG56 é mais completo que o TG40 e o ARCAL XXX; b quanto às instituições analisadas, estas em geral se basearam no TG56 para elaborar seus próprios protocolos, os quais demonstraram ter também concordância com os outros já citados. Nestes protocolos, a inexistência dos testes anuais foi notada, o que pode ser explicado por sua aparição nas freqüências trimestral e semestral. Do produto deste estudo são apresentadas tabelas dos tipos de testes com suas respectivas freqüências de utilização, das quais um protocolo pode ser inferido para auxiliar na implementação, pelo menos, dos tipos de testes de controle de qualidade básicos e indispensáveis para o equipamento, garantindo, assim, um tratamento adequado aos pacientes e uma melhor segurança ao pessoal envolvido e, conseqüentemente, assegurando a garantia de qualidade na braquiterapia por alta taxa de dose.High dose rate brachytherapy has been increasingly recognized in most countries, and radiotherapy services using this equipment are encouraged to have a very efficient quality assurance program to ensure protection for patients, workers and other personnel involved. The objective of this

  16. Nuclear energy and sustainable development: Assuring a solid foundation

    International Nuclear Information System (INIS)

    The financial crisis is having a pronounced impact on industries worldwide. While it is clear that electricity generators are not immune, it is equally clear that the affect of the financial crisis on the global growth of nuclear energy will be limited. Although some projects may be deferred or called into question, global demand for clean energy is growing and worldwide increase in nuclear generation is inevitable. For example, rather than reducing its ambitious development program, China now indicates that its objective is to increase nuclear capacity from 40 000 MWe to 75 000 MWe! India, in spite of economic slowdown, is still adhering to its target of increasing the share of nuclear generation to 9% in the next 25 years. Additionally, the United Arab Emirates has announced its intention to build 5 000 MWe of installed capacity by 2020, and several other countries - especially in the Middle East and East Asia - are considering aggressive programs. These programs come on top of announced expansion in the Americas and Europe. As the growth of nuclear generation is necessary and inevitable for sustainable economic development, the logical corollary is the development of the requisite supporting infrastructure to fuel the continuation and expansion of nuclear generation. This presentation will address the current status and challenges regarding infrastructure development, especially regarding the foundation block for fuel assurance: uranium supply. (author)

  17. Quality assurance for stereotactic radiosurgery using linear accelerator

    International Nuclear Information System (INIS)

    Stereotactic radiosurgery using a linear accelerator requires two quality assurance items; positional accuracy of irradiation and its prescribed dose. Authors have evaluated these two items in the QA program. To evaluate the positional accuracy of irradiation, the alignment of a laser pointer was measured at a isocenter using a target point simulator. The positional accuracy of the gantry and couch rotations of the linear accelerator was evaluated by the 'star shot' method. As to the dose measurement, tissue maximum ratio, off axis ratio, and relative output factor were determined using a diamond detector. Since a laser pointer is susceptible to small vibrations, it should always be checked. The results indicated that the positional accuracy of the gantry and couch rotations must be maintained within 1.0 mm for 360 degrees. As to the dose measurement, TMR, OAR, and ROF should be measured regularly by a small-sized detector with a high sensitivity and low-energy dependance such as a diamond detector. Stereotactic radiosurgery using a linear accelerator requires a QA program. Among other maintenance items in this QA program, the positional accuracy of gantry and couch rotation should be maintained within 1.0 mm for 360 degrees. (author)

  18. Mission assurance increased with regression testing

    Science.gov (United States)

    Lang, R.; Spezio, M.

    Knowing what to test is an important attribute in any testing campaign, especially when it has to be right or the mission could be in jeopardy. The New Horizons mission, developed and operated by the John Hopkins University Applied Physics Laboratory, received a planned major upgrade to their Mission Operations and Control (MOC) ground system architecture. Early in the mission planning it was recognized that the ground system platform would require an upgrade to assure continued support of technology used for spacecraft operations. With the planned update to the six year operational ground architecture from Solaris 8 to Solaris 10, it was critical that the new architecture maintain critical operations and control functions. The New Horizons spacecraft is heading to its historic rendezvous with Pluto in July 2015 and then proceeding into the Kuiper Belt. This paper discusses the Independent Software Acceptance Testing (ISAT) Regression test campaign that played a critical role to assure the continued success of the New Horizons mission. The New Horizons ISAT process was designed to assure all the requirements were being met for the ground software functions developed to support the mission objectives. The ISAT team developed a test plan with a series of test case designs. The test objectives were to verify that the software developed from the requirements functioned as expected in the operational environment. As the test cases were developed and executed, a regression test suite was identified at the functional level. This regression test suite would serve as a crucial resource in assuring the operational system continued to function as required with such a large scale change being introduced. Some of the New Horizons ground software changes required modifications to the most critical functions of the operational software. Of particular concern was the new MOC architecture (Solaris 10) is Intel based and little endian, and the legacy architecture (Solaris 8) was SPA

  19. Assuring health coverage for all in India.

    Science.gov (United States)

    Patel, Vikram; Parikh, Rachana; Nandraj, Sunil; Balasubramaniam, Priya; Narayan, Kavita; Paul, Vinod K; Kumar, A K Shiva; Chatterjee, Mirai; Reddy, K Srinath

    2015-12-12

    Successive Governments of India have promised to transform India's unsatisfactory health-care system, culminating in the present government's promise to expand health assurance for all. Despite substantial improvements in some health indicators in the past decade, India contributes disproportionately to the global burden of disease, with health indicators that compare unfavourably with other middle-income countries and India's regional neighbours. Large health disparities between states, between rural and urban populations, and across social classes persist. A large proportion of the population is impoverished because of high out-of-pocket health-care expenditures and suffers the adverse consequences of poor quality of care. Here we make the case not only for more resources but for a radically new architecture for India's health-care system. India needs to adopt an integrated national health-care system built around a strong public primary care system with a clearly articulated supportive role for the private and indigenous sectors. This system must address acute as well as chronic health-care needs, offer choice of care that is rational, accessible, and of good quality, support cashless service at point of delivery, and ensure accountability through governance by a robust regulatory framework. In the process, several major challenges will need to be confronted, most notably the very low levels of public expenditure; the poor regulation, rapid commercialisation of and corruption in health care; and the fragmentation of governance of health care. Most importantly, assuring universal health coverage will require the explicit acknowledgment, by government and civil society, of health care as a public good on par with education. Only a radical restructuring of the health-care system that promotes health equity and eliminates impoverishment due to out-of-pocket expenditures will assure health for all Indians by 2022--a fitting way to mark the 75th year of India

  20. Assuring health coverage for all in India.

    Science.gov (United States)

    Patel, Vikram; Parikh, Rachana; Nandraj, Sunil; Balasubramaniam, Priya; Narayan, Kavita; Paul, Vinod K; Kumar, A K Shiva; Chatterjee, Mirai; Reddy, K Srinath

    2015-12-12

    Successive Governments of India have promised to transform India's unsatisfactory health-care system, culminating in the present government's promise to expand health assurance for all. Despite substantial improvements in some health indicators in the past decade, India contributes disproportionately to the global burden of disease, with health indicators that compare unfavourably with other middle-income countries and India's regional neighbours. Large health disparities between states, between rural and urban populations, and across social classes persist. A large proportion of the population is impoverished because of high out-of-pocket health-care expenditures and suffers the adverse consequences of poor quality of care. Here we make the case not only for more resources but for a radically new architecture for India's health-care system. India needs to adopt an integrated national health-care system built around a strong public primary care system with a clearly articulated supportive role for the private and indigenous sectors. This system must address acute as well as chronic health-care needs, offer choice of care that is rational, accessible, and of good quality, support cashless service at point of delivery, and ensure accountability through governance by a robust regulatory framework. In the process, several major challenges will need to be confronted, most notably the very low levels of public expenditure; the poor regulation, rapid commercialisation of and corruption in health care; and the fragmentation of governance of health care. Most importantly, assuring universal health coverage will require the explicit acknowledgment, by government and civil society, of health care as a public good on par with education. Only a radical restructuring of the health-care system that promotes health equity and eliminates impoverishment due to out-of-pocket expenditures will assure health for all Indians by 2022--a fitting way to mark the 75th year of India