WorldWideScience

Sample records for assurance program fcap

  1. Performance assurance program plan

    Energy Technology Data Exchange (ETDEWEB)

    Rogers, B.H.

    1997-11-06

    B and W Protec, Inc. (BWP) is responsible for implementing the Performance Assurance Program for the Project Hanford Management Contract (PHMC) in accordance with DOE Order 470.1, Safeguards and Security Program (DOE 1995a). The Performance Assurance Program applies to safeguards and security (SAS) systems and their essential components (equipment, hardware, administrative procedures, Protective Force personnel, and other personnel) in direct support of Category I and H special nuclear material (SNM) protection. Performance assurance includes several Hanford Site activities that conduct performance, acceptance, operability, effectiveness, and validation tests. These activities encompass areas of training, exercises, quality assurance, conduct of operations, total quality management, self assessment, classified matter protection and control, emergency preparedness, and corrective actions tracking and trending. The objective of the Performance Assurance Program is to capture the critical data of the tests, training, etc., in a cost-effective, manageable program that reflects the overall effectiveness of the program while minimizing operational impacts. To aid in achieving this objective, BWP will coordinate the Performance Assurance Program for Fluor Daniel Hanford, Inc. (FDH) and serve as the central point for data collection.

  2. Quality Assurance Program. QAP Workbook.

    Science.gov (United States)

    Pelavin Research Inst., Washington, DC.

    The Quality Assurance Program (QAP) workbook is intended to assist institutions of higher education conduct qualitative and quantitative evaluations of their financial aid operations in relation to requirements of Title IV of the Higher Education Act. The workbook provides a structured approach for incorporating a cyclical Title IV QA system into…

  3. Quality Assurance Program: Beginning Teacher Warranty.

    Science.gov (United States)

    Barr, Robert D.

    This report discusses the Quality Assurance Program at the OSU/WOSC School of Education, a merged school serving Oregon State University and Western Oregon State College. This major reform in teacher education is designed to bring a high level of accountability to teacher education and is called a "Warranty of First-Year Teachers." If,…

  4. The quality assurance program at K & S

    Energy Technology Data Exchange (ETDEWEB)

    Slowey, T.W. [AAPM Accredited Dosimetry Calibration Laboratory, Nashville, TN (United States)

    1993-12-31

    K & S operates the largest and one of the most comprehensive Accredited Dosimetry Calibration Laboratories (ADCLs) in the American Association of Physicists in Medicine (AAPM) secondary laboratory system. It offers calibrations covering energies from Grenz-Ray (0.03-mm Al) to cesium-137 and cobalt-60, brachytherapy source and well chamber calibrations for low-activity sources, and, recently, high-dose-rate iridium-192. The present Quality Assurance (QA) program at K & S began with the AAPM Guidelines for Accreditation (Task Group No. 22 and No. 3, 1989) and grew over the past 10 years to include all aspects of providing a private, self-supporting calibration service from a free-standing independent facility. Some aspects of the QA program were prompted by the requirements of the nuclear power industry while other parts were from national consensus standards or the experiences of staff. Redundancy and teamwork are the most important characteristics of this QA program. K & S has participated in a National Institute of Standards and Technology (NIST) measurement quality assurance (MQA) program since 1982, and, in recent years, an ADCL intralaboratory intercomparison was conducted by Task Group 3 of the Radiation Therapy Committee of the AAPM. One measure of the credibility of a QA program is consistent performance on the MQA program and the ADCL intercomparisons over the past 10 years. An equally important measure of the ability of a program to assure quality results is the frequency of reported errors.

  5. 78 FR 35072 - Proposed Revisions to Reliability Assurance Program

    Science.gov (United States)

    2013-06-11

    ... From the Federal Register Online via the Government Publishing Office NUCLEAR REGULATORY COMMISSION Proposed Revisions to Reliability Assurance Program AGENCY: Nuclear Regulatory Commission. ACTION... Plants: LWR Edition,'' Section 17.4, ``Reliability Assurance Program.'' DATES: Submit comments by July...

  6. Quality Assurance Program for Molecular Medicine Laboratories

    OpenAIRE

    Hajia, M; Safadel, N; Samiee, S Mirab; Dahim, P; Anjarani, S; N Nafisi; Sohrabi, A; M Rafiee; Sabzavi, F; B Entekhabi

    2013-01-01

    Background: Molecular diagnostic methods have played and continuing to have a critical role in clinical laboratories in recent years. Therefore, standardization is an evolutionary process that needs to be upgrade with increasing scientific knowledge, improvement of the instruments and techniques. The aim of this study was to design a quality assurance program in order to have similar conditions for all medical laboratories engaging with molecular tests. Methods: We had to design a plan for al...

  7. 78 FR 7816 - Quality Assurance Program Requirements (Operations)

    Science.gov (United States)

    2013-02-04

    ...'s Agencywide Documents Access and Management System (ADAMS): You may access publicly-available... establishment of Quality Assurance (QA) controls for the implementation of managerial and administrative... COMMISSION Quality Assurance Program Requirements (Operations) AGENCY: Nuclear Regulatory Commission....

  8. Quality Assurance Program for Molecular Medicine Laboratories

    Directory of Open Access Journals (Sweden)

    F Sabzavi

    2013-01-01

    Full Text Available Background: Molecular diagnostic methods have played and continuing to have a critical role in clinical laboratories in recent years. Therefore, standardization is an evolutionary process that needs to be upgrade with increasing scientific knowledge, improvement of the instruments and techniques. The aim of this study was to design a quality assurance program in order to have similar conditions for all medical laboratories engaging with molecular tests.Methods: We had to design a plan for all four elements; required space conditions, equipments, training, and basic guidelines. Necessary guidelines was prepared and confirmed by the launched specific committee at the Health Reference Laboratory.Results: Several workshops were also held for medical laboratories directors and staffs, quality control manager of molecular companies, directors and nominees from universities. Accreditation of equipments and molecular material was followed parallel with rest of program. Now we are going to accredit medical laboratories and to evaluate the success of the program.Conclusion: Accreditation of medical laboratory will be succeeding if its basic elements are provided in advance. Professional practice guidelines, holding training and performing accreditation the molecular materials and equipments ensured us that laboratories are aware of best practices, proper interpretation, limitations of techniques, and technical issues. Now, active external auditing can improve the applied laboratory conditions toward the defined standard level.

  9. 10 CFR 830.121 - Quality Assurance Program (QAP).

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Quality Assurance Program (QAP). 830.121 Section 830.121... Assurance Program (QAP). (a) Contractors conducting activities, including providing items or services, that... must: (1) Submit a QAP to DOE for approval and regard the QAP as approved 90 days after...

  10. Quality Assurance Program Plan for radionuclide airborne emissions monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Vance, L.M.

    1993-07-01

    This Quality Assurance Program Plan (QAPP) describes the quality assurance requirements and responsibilities for radioactive airborne emissions measurements activities from regulated stacks are controlled at the Hanford Site. Detailed monitoring requirements apply to stacks exceeding 1% of the standard of 10 mrem annual effective dose equivalent to the maximally exposed individual from operations of the Hanford Site.

  11. Building a global information assurance program

    CERN Document Server

    Curts, Raymond J

    2002-01-01

    INTRODUCTION TO INFORMATION ASSURANCE (IA)AuthenticationConfidentialityNon-repudiationBASIC CONCEPTSAttributesInformation AttributesPure Information AttributesAttributes Influenced by the SystemSystem AttributesSecurity AttributesInformation System Support Planning PrinciplesThe Bottom Line, RevisitedInformation Assurance (IA)Commercial CapabilitiesSecurityNetwork ViewsRisk ManagementCognitive HierarchyTypes of LogicSummaryRISK, THREAT AND VULNERABILITYOVERVIEW OF SYSTEMS ENGINEERINGA Systems Engineering Case StudyCase Study BackgroundThe MissionThe GoalAn Approach Toward A SolutionCase Tools:

  12. Marshall Island radioassay quality assurance program an overview

    Energy Technology Data Exchange (ETDEWEB)

    Conrado, C.L.; Hamilton, T.F.; Kehl, S.R.; Robison, W.L.; Stoker, A.C.

    1998-09-01

    The Lawrence Livermore National Laboratory has developed an extensive quality assurance program to provide high quality data and assessments in support of the Marshall Islands Dose Assessment and Radioecology Program. Our quality assurance objectives begin with the premise of providing integrated and cost-effective program support (to meet wide-ranging programmatic needs, scientific peer review, litigation defense, and build public confidence) and continue through from design and implementation of large-scale field programs, sampling and sample preparation, radiometric and chemical analyses, documentation of quality assurance/quality control practices, exposure assessments, and dose/risk assessments until publication. The basic structure of our radioassay quality assurance/quality control program can be divided into four essential elements; (1) sample and data integrity control; (2) instrument validation and calibration; (3) method performance testing, validation, development and documentation; and (4) periodic peer review and on-site assessments. While our quality assurance objectives are tailored towards a single research program and the evaluation of major exposure pathways/critical radionuclides pertinent to the Marshall Islands, we have attempted to develop quality assurance practices that are consistent with proposed criteria designed for laboratory accre

  13. Transuranic Waste Characterization Quality Assurance Program Plan

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-04-30

    This quality assurance plan identifies the data necessary, and techniques designed to attain the required quality, to meet the specific data quality objectives associated with the DOE Waste Isolation Pilot Plant (WIPP). This report specifies sampling, waste testing, and analytical methods for transuranic wastes.

  14. 78 FR 54510 - New Entrant Safety Assurance Program Operational Test

    Science.gov (United States)

    2013-09-04

    ... motor carrier received its USDOT Number. The Agency currently devotes the same resources in travel costs and staff time to on-site reviews of low-risk and higher-risk new entrant motor carriers. The FMCSA... TRANSPORTATION Federal Motor Carrier Safety Administration New Entrant Safety Assurance Program Operational...

  15. 77 FR 22376 - Airport Improvement Program (AIP) Grant Assurances

    Science.gov (United States)

    2012-04-13

    .... Airport Revenues. a. All revenues generated by the airport and any local taxes on aviation fuel... airport, local taxes on aviation fuel) shall not apply. (2) If the Secretary approves the sale of a... Federal Aviation Administration Airport Improvement Program (AIP) Grant Assurances AGENCY:...

  16. The role of the EPA radiation quality assurance program in the measurement quality assurance accreditation program for radioassay laboratories

    Energy Technology Data Exchange (ETDEWEB)

    Grady, T.M. [Environmental Monitoring Systems Laboratory, Las Vegas, NV (United States)

    1993-12-31

    As the nature and extent of radiological contamination becomes better documented and more public, radioanalytical laboratories are faced with a constantly expanding variety of new and difficult analytical requirements. Concurrent with those requirements is the responsibility to provide customers, regulatory officials, or the public with defensible data produced in an environment of verifiable, controlled quality. To meet that need, a quality assurance accreditation program for radioassay laboratories has been proposed by the American National Standards Institute (ANSI). The standard will provide the organizational framework and functional requirements needed to assure the quality of laboratory outputs. Under the proposed program, the U.S. Environmental Protection Agency`s (EPA`s) Laboratory Intercomparison Program plays a key role as a reference laboratory. The current and proposed roles of the EPA Intercomparison Program are discussed, as are the functional relationships between EPA, the accreditating organization, and the service and monitoring laboratories.

  17. Developing a quality assurance program for online services.

    OpenAIRE

    Humphries, A W; Naisawald, G V

    1991-01-01

    A quality assurance (QA) program provides not only a mechanism for establishing training and competency standards, but also a method for continuously monitoring current service practices to correct shortcomings. The typical QA cycle includes these basic steps: select subject for review, establish measurable standards, evaluate existing services using the standards, identify problems, implement solutions, and reevaluate services. The Claude Moore Health Sciences Library (CMHSL) developed a qua...

  18. NIF Project Quality Assurance Program Plan Revision E

    Energy Technology Data Exchange (ETDEWEB)

    Dun, C; Brereton, S; Yatabe, J; Moses, E I

    2001-06-01

    The National Ignition Facility (NIF) is a key constituent of the Department Energy's (DOE's) Stockpile Stewardship Program. The NIF will use inertial confinement fusion (ICF) to produce ignition and energy gain in ICF targets and will perform weapons physics, weapons effects, and high-energy-density experiments in support of national security and civilian objectives. The primary mission of the NIF Project is the design and construction of the facility and equipment, acceptance testing, and activation. To accomplish this mission, the LLNL Director created the NIF Programs Directorate, and within that Directorate, the NIF Project Office to organize and manage the Project. The NIF Project Office establishes this QA Program to ensure its success. This QA Program Plan (QAPP) defines and describes the program--the management system--for specifying, achieving, and assuring the quality of all NIF Project work consistent with the policies of LLNL and the NIF Programs Directorate.

  19. Quality Assurance Program Plan (QAPP) Waste Management Project

    Energy Technology Data Exchange (ETDEWEB)

    VOLKMAN, D.D.

    1999-10-27

    This document is the Quality Assurance Program Plan (QAPP) for Waste Management Federal Services of Hanford, Inc. (WMH), that implements the requirements of the Project Hanford Management Contract (PHMC), HNF-MP-599, Project Hanford Quality Assurance Program Description (QAPD) document, and the Hanford Federal Facility Agreement with Consent Order (Tri-Party Agreement), Sections 6.5 and 7.8. WHM is responsible for the treatment, storage, and disposal of liquid and solid wastes generated at the Hanford Site as well as those wastes received from other US Department of Energy (DOE) and non-DOE sites. WMH operations include the Low-Level Burial Grounds, Central Waste Complex (a mixed-waste storage complex), a nonradioactive dangerous waste storage facility, the Transuranic Storage Facility, T Plant, Waste Receiving and Processing Facility, 200 Area Liquid Effluent Facility, 200 Area Treated Effluent Disposal Facility, the Liquid Effluent Retention Facility, the 242-A Evaporator, 300 Area Treatment Effluent Disposal Facility, the 340 Facility (a radioactive liquid waste handling facility), 222-S Laboratory, the Waste Sampling and Characterization Facility, and the Hanford TRU Waste Program.

  20. Developing a quality assurance program for online services.

    Science.gov (United States)

    Humphries, A W; Naisawald, G V

    1991-07-01

    A quality assurance (QA) program provides not only a mechanism for establishing training and competency standards, but also a method for continuously monitoring current service practices to correct shortcomings. The typical QA cycle includes these basic steps: select subject for review, establish measurable standards, evaluate existing services using the standards, identify problems, implement solutions, and reevaluate services. The Claude Moore Health Sciences Library (CMHSL) developed a quality assurance program for online services designed to evaluate services against specific criteria identified by research studies as being important to customer satisfaction. These criteria include reliability, responsiveness, approachability, communication, and physical factors. The application of these criteria to the library's existing online services in the quality review process is discussed with specific examples of the problems identified in each service area, as well as the solutions implemented to correct deficiencies. The application of the QA cycle to an online services program serves as a model of possible interventions. The use of QA principles to enhance online service quality can be extended to other library service areas.

  1. Quality Assurance of Joint Degree Programs from the Perspective of Quality Assurance Agencies: Experience in East Asia

    Science.gov (United States)

    Hou, Yung-Chi; Ince, Martin; Tsai, Sandy; Wang, Wayne; Hung, Vicky; Lin Jiang, Chung; Chen, Karen Hui-Jung

    2016-01-01

    Joint degree programs have gained popularity in East Asia, due to the growth of transnational higher education in the region since 2000. However, the external quality assurance (QA) and accreditation of joint degree programs is a challenge for QA agencies, as it normally involves the engagement of several institutions and multiple national…

  2. Quality Assurance of ARM Program Climate Research Facility Data

    Energy Technology Data Exchange (ETDEWEB)

    Peppler, RA; Kehoe, KE; Sonntag, KL; Bahrmann, CP; Richardson, SJ; Christensen, SW; McCord, RA; Doty, DJ; Wagener, Richard [BNL; Eagan, RC; Lijegren, JC; Orr, BW; Sisterson, DL; Halter, TD; Keck, NN; Long, CN; Macduff, MC; Mather, JH; Perez, RC; Voyles, JW; Ivey, MD; Moore, ST; Nitschke, DL; Perkins, BD; Turner, DD

    2008-03-01

    This report documents key aspects of the Atmospheric Radiation Measurement (ARM) Climate Research Facility (ACRF) data quality assurance program as it existed in 2008. The performance of ACRF instruments, sites, and data systems is measured in terms of the availability, usability, and accessibility of the data to a user. First, the data must be available to users; that is, the data must be collected by instrument systems, processed, and delivered to a central repository in a timely manner. Second, the data must be usable; that is, the data must be inspected and deemed of sufficient quality for scientific research purposes, and data users must be able to readily tell where there are known problems in the data. Finally, the data must be accessible; that is, data users must be able to easily find, obtain, and work with the data from the central repository. The processes described in this report include instrument deployment and calibration; instrument and facility maintenance; data collection and processing infrastructure; data stream inspection and assessment; the roles of value-added data processing and field campaigns in specifying data quality and haracterizing the basic measurement; data archival, display, and distribution; data stream reprocessing; and engineering and operations management processes and procedures. Future directions in ACRF data quality assurance also are presented.

  3. Data Quality Assurance Program Plan for NRC Division of Risk Analysis Programs at the INL

    Energy Technology Data Exchange (ETDEWEB)

    Sattison, Martin B. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Wierman, Thomas E. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Vedros, Kurt G. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Germain, Shawn W. St. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Eide, Steven A. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Sant, Robert L. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2009-07-01

    The Division of Risk Analysis (DRA), Office of Nuclear Regulatory Research (RES), must ensure that the quality of the data that feed into its programs follow Office of Management and Budget (OMB) and U.S. Nuclear Regulatory Commission (NRC) guidelines and possibly other standards and guidelines used in nuclear power plant risk analyses. This report documents the steps taken in DRA’s Data Quality Improvement project (Job Control Number N6145) to develop a Data Quality Assurance Program Plan. These steps were 1. Conduct a review of data quality requirements 2. Review current data programs, products, and data quality control activities 3. Review the Institute of Nuclear Power Operation (INPO) Equipment Performance and Information Exchange (EPIX) data quality programs and characterize the EPIX data quality and uncertainty 4. Compare these programs, products, and activities against the requirements 5. Develop a program plan that provides assurance that data quality is being maintained. It is expected that the Data Quality Assurance Program Plan will be routinely implemented in all aspects of future data collection and processing efforts and that specific portions will be executed annually to provide assurance that data quality is being maintained.

  4. Quality assurance and performance improvement in intraoperative neurophysiologic monitoring programs.

    Science.gov (United States)

    Tamkus, Arvydas A; Rice, Kent S; McCaffrey, Michael T

    2013-03-01

    Quality assurance (QA) as it relates to intraoperative neurophysiological monitoring (IONM) can be defined as the systematic monitoring, evaluation, and modification of the IONM service to insure that desired standards of quality are being met. In practice, that definition is usually extended to include the concept that the quality of the IONM service will be improved wherever possible and, although there are some differences in the two terms, in this article the term QA will be understood to include quality improvement (QI) processes as well. The measurement and documentation of quality is becoming increasingly important to healthcare providers. This trend is being driven by pressures from accrediting agencies, payers, and patients. The essential elements of a QA program are described. A real-life example of QA techniques and management relevant to IONM providers is presented and discussed.

  5. Waste Encapsulation and Storage Facility (WESF) Quality Assurance Program Plan (QAPP)

    Energy Technology Data Exchange (ETDEWEB)

    ROBINSON, P.A.

    2000-04-17

    This Quality Assurance Plan describes how the Waste Encapsulation and Storage Facility (WESF) implements the quality assurance (QA) requirements of the Quality Assurance Program Description (QAPD) (HNF-Mp-599) for Project Hanford activities and products. This QAPP also describes the organizational structure necessary to successfully implement the program. The QAPP provides a road map of applicable Project Hanford Management System Procedures, and facility specific procedures, that may be utilized by WESF to implement the requirements of the QAPD.

  6. Risk assessment in the DOE Assurance Program for Remedial Action

    Energy Technology Data Exchange (ETDEWEB)

    Marks, S.; Cross, F.T.; Denham, D.H.; Kennedy, W.E.; Stenner, R.D.

    1985-08-01

    This document provides information obtained during the performance of risk assessment tasks in support of the Assurance Program for Remedial Action (APRA) sponsored by the Office of Operational Safety of the Department of Energy. We have presented a method for the estimation of projected health effects at properties in the vicinity of uranium mill tailing piles due to transported tailings or emissions from the piles. Because radon and radon daughter exposure is identified as the principal factor contributing to health effects at such properties, the basis for estimating lung cancer risk as a result of such exposure is discussed in detail. Modeling of health risk due to a secondary pathway, ingestion of contaminated, home-grown food products, is also discussed since it is a potentially important additional source of exposure in certain geographic locations. Risk assessment methods used in various mill tailings reports are reviewed. The protocols for radiological surveys conducted in DOE-sponsored remedial action programs are critically reviewed with respect to their relevance to the needs of health risk estimation. The relevance of risk assessment to the APRA program is discussed briefly.

  7. Who Shall Control Entry to Teacher Education? North Carolina Quality Assurance Program.

    Science.gov (United States)

    Knight, J. Pat

    A Quality Assurance Program (QAP) has been established by North Carolina as a means of assuring competent professional programs for teacher education. The QAP is based on two major premises: (1) Crucial competencies for teacher effectiveness can be identified, verified, and validated; and (2) Teacher education begins at initial entry and…

  8. Extending cluster lot quality assurance sampling designs for surveillance programs.

    Science.gov (United States)

    Hund, Lauren; Pagano, Marcello

    2014-07-20

    Lot quality assurance sampling (LQAS) has a long history of applications in industrial quality control. LQAS is frequently used for rapid surveillance in global health settings, with areas classified as poor or acceptable performance on the basis of the binary classification of an indicator. Historically, LQAS surveys have relied on simple random samples from the population; however, implementing two-stage cluster designs for surveillance sampling is often more cost-effective than simple random sampling. By applying survey sampling results to the binary classification procedure, we develop a simple and flexible nonparametric procedure to incorporate clustering effects into the LQAS sample design to appropriately inflate the sample size, accommodating finite numbers of clusters in the population when relevant. We use this framework to then discuss principled selection of survey design parameters in longitudinal surveillance programs. We apply this framework to design surveys to detect rises in malnutrition prevalence in nutrition surveillance programs in Kenya and South Sudan, accounting for clustering within villages. By combining historical information with data from previous surveys, we design surveys to detect spikes in the childhood malnutrition rate.

  9. Clinical microbiology quality assurance program: a Taiwan experience.

    Science.gov (United States)

    Tsai, W C; Wu, J L; Luh, K T

    1995-05-01

    Quality assurance programs have been established during the last two decades in developed countries to promote high quality performance in clinical laboratories. In Taiwan, such a program for clinical microbiology laboratories has been in place since July 1987. It has been supported by the Department of Health, Executive Yuan, R.O.C. and was set up by the authors. The manpower status, facilities and equipment, and performance of clinical laboratories were investigated during the first year and standards of laboratory quality were recommended. Since then, under a continuing education program, we have conducted seminars, symposia, workshops, short-courses or panel discussions approximately 4 times a year. There have been about 150 participants per session and they have come from local hospitals (primary care hospitals), regional hospitals (secondary care hospitals) and medical centers (tertiary care hospitals). Proficiency test specimens or external unknown specimens were sent to all the laboratories twice a year and approximately 3 specimens were used each time for the evaluation of each laboratory's diagnostic capability and quality of service. Results indicated that there were tremendous improvements in the quality of laboratory performance. At the same time, several laboratory manuals describing the methods of quality control of clinical specimens, test procedures, media and reagents, personnel management and a compilation of reports etc. were published as guidelines of basic requirements for each level of the laboratories. For local hospital laboratories in remote areas, several regional hospitals or medical centers with high quality laboratories were selected to serve as back-ups. Our evaluation has shown that the performance and quality of service provided by most clinical microbiology laboratories in Taiwan have now reached nearly the level of those found in the so-called "developed countries".

  10. Development of a quality assurance program for ionizing radiation secondary calibration laboratories

    Energy Technology Data Exchange (ETDEWEB)

    Heaton, H.T. II; Taylor, A.R. Jr. [Center for Devices and Radiological Health, Rockville, MD (United States)

    1993-12-31

    For calibration laboratories, routine calibrations of instruments meeting stated accuracy goals are important. One method of achieving the accuracy goals is to establish and follow a quality assurance program designed to monitor all aspects of the calibration program and to provide the appropriate feedback mechanism if adjustments are needed. In the United States there are a number of organizations with laboratory accreditation programs. All existing accreditation programs require that the laboratory implement a quality assurance program with essentially the same elements in all of these programs. Collectively, these elements have been designated as a Measurement Quality Assurance (MQA) program. This paper will briefly discuss the interrelationship of the elements of an MQA program. Using the Center for Devices and Radiological Health (CDRH) X-ray Calibration Laboratory (XCL) as an example, it will focus on setting up a quality control program for the equipment in a Secondary Calibration Laboratory.

  11. Standard guide for establishing a quality assurance program for uranium conversion facilities

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2004-01-01

    1.1 This guide provides guidance and recommended practices for establishing a comprehensive quality assurance program for uranium conversion facilities. 1.2 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate health and safety practices and determine the applicability of regulatory limitations prior to use. 1.3 The basic elements of a quality assurance program appear in the following order: FUNCTION SECTION Organization 5 Quality Assurance Program 6 Design Control 7 Instructions, Procedures & Drawings 8 Document Control 9 Procurement 10 Identification and Traceability 11 Processes 12 Inspection 13 Control of Measuring and Test Equipment 14 Handling, Storage and Shipping 15 Inspection, Test and Operating Status 16 Control of Nonconforming Items 17 Corrective Actions 18 Quality Assurance Records 19 Audits 20 TABLE 1 NQA-1 Basic Requirements Relat...

  12. Quality assurance program description: Hanford Waste Vitrification Plant, Part 1. Revision 3

    Energy Technology Data Exchange (ETDEWEB)

    1992-12-31

    This document describes the Department of Energy`s Richland Field Office (DOE-RL) quality assurance (QA) program for the processing of high-level waste as well as the Vitrification Project Quality Assurance Program for the design and construction of the Hanford Waste Vitrification Plant (HWVP). It also identifies and describes the planned activities that constitute the required quality assurance program for the HWVP. This program applies to the broad scope of quality-affecting activities associated with the overall HWVP Facility. Quality-affecting activities include designing, purchasing, fabricating, handling, shipping, storing, cleaning, erecting, installing, inspecting, testing, maintaining, repairing, and modifying. Also included are the development, qualification, and production of waste forms which may be safely used to dispose of high-level radioactive waste resulting from national defense activities. The HWVP QA program is made up of many constituent programs that are being implemented by the participating organizations. This Quality Assurance program description is intended to outline and define the scope and application of the major programs that make up the HWVP QA program. It provides a means by which the overall program can be managed and directed to achieve its objectives. Subsequent parts of this description will identify the program`s objectives, its scope, application, and structure.

  13. Multi-Function Waste Tank Facility Quality Assurance Program Plan, Project W-236A. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Hall, L.R.

    1995-05-30

    This document describes the Quality Assurance (QA) program for the Multi-Function Waste Tank Facility (MWTF) Project. The purpose of this QA program is to control project activities in such a manner as to achieve the mission of the MWTF Project in a safe and reliable manner. The QA program for the MWTF Project is founded on DOE Order 5700.6C, Quality Assurance, and implemented through the use of ASME NQA-1, Quality Assurance Program Requirements for Nuclear Facilities (ASME 1989 with addenda la-1989, lb-1991 and lc-1992). This document describes the program and planned actions which the Westinghouse Hanford Company (WHC) will implement to demonstrate and ensure that the project meets the requirements of DOE Order 5700.6C through the interpretive guidance of ASME NQA-1.

  14. Evaluation and recommendations on U. C. Lawrence Livermore Labortory Quality Assurance Program

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, F.D.; Horner, M.H.

    1978-04-12

    A study was conducted of the University of California's Lawrence Livermore Laboratory Quality Assurance Program, which focused on training needs and recommendations tailored to the various on-going programs. Specific attention was directed to an assessment of the quality status for the MFTF facility and the capabilities of assigned quality project engineers. Conclusions and recommendations are presented which not only address the purpose of this study, but extend into other areas to provide insight and needs for a total cost effective application of a quality assurance program.

  15. 42 CFR 417.106 - Quality assurance program; Availability, accessibility, and continuity of basic and supplemental...

    Science.gov (United States)

    2010-10-01

    ... PROGRAM HEALTH MAINTENANCE ORGANIZATIONS, COMPETITIVE MEDICAL PLANS, AND HEALTH CARE PREPAYMENT PLANS Qualified Health Maintenance Organizations: Services § 417.106 Quality assurance program; Availability... following conditions: (1) Stresses health outcomes to the extent consistent with the state of the art....

  16. Project Hanford management contract quality assurance program implementation plan for nuclear facilities

    Energy Technology Data Exchange (ETDEWEB)

    Bibb, E.K.

    1997-10-15

    During transition from the Westinghouse Hanford Company (WHC) Management and Operations (M and O) contract to the Fluor Daniel Hanford (FDH) Management and Integration (M and I) contract, existing WHC policies, procedures, and manuals were reviewed to determine which to adopt on an interim basis. Both WHC-SP-1131,Hanford Quality Assurance Program and Implementation Plan, and WHC-CM-4-2, Quality Assurance Manual, were adopted; however, it was recognized that revisions were required to address the functions and responsibilities of the Project Hanford Management Contract (PHMC). This Quality Assurance Program Implementation Plan for Nuclear Facilities (HNF-SP-1228) supersedes the implementation portion of WHC-SP-1 13 1, Rev. 1. The revised Quality Assurance (QA) Program is documented in the Project Hanford Quality Assurance Program Description (QAPD), HNF-MP-599. That document replaces the QA Program in WHC-SP-1131, Rev. 1. The scope of this document is limited to documenting the nuclear facilities managed by FDH and its Major Subcontractors (MSCS) and the status of the implementation of 10 CFR 830.120, Quality Assurance Requirements, at those facilities. Since the QA Program for the nuclear facilities is now documented in the QAPD, future updates of the information provided in this plan will be by letter. The layout of this plan is similar to that of WHC-SP-1 13 1, Rev. 1. Sections 2.0 and 3.0 provide an overview of the Project Hanford QA Program. A list of Project Hanford nuclear facilities is provided in Section 4.0. Section 5.0 provides the status of facility compliance to 10 CFR 830.120. Sections 6.0, 7.0, and 8.0 provide requested exemptions, status of open items, and references, respectively. The four appendices correspond to the four projects that comprise Project Hanford.

  17. Summary report on the Solar Consumer Assurance Network (SOLCAN) Program Planning Task in the southern region

    Energy Technology Data Exchange (ETDEWEB)

    Browne, M. B. [comp.

    1981-03-15

    The goal of the SOLCAN Program Planning Task is to assist in the development, at the state and local levels, of consumer assurance approaches that will support the accelerated adoption and effective use of new products promoted by government incentives to consumers to meet our nation's energy needs. The task includes state-conducted evaluations and state SOLCAN meetings to identify consumer assurance mechanisms, assess their effectiveness, and identify and describe alternative means for strengthening consumer and industry assurance in each state. Results of the SOLCAN process are presented, including: a Solar Consumer Protection State Assessment Guide; State Solar Consumer Assurance Resources for Selected States; State Solar Consumer Protection Assessment Interviews for Florida; and state SOLCAN meeting summaries and participants. (LEW)

  18. John F. Kennedy Space Center, Safety, Reliability, Maintainability and Quality Assurance, Survey and Audit Program

    Science.gov (United States)

    1994-01-01

    This document is the product of the KSC Survey and Audit Working Group composed of civil service and contractor Safety, Reliability, and Quality Assurance (SR&QA) personnel. The program described herein provides standardized terminology, uniformity of survey and audit operations, and emphasizes process assessments rather than a program based solely on compliance. The program establishes minimum training requirements, adopts an auditor certification methodology, and includes survey and audit metrics for the audited organizations as well as the auditing organization.

  19. Standard guide for establishing a quality assurance program for analytical chemistry laboratories within the nuclear industry

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2006-01-01

    1.1 This guide covers the establishment of a quality assurance (QA) program for analytical chemistry laboratories within the nuclear industry. Reference to key elements of ANSI/ISO/ASQC Q9001, Quality Systems, provides guidance to the functional aspects of analytical laboratory operation. When implemented as recommended, the practices presented in this guide will provide a comprehensive QA program for the laboratory. The practices are grouped by functions, which constitute the basic elements of a laboratory QA program. 1.2 The essential, basic elements of a laboratory QA program appear in the following order: Section Organization 5 Quality Assurance Program 6 Training and Qualification 7 Procedures 8 Laboratory Records 9 Control of Records 10 Control of Procurement 11 Control of Measuring Equipment and Materials 12 Control of Measurements 13 Deficiencies and Corrective Actions 14

  20. Quality Assurance of Computer Programs for Photopeak Integration in Activation Analysis

    DEFF Research Database (Denmark)

    Heydorn, Kaj

    1978-01-01

    the radionuclide in question, and qualitative analysis is therefore needed only to the extent that the decay characteristics of this radionuclide could be confused with those of other possible radionuclides, thus interfering with its determination. The quality of these computer programs can only be assured...

  1. Mammography in public hospitals at Rio de Janeiro: a quality assurance program

    Energy Technology Data Exchange (ETDEWEB)

    Briquet, C.; Coutinho, C.M.C.; Mota, H.C.; Tavares, E. [Instituto de Radioprotecao e Dosimetria/ Commisao Nacional de Energia Nuclear. Av. Salvador Allende, s/n CEP: 22780-160. Rio de Janeiro (Brazil)

    1998-12-31

    This paper presents the preliminary results and the methodology followed by the implementation of a Quality Assurance Program in public hospitals at Rio de Janeiro. We observed that the main problems of image are due to the processing. None facility has a dedicated processor and the processor daily quality control is a concern not yet adopted. (Author)

  2. Quality Assurance of Non-Local Accounting Programs Conducted in Hong Kong

    Science.gov (United States)

    Cheng, Mei-Ai; Leung, Noel W.

    2014-01-01

    This study examines the current government policy and institutional practice on quality assurance of non-local accounting programs conducted in Hong Kong. Both international guidelines, national regulations and institutional frameworks in higher education and transnational higher education, and professional practice in accounting education are…

  3. Quality Matters: A Faculty-Centred Program to Assure Quality in Online Course Design

    Science.gov (United States)

    Shattuck, Kay

    2010-01-01

    One of the dilemmas faced by today's faculty is assuring quality in online courses. As one solution to that dilemma, Quality Matters (QM), a program of MarylandOnline, built a rubric of design standards informed by existing research literature and best practices. The rubric was implemented within a faculty-centred, peer review process in which…

  4. Quality Assurance in Higher Education: An Outline Adaptable to Small Colleges Offerings On and Off-Campus Programs.

    Science.gov (United States)

    Steinkrauss, Philip J.; Kranz, M. Rosaria

    A Quality Assurance Program (QAP) developed at the College of St. Francis is presented that is based on an open systems approach. The model allows an institution to continually monitor, evaluate, and, when necessary, modify its academic programs, graduates or undergraduate, traditionally or non-traditionally delivered, to assure quality. Part I…

  5. Plutonium immobilization project development and testing quality assurance program description - February 1999

    Energy Technology Data Exchange (ETDEWEB)

    MacLean, L M; Ziemba, J

    1999-02-01

    Lawrence Livermore National Laboratory Immobilization Development and Testing organization (LLNL ID and T) is a Participant in the Plutonium Immobilization Project (PIP). The LLNL D and T has lead responsibilities for form characterization and qualification, ceramic form development, process/equipment development with plutonium, and process systems testing and validation for both conversion and immobilization. This work must be performed in accordance with the graded approach of a Quality Assurance (QA) Program. A QA Program has been developed at LLNL to meet the requirements of the DOE/MD Quality Assurance Requirements. The LLNL QA Program consists of a Quality Assurance Program Description (QAPD) and Quality Implementing Procedures. These documents interface and are a subset of the overall PIP QA Program Documents. The PIP QA Program is described in the PIP ID and T QA Plan, PIP QAPD, and QA Procedures. Other Participant Organizations also must document and describe their PIP compliant QA Programs in a QAPD and implementing procedures. The purpose of this LLNL QAPD is to describe the organization, management processes, QA Controls for Grading, functional responsibilities, levels of authority, and interfaces for those managing, performing, and assessing the adequacy of work.

  6. An Overview of ARM Program Climate Research Facility Data Quality Assurance

    Energy Technology Data Exchange (ETDEWEB)

    Peppler, Randy A. [University of Oklahoma, Norman; Long, Chuck A. [Pacific Northwest National Laboratory (PNNL); Sisterson, D. L. [Argonne National Laboratory (ANL); Turner, D. [University of Wisconsin; Bahrmann, C. P. [Pennsylvania State University; Christensen, Sigurd W [ORNL; Doty, K. J. [Brookhaven National Laboratory (BNL); Eagan, R. C. [Argonne National Laboratory (ANL); Halter, T. D. [Pacific Northwest National Laboratory (PNNL); Ivey, M. D. [Sandia National Laboratories (SNL); Keck, N. N. [Pacific Northwest National Laboratory (PNNL); Kehoe, Kenneth E. [University of Oklahoma, Norman; Liljegren, J. C. [Argonne National Laboratory (ANL); Macduff, M. C. [Pacific Northwest National Laboratory (PNNL); Mather, J. H. [Pacific Northwest National Laboratory (PNNL); McCord, Raymond A [ORNL; Monroe, Justin W. [University of Oklahoma; Moore, Sean T. [Mission Research and Technical Services; Nitschke, K. L. [Los Alamos National Laboratory (LANL); Orr, B. W. [Argonne National Laboratory (ANL); Perez, Robin C. [Pacific Northwest National Laboratory (PNNL); Perkins, B. D. [Los Alamos National Laboratory (LANL); Richardson, S. J. [Pennsylvania State University; Sonntag, Karen L. [University of Oklahoma, Norman; Voyles, Jimmy W. [Pacific Northwest National Laboratory (PNNL); Wagener, Richard [Brookhaven National Laboratory (BNL)

    2008-10-30

    This report documents key aspects of the Atmospheric Radiation Measurement (ARM) Program's data quality assurance program. Processes described include data archival, display, and distribution, data stream reprocessing, and future directions in ARM data quality checking. A comprehensive, end-to-end data quality assurance program, from instrument siting, to calibration and maintenance, through data quality control and well-documented dissemination, is essential for producing a high-quality research data set. The processes developed over the past 15 years by the ARM Program offer a possible framework for use by other instrumentation-diverse networks, and are offered here to highlight the myriad aspects that go into producing such a data set.

  7. 40 CFR 264.19 - Construction quality assurance program.

    Science.gov (United States)

    2010-07-01

    ... components, where applicable: (i) Foundations; (ii) Dikes; (iii) Low-permeability soil liners; (iv... 264.301. (2) The CQA program shall include test fills for compacted soil liners, using the same... fill, where data are sufficient to show that a constructed soil liner will meet the...

  8. USCEA/NIST measurement assurance programs for the radiopharmaceutical and nuclear power industries

    Energy Technology Data Exchange (ETDEWEB)

    Golas, D.B. [Council for Energy Awareness, Washington, DC (United States)

    1993-12-31

    In cooperation with the U.S. Council for Energy Awareness (USCEA), the National Institute of Standards and Technology (NIST) supervises and administers two measurement assurance programs for radioactivity measurement traceability. One, in existence since the mid 1970s, provides traceability to suppliers of radiochemicals and radiopharmaceuticals, dose calibrators, and nuclear pharmacy services. The second program, begun in 1987, provides traceability to the nuclear power industry for utilities, source suppliers, and service laboratories. Each program is described, and the results of measurements of samples of known, but undisclosed activity, prepared at NIST and measured by the participants are presented.

  9. Implementation of a quality assurance program for computerized treatment planning systems.

    Science.gov (United States)

    Camargo, Priscilla R T L; Rodrigues, Laura N; Furnari, Laura; Rubo, Rodrigo A

    2007-07-01

    In the present investigation, the necessary tests for implementing a quality assurance program for a commercial treatment planning system (TPS), recently installed at Sao Paulo University School of Medicine Clinicas Hospital-Brazil, was established and performed in accordance with the new IAEA publication TRS 430, and with AAPM Task Group 53. The tests recommended by those documents are classified mainly into acceptance, commissioning (dosimetric and nondosimetric), periodic quality assurance, and patient specific quality assurance tests. The recommendations of both IAEA and AAPM documents are being implemented at the hospital for photon beams produced by two linear accelerators. A Farmer ionization chamber was used in a 30 x 30 x 30 cm3 phantom with a dose rate of 320 monitor unit (MU)/min and 50 MU in the case of the dosimetric tests. The acceptance tests verified hardware, network systems integration, data transfer, and software parameters. The results obtained are in good agreement with the specifications of the manufacturer. For the commissioning dosimetric tests, the absolute dose was measured for simple geometries, such as square and rectangular fields, up to more complex geometries such as off-axis hard wedges and for behavior in the build up region. Results were analysed by the use of confidence limit as proposed by Venselaar et al. [Radio Ther. Oncol. 60, 191-201 (2001)]. Criteria of acceptability had been applied also for the comparison between the values of MU calculated manually and MU generated by TPS. The results of the dosimetric tests show that work can be reduced by choosing to perform only those that are more crucial, such as oblique incidence, shaped fields, hard wedges, and buildup region behavior. Staff experience with the implementation of the quality assurance program for a commercial TPS is extremely useful as part of a training program.

  10. The Evolution of the NASA Commercial Crew Program Mission Assurance Process

    Science.gov (United States)

    Canfield, Amy C.

    2016-01-01

    In 2010, the National Aeronautics and Space Administration (NASA) established the Commercial Crew Program (CCP) in order to provide human access to the International Space Station and low Earth orbit via the commercial (non-governmental) sector. A particular challenge to NASA has been how to determine that the Commercial Provider's transportation system complies with programmatic safety requirements. The process used in this determination is the Safety Technical Review Board which reviews and approves provider submitted hazard reports. One significant product of the review is a set of hazard control verifications. In past NASA programs, 100% of these safety critical verifications were typically confirmed by NASA. The traditional Safety and Mission Assurance (S&MA) model does not support the nature of the CCP. To that end, NASA S&MA is implementing a Risk Based Assurance process to determine which hazard control verifications require NASA authentication. Additionally, a Shared Assurance Model is also being developed to efficiently use the available resources to execute the verifications.

  11. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) Quality Assurance Manual

    Energy Technology Data Exchange (ETDEWEB)

    C. L. Smith; R. Nims; K. J. Kvarfordt; C. Wharton

    2008-08-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) is a software application developed for performing a complete probabilistic risk assessment using a personal computer running the Microsoft Windows operating system. SAPHIRE is primarily funded by the U.S. Nuclear Regulatory Commission (NRC). The role of the INL in this project is that of software developer and tester. This development takes place using formal software development procedures and is subject to quality assurance (QA) processes. The purpose of this document is to describe how the SAPHIRE software QA is performed for Version 6 and 7, what constitutes its parts, and limitations of those processes.

  12. Assurance Program for Remedial Action (APRA) microcomputer-operated bibliography management system

    Energy Technology Data Exchange (ETDEWEB)

    Stenner, R.D.; Washburn, D.K.; Denham, D.H.

    1985-06-01

    Pacific Northwest Laboratory (PNL) provided technical assistance to the Office of Operational Safety (OOS) in developing their Assurance Program for Remedial Action (APRA). The APRA Bibliography Management System (BMS), a microcomputer-operated system designed to file, locate and retrieve project-specific bibliographic data, was developed to manage the documentation associated with APRA. The BMS uses APRABASE, a PNL-developed computer program written in dBASE II language, which is designed to operate using the commercially available dBASE II database software. This document describes the APRABASE computer program, its associated subprograms, and the dBASE II APRA file. A User's Manual is also provided in the document. Although the BMS was designed to manage APRA-associated documents, it could be easily adapted for use in handling bibliographic data associated with any project.

  13. [Standardization in laboratory hematology by participating in external quality assurance programs].

    Science.gov (United States)

    Nazor, Aida; Siftar, Zoran; Flegar-Mestrić, Zlata

    2011-09-01

    Since 1985, Department of Clinical Chemistry and Laboratory Medicine, Merkur University Hospital, Zagreb, has been participating in the International External Quality Assessment Scheme for Hematology (IEQAS-H) organized by the World Health Organization (WHO). Owing to very good results, in 1987 the Department received a certificate of participation in this control scheme. Department has been cooperating in the external quality assessment program in laboratory hematology which has been continuously performed in Croatia since 1986 by the Committee for External Quality Assessment Schemes under the auspices of the Croatian Society of Medical Biochemists and School of Pharmacy and Biochemistry, University of Zagreb. Nowadays, 186 medical biochemical laboratories are included in the National External Quality Assessment program, which is performed three times per year. Our Department has participated in the international projects of the European Committee for External Quality Assurance Programs in Laboratory Medicine (EQALM).

  14. U.S. Department of Energy, Carlsbad Area Office quality assurance program document. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    Mission of the Carlsbad Area Office (CAO) is to protect human health and the environment by opening and operating the Waste Isolation Pilot Plant (WIPP) for safe disposal of TRU waste, and establishing an effective system for management of TRU waste from generation to disposal. To help in fulfilling this mission and to ensure that risks and environmental impacts are identified and minimized, and that safety, reliability, and performance are optimized, CAO`s policy is to establish and maintain an effective quality assurance (QA) program that supports compliance with applicable Federal, State, and local regulations, and DOE orders and requirements. This document establishes QA program requirements for all programs, projects, and activities sponsored by CAO.

  15. Energy Assurance Technical Training and Awareness Program/Energy Infrastructure Training and Analysis Center

    Energy Technology Data Exchange (ETDEWEB)

    Barbara McCabe

    2005-11-15

    This report covers the work completed during Year One (Year One has a 16 month project period) of a five- year Cooperative Agreement (DE-FC26-03NT41895) between the International Union of Operating Engineers (IUOE) National Hazmat Program (OENHP) and the U. S. Department of Energy (DOE) National Energy Technology Laboratory (NETL). This final technical report is being submitted, as required by the Cooperative Agreement, within 90 (calendar) days after the project period ends (December 31, 2004). The resources allocated to Year One of the Cooperative Agreement were adequate for the completion of the required deliverables. All deliverables have been completed and sent to AAD Document Control as directed in the cooperative agreement. The allocation for Year One required 20-25 trainers to be trained in each of five Train-the-Trainer courses and a total of 6,000 workers trained throughout the country. Through cost savings employed for the scheduling and conduct of Train-the-Trainer, instructor refreshers, and direct training classes, 3171 workers have been trained to date. This total incorporates 159 trainers and members from management, local, county, state and federal organizations identified in the Strategic Plan. The largest percentage of personnel trained is heavy equipment operators, and building engineers, which is the largest targeted population identified under this cooperative agreement. The OENHP, using existing curriculum as appropriate, has modified and developed new training modules that have been used to establish four different levels of training courses. The four courses are: (1) EA 500 Energy Assurance Train-the-Trainer, (2) EA 400 Energy Assurance Instructor Refresher, (3) EA 300 Energy Assurance, and (4) EA 100 Energy Assurance Awareness. Training modules cover topics, such as, but not limited to, facility vulnerability and vulnerability assessment, physical security- heating, ventilation, air conditioning, terrorism awareness, weapons of mass

  16. Quality assurance and risk management: a survey of dental schools and recommendations for integrated program management.

    Science.gov (United States)

    Fredekind, Richard E; Cuny, Eve J; Nadershahi, Nader A

    2002-04-01

    Quality assurance (QA) and risk management (RM) programs are intended to improve patient care, meet accreditation standards, and ensure compliance with liability insurance policies. The purpose of this project was to obtain and disseminate information on whether dental schools integrate QA and RM and what mechanisms have been most effective in measuring accomplishments in these programs. All sixty-five U.S. and Canadian dental schools were sent a twenty-nine-item survey, and forty-six (71 percent) schools responded. The main findings are as follows: 66 percent had a written QA program combined with a QA committee; 95 percent received administrative support; there was wide variation in the makeup of the QA committee; many institutions reported significant changes resulting from the QA program; and over half of the respondents merged QA and RM in some fashion. To develop or maintain an effective QA/RM program, the authors propose the following: obtain active support from the dean; develop goals and mission/vision statements; include trained personnel on the committee; establish wide levels of involvement in the QA program; develop QA measurements to ensure compliance with institutionally developed standards of patient care; and establish continuous cycles of improvement.

  17. Nutrition Program Quality Assurance through a Formalized Process of On-Site Program Review

    Science.gov (United States)

    Paddock, Joan Doyle; Dollahite, Jamie

    2012-01-01

    A protocol for a systematic onsite review of the Expanded Food and Nutrition Education Program and Supplemental Nutrition Assistance Program-Education was developed to support quality programming and ensure compliance with state guidelines and federal regulations. Onsite review of local nutrition program operations is one strategy to meet this…

  18. Development and Implementation of a Comprehensive Quality Assurance Program at a Community Endoscopy Facility

    Directory of Open Access Journals (Sweden)

    Robert J Hilsden

    2011-01-01

    Full Text Available Quality assurance (QA is a process that includes the systematic evaluation of a service, institution of improvements and ongoing evaluation to ensure that effective changes were made. QA is a fundamental component of any organized colorectal cancer screening program. However, it should play an equally important role in opportunistic screening. Establishing the processes and procedures for a comprehensive QA program can be a daunting proposition for an endoscopy unit. The present article describes the steps taken to establish a QA program at the Forzani & MacPhail Colon Cancer Screening Centre (Calgary, Alberta – a colorectal cancer screening centre and nonhospital endoscopy unit that is dedicated to providing colorectal cancer screening-related colonoscopies. Lessons drawn from the authors’ experience may help others develop their own initiatives. The Global Rating Scale, a quality assessment and improvement tool developed for the gastrointestinal endoscopy services of the United Kingdom’s National Health Service, was used as the framework to develop the QA program. QA activities include monitoring the patient experience through surveys, creating endoscopist report cards on colonoscopy performance, tracking and evaluating adverse events and monitoring wait times.

  19. Quality assurance

    Energy Technology Data Exchange (ETDEWEB)

    Gillespie, B.M.; Gleckler, B.P.

    1995-06-01

    This section of the 1994 Hanford Site Environmental Report summarizes the quality assurance and quality control practices of Hanford Site environmental monitoring and surveillance programs. Samples are analyzed according to documented standard analytical procedures. This section discusses specific measures taken to ensure quality in project management, sample collection, and analytical results.

  20. Using RUFDATA to guide a logic model for a quality assurance process in an undergraduate university program.

    Science.gov (United States)

    Sherman, Paul David

    2016-04-01

    This article presents a framework to identify key mechanisms for developing a logic model blueprint that can be used for an impending comprehensive evaluation of an undergraduate degree program in a Canadian university. The evaluation is a requirement of a comprehensive quality assurance process mandated by the university. A modified RUFDATA (Saunders, 2000) evaluation model is applied as an initiating framework to assist in decision making to provide a guide for conceptualizing a logic model for the quality assurance process. This article will show how an educational evaluation is strengthened by employing a RUFDATA reflective process in exploring key elements of the evaluation process, and then translating this information into a logic model format that could serve to offer a more focussed pathway for the quality assurance activities. Using preliminary program evaluation data from two key stakeholders of the undergraduate program as well as an audit of the curriculum's course syllabi, a case is made for, (1) the importance of inclusivity of key stakeholders participation in the design of the evaluation process to enrich the authenticity and accuracy of program participants' feedback, and (2) the diversification of data collection methods to ensure that stakeholders' narrative feedback is given ample exposure. It is suggested that the modified RUFDATA/logic model framework be applied to all academic programs at the university undergoing the quality assurance process at the same time so that economies of scale may be realized.

  1. Integration of Academic and Vocational Programs in Illinois Community Colleges. The Status of Integration Activities Funded through the Quality Assurance Program.

    Science.gov (United States)

    Illinois Univ., Urbana. Dept. of Vocational and Technical Education.

    Quality Assurance Program (QAP) integration activities were studied at eight Illinois community and junior colleges. Data collection involved telephone interviews with career deans at the colleges, 11 follow-up site observations, and attendance at a regional vocational education system directors meeting. When classroom observations occurred,…

  2. Emerging technologies and quality assurance in hemostasis: a review of findings from the Royal College of Pathologists of Australasia Quality Assurance Program.

    Science.gov (United States)

    Favaloro, Emmanuel J; Bonar, Roslyn

    2007-04-01

    Regular multilaboratory surveys of laboratories by the Royal College of Pathologists of Australasia Quality Assurance Program (QAP) have been conducted to assess proficiency in tests of hemostasis for the last 40 years. This article focuses primarily on specialized assays of hemostasis, for which surveys have been conducted for some 10 years. For von Willebrand disease (vWD) evaluations, a total of 47 plasma samples have been dispatched to survey participants, including representative samples from normal individuals plus all of the major vWD subtypes (i.e., types 1, 2A, 2B, 2M, 2N, and 3). These surveys have focused partly on the issue of diagnostic interpretive error rates associated with different assays and test panels. In this context, considerable improvement is seen when laboratories incorporate the vWF:collagen-binding assay into the test panel. Thrombophilia-associated tests assessed by the program and discussed in this review include activated protein c resistance, lupus anticoagulant, and deficiencies of protein C, protein S, and antithrombin. Other tests briefly reviewed here include factor assays and inhibitors, D-dimer, and heparin/anti-Xa assays. Anticardiolipin antibody and anti-beta(2)-glycoprotein I antibody (aB(2)GPI) testing, assessed by the Immunology QAP, is also reviewed briefly, as are genetic tests associated with thrombophilic markers such as factor V Leiden and the prothrombin gene.

  3. Quality assurance manual for the environmental survey and site assessment program, Oak Ridge Institute for Science and Education

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-03-21

    The purpose of this manual is to provide Program policy and oversight for the maintenance of Quality Assurance (QA) and Quality Control (QC) within the Environmental Survey and Site Assessment Program (ESSAP) of Oak Ridge Institute for Science and Education. This manual describes administrative systems, as well as specific quality control procedures, which apply to all functional groups in ESSAP. The sites surveyed under this program are primarily those where residual contamination from previous operations may pose a potential risk to the environment or to the health and safety of those in the immediate vicinity. Other major activities include environmental assessments, training related to decommissioning survey activities, effluent sampling and monitoring, special laboratory analyses, program appraisals and document reviews, consulting on environment-related topics, and technical assistance for guideline development. The methodology for performance of particular field and laboratory activities is presented in the ESSAP Survey Procedures Manual and the Laboratory Procedures Manual.

  4. Use of alumni and employer surveys for internal quality assurance of the DVM program at the University of Montreal.

    Science.gov (United States)

    Doucet, Michèle Y; Vrins, André

    2010-01-01

    Annual alumni and employer surveys, initially designed as outcomes assessment tools, were integrated into a new internal quality assurance strategy to improve the doctor of veterinary medicine program at the University of Montreal's Faculté de Médecine Vétérinaire. Data collected annually from the classes of 2004-2007 indicated that alumni and their employers were generally satisfied with their level of preparation after one year of professional activity. Specific weaknesses were found in non-technical skills such as communication and resource management. These data were used in support of other forms of feedback to guide curricular reform.

  5. Evaluation of Government Quality Assurance Oversight for DoD Acquisition Programs

    Science.gov (United States)

    2014-11-03

    basic concepts and definitions for quality management systems, ISO 9001 :2008 identifies requirements for quality management systems, and ISO 9004...source, The AS9100, “Quality Management Systems – Requirements for Aviation, Space, and Defense Organizations,” is based on ISO 9001 requirements...Defense Acquisition System and the Joint Capability,” briefly described the requirement for quality assurance and referenced ISO 9001 , “Quality

  6. External quality-assurance results for the National Atmospheric Deposition Program/National Trends Network, 2002-03

    Science.gov (United States)

    Wetherbee, Gregory A.; Latysh, Natalie E.; Burke, Kevin P.

    2005-01-01

    Six external quality-assurance programs were operated by the U.S. Geological Survey (USGS) External Quality-Assurance (QA) Project for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN) from 2002 through 2003. Each program measured specific components of the overall error inherent in NADP/NTN wet-deposition measurements. The intersite-comparison program assessed the variability and bias of pH and specific conductance determinations made by NADP/NTN site operators twice per year with respect to accuracy goals. The percentage of site operators that met the pH accuracy goals decreased from 92.0 percent in spring 2002 to 86.3 percent in spring 2003. In these same four intersite-comparison studies, the percentage of site operators that met the accuracy goals for specific conductance ranged from 94.4 to 97.5 percent. The blind-audit program and the sample-handling evaluation (SHE) program evaluated the effects of routine sample handling, processing, and shipping on the chemistry of weekly NADP/NTN samples. The blind-audit program data indicated that the variability introduced by sample handling might be environmentally significant to data users for sodium, potassium, chloride, and hydrogen ion concentrations during 2002. In 2003, the blind-audit program was modified and replaced by the SHE program. The SHE program was designed to control the effects of laboratory-analysis variability. The 2003 SHE data had less overall variability than the 2002 blind-audit data. The SHE data indicated that sample handling buffers the pH of the precipitation samples and, in turn, results in slightly lower conductivity. Otherwise, the SHE data provided error estimates that were not environmentally significant to data users. The field-audit program was designed to evaluate the effects of onsite exposure, sample handling, and shipping on the chemistry of NADP/NTN precipitation samples. Field-audit results indicated that exposure of NADP/NTN wet-deposition samples

  7. 10 CFR 71.37 - Quality assurance.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance. 71.37 Section 71.37 Energy NUCLEAR... Package Approval § 71.37 Quality assurance. (a) The applicant shall describe the quality assurance program... quality assurance program that are applicable to the particular package design under...

  8. 40 CFR 51.363 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 2 2010-07-01 2010-07-01 false Quality assurance. 51.363 Section 51... Requirements § 51.363 Quality assurance. An ongoing quality assurance program shall be implemented to discover... impede program performance. The quality assurance and quality control procedures shall be...

  9. Hanford Waste Vitrification Plant Quality Assurance Program description for high-level waste form development and qualification. Revision 3, Part 2

    Energy Technology Data Exchange (ETDEWEB)

    1993-08-01

    The Hanford Waste Vitrification Plant Project has been established to convert the high-level radioactive waste associated with nuclear defense production at the Hanford Site into a waste form suitable for disposal in a deep geologic repository. The Hanford Waste Vitrification Plant will mix processed radioactive waste with borosilicate material, then heat the mixture to its melting point (vitrification) to forin a glass-like substance that traps the radionuclides in the glass matrix upon cooling. The Hanford Waste Vitrification Plant Quality Assurance Program has been established to support the mission of the Hanford Waste Vitrification Plant. This Quality Assurance Program Description has been written to document the Hanford Waste Vitrification Plant Quality Assurance Program.

  10. The development of a quality assurance project plan for the USEPA dioxin exposure initiative program

    Energy Technology Data Exchange (ETDEWEB)

    Byrne, C.; Ferrario, J. [Stennis Space Center, MS (USA). USEPA Environmental Chemistry Laboratory

    2004-09-15

    All projects planned and implemented under the United States Environmental Protection Agency (USEPA) Dioxin Exposure Initiative are required to have completed Quality Assurance Projects Plans (QAPPs). EPA Order 5360.1 A2 states, ''All work funded by the United States Environmental Protection Agency (EPA) that involves the acquisition of environmental data generated from direct measurement activities, collected from other sources, or compiled from computerized data bases and information systems are implemented in accordance with an approved QA Project Plan except under circumstances requiring immediate actions to protect human health and the environment or operations conducted under police powers''. This policy is based on the newly revised national consensus standard, ANSI/ASQC E-4-2004. These QAPPs have proven invaluable in the development and improvement of analytical methodology for dioxin-like compounds over the intervening years and in the verification and validation of the results of dioxin exposure studies.

  11. Effect of certified reference material 470 (CRM 470) on national quality assurance programs for serum proteins in Europe.

    Science.gov (United States)

    Johnson, A M; Whicher, J T

    2001-11-01

    The introduction of the international reference material for serum proteins, CRM 470, has resulted in significant reduction of the among-laboratory variance for most proteins assayed in European national quality assurance programs. In general, the CVs have decreased by 5 to 65%. However, both among- and within-manufacturer variances in many cases remain unacceptably high. In addition, concentration-dependent differences in variance and bias are present for some proteins. Although some variance will persist, reducing variance and bias to levels required for the institution of universal reference ranges will necessitate more accurate transfer of values to calibrants and controls and improved calibration curve fitting by manufacturers, as well as better quality control within laboratories.

  12. Educators' Curriculum Guide. Quality Assurance and Animal Care: Youth Education Program.

    Science.gov (United States)

    Busboom, Jan R.; Newman, Jerry A.; Shulaw, William P.; Jeffreys, J. Bradford

    This curriculum guide contains a six-unit, two-level program combining animal science and veterinary care for youth club leaders and members in grades three through twelve. The Facilitator and Educator/Leader Introductions describe the program, the goals, and the students who will participate. The six lesson plans contain what the lesson is about,…

  13. 77 FR 14955 - DoD Information Assurance Scholarship Program (IASP)

    Science.gov (United States)

    2012-03-14

    ...) Provides an educational program that awards bachelor's degrees, or provides no less than a 2-year program... administration, data management, digital and multimedia forensics, electrical engineering, electronics... institutions may apply for full scholarships to complete a bachelor's, master's, or a doctoral degree,...

  14. Assurance Cases

    Science.gov (United States)

    2015-01-26

    2015 Carnegie Mellon University Assurance Cases Software Engineering Institute Carnegie Mellon University Pittsburgh, PA 15213 Charles B...1. REPORT DATE 26 JAN 2015 2. REPORT TYPE N/A 3. DATES COVERED 4. TITLE AND SUBTITLE Assurance Cases 5a. CONTRACT NUMBER 5b. GRANT NUMBER... Assurance Cases Charles B. Weinstock, January 2015 © 2015 Carnegie Mellon University Copyright 2015 Carnegie Mellon University This material is based upon

  15. Loch Vale Watershed Long-Term Ecological Research and Monitoring Program: Quality Assurance Report, 2003-09

    Science.gov (United States)

    Richer, Eric E.; Baron, Jill S.

    2011-01-01

    The Loch Vale watershed project is a long-term research and monitoring program located in Rocky Mountain National Park that addresses watershed-scale ecosystem processes, particularly as they respond to atmospheric deposition and climate variability. Measurements of precipitation depth, precipitation chemistry, discharge, and surface-water quality are made within the watershed and elsewhere in Rocky Mountain National Park. As data collected for the program are used by resource managers, scientists, policy makers, and students, it is important that all data collected in Loch Vale watershed meet high standards of quality. In this report, data quality was evaluated for precipitation, discharge, and surface-water chemistry measurements collected during 2003-09. Equipment upgrades were made at the Loch Vale National Atmospheric Deposition Program monitoring site to improve precipitation measurements and evaluate variability in precipitation depth and chemistry. Additional solar panels and batteries have been installed to improve the power supply, and data completeness, at the NADP site. As a result of equipment malfunction, discharge data for the Loch Outlet were estimated from October 18, 2005, to August 17, 2006. Quality-assurance results indicate that more than 98 percent of all surface-water chemistry measurements were accurate and precise. Records that did not meet quality criteria were removed from the database. Measurements of precipitation depth, precipitation chemistry, discharge, and surface-water quality were all sufficiently complete and consistent to support project data needs.

  16. 78 FR 12157 - RFS Renewable Identification Number (RIN) Quality Assurance Program

    Science.gov (United States)

    2013-02-21

    ... fuel. This RIN-based approach to the development and implementation of the RFS program was developed in.../compliance/resources/policies/civil/erp/erp-invalidrins.pdf . Obligated parties are required to...

  17. Zirconium pressure tube testing: Test procedures, Production Assurance Program (Project H-700)

    Energy Technology Data Exchange (ETDEWEB)

    Zaloudek, F.R.; Lewis, M. [Pacific Northwest Lab., Richland, WA (United States)

    1986-06-01

    UNC Nuclear Industries (UNC) has initiated a plan for the fabrication of zirconium alloy pressure tubes required for the future operation of N-Reactor. As part of this plan, UNC is establishing a program to qualify and develop a process capable of fabricating these pressure tubes to the requirements of UNC specification HWS 6502, REV. 4, Amendment 1. The objective of the Pressure Tube Testing Task is to support the UNC program-by performing physical, mechanical and chemical testing on prototype tube sections produced during FY-1986, 1987 and 1988 and to test samples from production runs after 1988 as may be required. The types of tests included in the Zirconium Pressure Tube Testing Program will be as follows: tensile tests; burst tests; fracture toughness tests; corrosion tests; chemical composition analyses; grain structure evaluations. The purpose of this document is to define the procedures that will be used in each type of test included in this task.

  18. TU-G-BRD-02: Automated Systematic Quality Assurance Program for Radiation Oncology Information System Upgrades

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, B; Yi, B; Eley, J; Mutaf, Y; Rahman, S; D’Souza, W [University of Maryland School of Medicine, Baltimore, MD (United States)

    2015-06-15

    Purpose: To: (1) describe an independent, automated, systematic software-based protocol for verifying clinical data accuracy/integrity for mitigation of data corruption/loss risks following radiation oncology information system (ROIS) upgrades; and (2) report on application of this approach in an academic/community practice environment. Methods: We propose a robust approach to perform quality assurance on the ROIS after an upgrade, targeting four data sources: (1) ROIS relational database; (2) ROIS DICOM interface; (3) ROIS treatment machine data configuration; and (4) ROIS-generated clinical reports. We investigated the database schema for differences between pre-/post-upgrade states. Paired DICOM data streams for the same object (such as RT-Plan/Treatment Record) were compared between pre-/post-upgrade states for data corruption. We examined machine configuration and related commissioning data files for changes and corruption. ROIS-generated treatment appointment and treatment parameter reports were compared to ensure patient encounter and treatment plan accuracy. This protocol was supplemented by an end-to-end clinical workflow test to verify essential ROI functionality and integrity of components interfaced during patient care chain of activities. We describe the implementation of this protocol during a Varian ARIA system upgrade at our clinic. Results: We verified 1,638 data tables with 2.4 billion data records. For 222 under-treatment patients, 605 DICOM RT plans and 13,480 DICOM treatment records retrieved from the ROIS DICOM interface were compared, with no differences in fractions, doses delivered, or treatment parameters. We identified 82 new data tables and 78 amended/deleted tables consistent with the upgrade. Reports for 5,073 patient encounters over a 2-week horizon were compared and were identical to those before the upgrade. Content in 12,237 xml machine files was compared, with no differences identified. Conclusion: An independent QA

  19. Using Continuous Improvement in Online Program Design: DMAIC as a Tool for Assurance of Learning Assessments

    Science.gov (United States)

    Carnovale, Steven; Allen, Cliff; Pullman, Madeleine; Wong, Daniel

    2016-01-01

    The integration of technology into education has forced radical innovations to traditional instructional delivery models. Given its prevalence, a thorough understanding of pedagogical best practices associated with the design and implementation of such programs is critical. Furthermore, the need for an institutional commitment to assessment and a…

  20. The NASA Electronic Parts and Packaging (NEPP) Program: Overview and the New Tenets for Cost Conscious Mission Assurance on Electrical, Electronic, and Electromechanical (EEE) Parts

    Science.gov (United States)

    LaBel, Kenneth A.; Sampson, Michael J.

    2015-01-01

    The NEPP Program focuses on the reliability aspects of electronic devices (integrated circuits such as a processor in a computer). There are three principal aspects of this reliability: 1) Lifetime, inherent failure and design issues related to the EEE parts technology and packaging; 2) Effects of space radiation and the space environment on these technologies, and; 3) Creation and maintenance of the assurance support infrastructure required for mission success. The NEPP mission is to provide guidance to NASA for the selection and application of microelectronics technologies, to improve understanding of the risks related to the use of these technologies in the space environment, and to ensure that appropriate EEE parts research is performed to meet NASA mission assurance needs. NEPPs FY15 goals are to represent the NASA voice to the greater aerospace EEE parts community including supporting anti-counterfeit and trust, provide relevant guidance to cost-effective missions, aid insertion of advanced (and commercial) technologies, resolve unexpected parts issues, ensure access to appropriate radiation test facilities, and collaborate as widely as possible with external entities. In accordance with the changing mission profiles throughout NASA, the NEPP Program has developed a balanced portfolio of efforts to provide agency-wide assurance for not only traditional spacecraft developments, but also those in-line with the new philosophies emerging worldwide. In this presentation, we shall present an overview of this program and considerations for EEE parts assurance as applied to cost conscious missions.

  1. Norwegian program of quality assurance in radiotherapy (KVIST) - Organisation, benefits and experience feedback;Programme norvegien d'assurance qualite dans la radiotherapie (KVIST) - Organisation, benefices et retour d'experience

    Energy Technology Data Exchange (ETDEWEB)

    Merete Olerud, H. [Oslo Univ., Autorite Norvegienne de Radioprotection, Osteras, Institut de Physique et Biophysique (Norway); Levernes, S. [Oslo Univ., Centre Hospitalier, Autorite Norvegienne de Radioprotection, Osteras - DNR, Montebello (Norway); Hellebust, T.P. [Autorite Norvegienne de Radioprotection, Osteras, Centre Hospitalier, DNR, Montebello (Norway); Heikkela, I.E. [Autorite Norvegienne de Radioprotection, Osteras D.C., Johannessen, Centre Hospitalier Universitaire - Ulleval, Oslo (Norway); Bjerke, H. [Autorite Norvegienne de Radioprotection, Osteras, Rekstad BL, Centre Hospitalier Universitaire - Ulleval, Oslo (Norway); Sundqvist, E. [Programme Radiographie, Faculte de la Sante, Oslo, College Universitaire, Oslo (Norway); Frykholm, G. [Oslo Univ., Centre Hospitalier Universitaire, Autorite Norvegienne de Radioprotection, Osteras, St.Olav, Trondheim (Norway)

    2009-12-15

    In 2000, the Norwegian Radiation Protection Authority (N.R.P.A.) initiated work to develop a national quality assurance programme in radiotherapy. The program was named K.V.I.S.T.: i.e. Norwegian abbreviation of Quality Assurance in Radiotherapy (KValitetSikring STraleterapi). The programme is performed by the multidisciplinary K.V.I.S.T. Group and aims to stimulate collaboration by focussing on clinical, technical and administrative problems that can be addressed and solved on a national level. An important objective is to establish a positive attitude towards quality assurance and better communication between centres and the various professions and professionals involved in radiotherapy, i.e. the oncologists, medical physicists and radiation therapy technologists. Information is also provided to other stake holders such as health authorities, hospital administrators and patients. In 2007 radiotherapy in Norway represent 10 departments and forty accelerators. Since radiotherapy is given high priority in cancer care good quality assurance is required. The member of the K.V.I.S.T.-group are part time at N.R.P.A. and part time in different radiotherapy departments. Professionals with competencies within radiotherapy (R.T.) have permanent positions in a national public entity. The K.V.I.S.T.-group is multidisciplinary. The K.V.I.S.T.-group acts as a coordinating group for all type of national Q.A. projects. The recommendations/guidelines are developed by national consensus. The work is performed by the radiotherapy community it self, thus creating an atmosphere of ownership. (N.C.)

  2. Quality assurance program in diagnostic radiology; Programa de garantia de qualidade em radiologia diagnostica

    Energy Technology Data Exchange (ETDEWEB)

    Yacovenco, Alejandro; Borges, J.C. [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia; Lira, S.H. [Hospital Central da Policia Militar, Rio de Janeiro, RJ (Brazil). Servico de Radiologia; Mota, H.C. [Instituto de Radioprotecao e Dosimetria (IRD), Rio de Janeiro, RJ (Brazil)

    1994-07-01

    Aiming to elaborate a methodology to optimize the performance of the Radiology Service of the Military Police Hospital, in Rio dee Janeiro, some goals were established: improvement of the attendance to patients; improvement of the qualification of technicians; achievement and maintenance of high degrees of quality in each step of the radiological process; improvement of the image quality; optimization of dose per examination and cost reduction. The procedure used to detect faults in the radiological process was the analysis of causes of film losses. Results show a 70% reduction in the film rejection rate. 74% of total identified faults were due to equipment, 11% to films, 10% to patients and 5% to developing. The reduction in the cost of developed film reached 75%. A training course given to the staff of the radiological service fully reached its goals, contributing, with the staff motivation, mostly to the success of the program. This success indicates that, with a serious persistent work, it is possible to offer to patients services within their expectations, even at a public hospital. Such programs should be supported by health authorities, not only due to their technical and economic needs but, mostly, due to their social implications. (author). 10 refs., 11 figs.

  3. Developing cross-sectoral quality assurance for cataract surgery in the statutory quality assurance program of the German health care system: Experiences and lessons learned.

    Science.gov (United States)

    Bramesfeld, Anke; Pauletzki, Jürgen; Behrenz, Lars; Szecsenyi, Joachim; Willms, Gerald; Broge, Björn

    2015-08-01

    Since 2001, statutory external quality assurance (QA) for hospital care has been in place in the German health system. In 2009, the decision was taken to expand it to cross-sectoral procedures. This novel and unprecedented form of national QA aims at (1) making the quality procedures comparable that are provided both in inpatient and outpatient care, (2) following-up outcomes of hospital care after patients' discharge and (3) measuring the quality of complex treatment chains across interfaces. As a pioneer procedure a QA procedure in cataract surgery QA was developed. Using this as an example, challenges of cross-sectoral QA are highlighted. These challenges relate, in particular, to three technical problems: triggering cases for documentation, following-up patients' after hospital discharge, and the burden of documentation in outpatient care. These problems resulted finally in the haltering of the development of the QA procedure. However, the experiences gained with this first development of cross-sectoral QA inspired the reorientation and further development of the field in Germany. Future cross-sectoral QA will rigorously aim at keeping burden of documentation small. It will draw data for QA mainly at three sources: routine data, patient surveys and peer reviews using indicators. Policy implications of this reorientation are discussed.

  4. Frequent major errors in antimicrobial susceptibility testing of bacterial strains distributed under the Deutsches Krebsforschungszentrum Quality Assurance Program.

    Science.gov (United States)

    Boot, R

    2012-07-01

    The Quality Assurance Program (QAP) of the Deutsches Krebsforschungszentrum (DKFZ) was a proficiency testing system developed to service the laboratory animal discipline. The QAP comprised the distribution of bacterial strains from various species of animals for identification to species level and antibiotic susceptibility testing (AST). Identification capabilities were below acceptable standards. This study evaluated AST results using the DKFZ compilations of test results for all bacterial strains showing the number of participants reporting the strain as resistant (R), sensitive (S) or intermediate susceptible (I) to each antibiotic substance used. Due to lack of information about methods used, it was assumed that what the majority of the participants reported (R or S) was the correct test result and that an opposite result was a major error (ME). MEs occurred in 1375 of 14,258 (9.7%) of test results and ME% ranged from 0% to 23.2% per bacterial group-agent group combination. Considerable variation in MEs was found within groups of bacteria and within groups of agents. In addition to poor performance in proper species classification, the quality of AST in laboratory animal diagnostic laboratories seems far below standards considered acceptable in human diagnostic microbiology.

  5. Design and implementation of a quality assurance program for gamma cameras; Diseno e implementacion de un programa de aseguramiento de calidad para camaras gamma

    Energy Technology Data Exchange (ETDEWEB)

    Montoya M, A.; Rodriguez L, A. [Instituto Nacional de Cancerologia, Departamento de Medicina Nuclear, Av. San Fernando No. 22, Col. Seccion XVI, 14080 Mexico D. F. (Mexico); Trujillo Z, F. E., E-mail: montoya-moreno@hotmail.co [Hospital Regional de Alta Especialidad de Oaxaca, Area de Fisica Medica, Aldama s/n, Paraje El Tule, 71256 San Bartolo Coyotepec, Oaxaca (Mexico)

    2010-09-15

    In nuclear medicine more than 90% of the carried out procedures are diagnostic. To assure an appropriate diagnostic quality of the images and the doses optimization received by the patients originated in the radioactive material, it is indispensable the periodic surveillance of the operation and performance of the equipment s by means of quality assurance tests. This work presents a proposal of a quality assurance program for gamma cameras based on recommendations of the IAEA, the American Association of Medical Physics and the National Electrical Manufacturers Association. Some tests of the program were applied to an e.cam gamma camera (Siemens) of the Nuclear Medicine Department of the National Institute of Cancer. The intrinsic and extrinsic uniformity, the intrinsic spatial resolution and the extrinsic sensibility were verified. For intrinsic uniformity the average daily values of the integral uniformity and differential uniformity in the useful vision field were 2.61% and 1.58% respectively, the average monthly values of intrinsic uniformity for the integral and differential uniformity in the useful vision field were 4.10% and 1.66% respectively. The used acceptance criterions were respectively of 3.74% and 2.74%. The average values of extrinsic uniformity for the useful vision field were of 7.65% (intrinsic uniformity) and 2.69% (extrinsic uniformity), in this case the acceptance criterion is a value of 6.00%. The average value of intrinsic spatial resolution went 4.67 mm superior to 4.4. mm that is the acceptance limit. Finally, maximum variations of 1.8% were observed (minors than 2% that is the acceptance criterion) for the extrinsic sensibility measured in different regions of the detector. Significant variations of extrinsic sensibility were not observed among the monthly lectures. Of the realized measurements was concluded that the system requires of a maintenance service by part of the manufacturer, which one carries out later on to this work. The

  6. Quality assurance program in the External dosimetry laboratory of the CPHR; Programa de aseguramiento de la calidad en el laboratorio de dosimetria externa del CPHR

    Energy Technology Data Exchange (ETDEWEB)

    Molina P, D.; Pernas S, R.; Martinez H, E.; Cardenas H, J. [Centro de Proteccion e Higiene de las Radiaciones, Calle 20 No. 4113 e/41 y 47. Playa, C.P. 11300, A.P. 6195, C.P. 10600 La Habana (Cuba)

    2006-07-01

    From 1999 the Laboratory of External Dosimetry of the Radiation Protection and Hygiene Center comes applying in its service of personal dosimetry a Program of Quality Assurance. This program was designed according to the recommendations of national and international organizations as the National Assuring Office of the Republic of Cuba (ONARC), the International Standards Organization (ISO), the International Electro technique Commission (IEC) and the International Atomic Energy Agency (IAEA). In this work it is presented in a summarized way the operation of this Program of Quality Assurance which includes the administration and conservation of the results and the documentation of the service, the controls that are carried out to the equipment, the acceptance tests that are applied to the equipment and new dosemeters, the shipment and prosecution of the dosemeters, the evaluation, storage and conservation of the doses, the report of the results, the traceability and reproducibility of the measurements, the attention to the reclamations and the clients complaints and the internal and external audits to those that it undergoes periodically the laboratory. (Author)

  7. Assuring reliability program effectiveness.

    Science.gov (United States)

    Ball, L. W.

    1973-01-01

    An attempt is made to provide simple identification and description of techniques that have proved to be most useful either in developing a new product or in improving reliability of an established product. The first reliability task is obtaining and organizing parts failure rate data. Other tasks are parts screening, tabulation of general failure rates, preventive maintenance, prediction of new product reliability, and statistical demonstration of achieved reliability. Five principal tasks for improving reliability involve the physics of failure research, derating of internal stresses, control of external stresses, functional redundancy, and failure effects control. A final task is the training and motivation of reliability specialist engineers.

  8. Just in Time Assurance

    Science.gov (United States)

    2010-04-01

    Just in Time Assurance Ji Al F PhD U i it f Id hm ves- oss, , n vers y o a o Director Center for Secure and Dependable Computing W. Mark Vanfleet...COVERED 00-00-2010 to 00-00-2010 4. TITLE AND SUBTITLE Just in Time Assurance 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6...discusses how practical and affordable recertification can become the norm instead of the rare exception 2 What Does Just in Time Mean? Manufacturing

  9. [Medical quality assurance today].

    Science.gov (United States)

    Schäfer, Robert D

    2008-01-01

    Both the quality and performance of health systems are strongly influenced by the number and the qualification of the professional staff. Quality assurance programs help to analyse causalities which are responsible for medical malpractice. On the basis of the experiences gained by the performance of established Quality Assurance Programs (QAP) in the North Rhine area since 1982 various aspects of the efficiency of these programs will be discussed. The implementation of legal regulations making these programs mandatory is criticised not only for its bureaucratic effect but also for the attempt to exclude professional experts from the interpretation of results. It is recommended to liberalize these regulations in order to facilitate improvement of methods and participation of the medical profession.

  10. Updated operational protocols for the U.S. Geological Survey Precipitation Chemistry Quality Assurance Project in support of the National Atmospheric Deposition Program

    Science.gov (United States)

    Wetherbee, Gregory A.; Martin, RoseAnn

    2017-02-06

    The U.S. Geological Survey Branch of Quality Systems operates the Precipitation Chemistry Quality Assurance Project (PCQA) for the National Atmospheric Deposition Program/National Trends Network (NADP/NTN) and National Atmospheric Deposition Program/Mercury Deposition Network (NADP/MDN). Since 1978, various programs have been implemented by the PCQA to estimate data variability and bias contributed by changing protocols, equipment, and sample submission schemes within NADP networks. These programs independently measure the field and laboratory components which contribute to the overall variability of NADP wet-deposition chemistry and precipitation depth measurements. The PCQA evaluates the quality of analyte-specific chemical analyses from the two, currently (2016) contracted NADP laboratories, Central Analytical Laboratory and Mercury Analytical Laboratory, by comparing laboratory performance among participating national and international laboratories. Sample contamination and stability are evaluated for NTN and MDN by using externally field-processed blank samples provided by the Branch of Quality Systems. A colocated sampler program evaluates the overall variability of NTN measurements and bias between dissimilar precipitation gages and sample collectors.This report documents historical PCQA operations and general procedures for each of the external quality-assurance programs from 2007 to 2016.

  11. SU-C-BRD-01: Multi-Centre Collaborative Quality Assurance Program for IMRT Planning and Delivery: Year 3 Results

    Energy Technology Data Exchange (ETDEWEB)

    McNiven, A; Jaffray, D; Letourneau, D [Princess Margaret Cancer Centre and Department of Radiation Oncology, University of Toronto, Toronto, ON (Canada)

    2015-06-15

    Purpose: A multi-centre quality assurance program was developed to enable quality improvement by coupling measurement of intensity modulated radiotherapy (IMRT) planning and delivery performance for site-specific planning exercises with diagnostic testing. The third year of the program specifically assessed the quality of spine stereotactic body radiotherapy (SBRT) planning and delivery amongst the participating centres. Methods: A spine SBRT planning exercise (24 Gy in 2 fractions) was created and completed by participants prior to an on-site visit. The delivery portion of the on-site visit included spine SBRT plan delivery and diagnostic testing, which included portal image acquisition for quantification of phantom positioning error and multi-leaf collimator (MLC) calibration accuracy. The measured dose was compared to that calculated in the treatment planning system (TPS) using 3%/2mm composite analysis and 3%/3mm gamma analysis. Results: Fourteen institutions participated, creating 17 spine SBRT plans (15 VMAT and 2 IMRT). Three different TPS, two beam energies (6 MV and 6 MV FFF), and four MLC designs from two linac vendors were tested. Large variation in total monitor units (MU) per plan (2494–6462 MU) and dose-volume parameters was observed. The maximum point dose in the plans ranged from 116–149% and was dependent upon the TPS used. Pass rates for measured to planned dose comparison ranged from 89.4–100% and 97.3–100% for 3%/2mm and 3%/3mm criteria respectively. The largest measured MLC error did Result in one of the poorer pass rates. No direct correlation between phantom positioning error and pass rates overall. Conclusion: Significant differences were observed in the planning exercise for some plan and dose-volume parameters based on the TPS used. Standard evaluation criteria showed good agreement between planned and measured dose for all participants, however on an individual plan basis, diagnostic tests were able to identify contributing

  12. 42 CFR 422.210 - Assurances to CMS.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Assurances to CMS. 422.210 Section 422.210 Public...) MEDICARE PROGRAM MEDICARE ADVANTAGE PROGRAM Relationships With Providers § 422.210 Assurances to CMS. (a) Assurances to CMS. Each organization will provide assurance satisfactory to the Secretary that...

  13. 10 CFR 76.93 - Quality assurance.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance. 76.93 Section 76.93 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) CERTIFICATION OF GASEOUS DIFFUSION PLANTS Safety § 76.93 Quality assurance. The Corporation shall establish, maintain, and execute a quality assurance program satisfying each...

  14. 40 CFR 194.22 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Quality assurance. 194.22 Section 194... General Requirements § 194.22 Quality assurance. (a)(1) As soon as practicable after April 9, 1996, the Department shall adhere to a quality assurance program that implements the requirements of ASME...

  15. Solar consumer assurance network briefing book

    Energy Technology Data Exchange (ETDEWEB)

    Connor, Lynda

    1980-06-01

    Background information is provided on the rationale and purpose of the Solar Consumer Assurance Network (SOLCAN) program. Mechanisms being instituted by states to meet solar consumer assurance needs are identified. Mechanisms being developed with Federal government support to encourage solar consumer assurance activities are described. The operation of the FY 80 SOLCAN effort is described. (MHR)

  16. GLYCOHEMOGLOBIN - COMPARISON OF 12 ANALYTICAL METHODS, APPLIED TO LYOPHILIZED HEMOLYSATES BY 101 LABORATORIES IN AN EXTERNAL QUALITY ASSURANCE PROGRAM

    NARCIS (Netherlands)

    WEYKAMP, CW; PENDERS, TJ; MUSKIET, FAJ; VANDERSLIK, W

    1993-01-01

    Stable lyophilized ethylenediaminetetra-acetic acid (EDTA)-blood haemolysates were applied in an external quality assurance programme (SKZL, The Netherlands) for glycohaemoglobin assays in 101 laboratories using 12 methods. The mean intralaboratory day-to-day coefficient of variation (CV), calculate

  17. Development of a milk quality assurance program for paratuberculosis: from within- and between herd dynamics to economic decision analysis

    NARCIS (Netherlands)

    Roermund, van H.J.W.; Weber, M.F.; Koeijer, de A.A.; Velthuis, A.G.J.; Jong, de M.C.M.

    2005-01-01

    A bulk milk quality assurance programme for Mycobacterium avium subsp. paratuberculosis (Map) in dairy herds was simulated. Herds were certified as 'low-Map bulk milk' if, with a certain probability, the concentration of Map in bulk milk did not exceed a maximum acceptable concentration (MAC). The M

  18. Assurance of Learning in an MBA Program: Exploration of the Value Added by the Graduate Major Field Test in Business

    Science.gov (United States)

    Kass, Darrin; Grandzol, Christian

    2014-01-01

    The use of standardized tests as a piece of outcomes assessment has risen in recent years in order to satisfy external accrediting bodies such as the Association to Advance Collegiate Schools of Business International. The authors explore the value added by the Graduate Major Field Test in Business (GMFT-B) for assurance of learning in a master of…

  19. Quality Assurance for Consumers of Private Training Programs. Findings and Recommendations from the Consultation on the Regulation and Support of Training Providers in New Brunswick = Assurance de la qualite pour les consommateurs de programmes de formation du secteur prive. Resultats et recommandations a la suite des consultations relativement a la reglementation et au soutien des fournisseurs de cours de formation au Nouveau-Brunswick.

    Science.gov (United States)

    New Brunswick Labour Force Development Board, Fredericton.

    Eighteen key individuals from the business, labor, and training sectors and other organizations concerned with the purchase of private training programs were consulted in an effort to determine the role of Canada's federal government and New Brunswick's provincial government in quality assurance for consumers of private training programs. There…

  20. QA (Quality Assurance) role in advanced energy activities: Towards an /open quotes/orthodox/close quotes/ Quality Program: Canonizing the traditions at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Bodnarczuk, M.W.

    1988-02-01

    After a brief description of the goal of Fermi National Accelerator Laboratory (Fermilab) this paper poses and answers three questions related to Quality Assurance (QA) at the Laboratory. First, what is the difference between 'orthodox' and 'unorthodox' QA and is there a place for 'orthodox' QA at a laboratory like Fermilab. Second, are the deeper philosophical and cultural frameworks of high-energy physics acommodating or antagonistic to an 'orthodox' QA Program. Finally, faced with the task of developing an institutional QA program for Fermilab where does one begin. The paper is based on experience with the on-going development and implementation of an institutional QA Program at Fermilab. 10 refs.

  1. Guidelines for the processing and quality assurance of benthic invertebrate samples collected as part of the National Water-Quality Assessment Program

    Science.gov (United States)

    Cuffney, T.F.; Gurtz, M.E.; Meador, M.R.

    1993-01-01

    Benthic invertebrate samples are collected as part of the U.S. Geological Survey's National Water-Quality Assessment Program. This is a perennial, multidisciplinary program that integrates biological, physical, and chemical indicators of water quality to evaluate status and trends and to develop an understanding of the factors controlling observed water quality. The Program examines water quality in 60 study units (coupled ground- and surface-water systems) that encompass most of the conterminous United States and parts of Alaska and Hawaii. Study-unit teams collect and process qualitative and semi-quantitative invertebrate samples according to standardized procedures. These samples are processed (elutriated and subsampled) in the field to produce as many as four sample components: large-rare, main-body, elutriate, and split. Each sample component is preserved in 10-percent formalin, and two components, large-rare and main-body, are sent to contract laboratories for further processing. The large-rare component is composed of large invertebrates that are removed from the sample matrix during field processing and placed in one or more containers. The main-body sample component consists of the remaining sample materials (sediment, detritus, and invertebrates) and is subsampled in the field to achieve a volume of 750 milliliters or less. The remaining two sample components, elutriate and split, are used for quality-assurance and quality-control purposes. Contract laboratories are used to identify and quantify invertebrates from the large-rare and main-body sample components according to the procedures and guidelines specified within this document. These guidelines allow the use of subsampling techniques to reduce the volume of sample material processed and to facilitate identifications. These processing procedures and techniques may be modified if the modifications provide equal or greater levels of accuracy and precision. The intent of sample processing is to

  2. An Application Example Analysis of Quality Assurance Program for STELLA(Sodium Integral Effect Test Loop for Safety Simulation and Assessment) Project

    Energy Technology Data Exchange (ETDEWEB)

    Jung, Minhwan; Gam, Dayoung; Eoh, Jae-Hyuk; Jeong, Ji-Young [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    KAERI has been conducting various basic R and D activities in the field of nuclear technology. In addition, KAERI is now participating in the Generation IV International Forum (GIF), preparing for the development of key technologies for Generation IV nuclear energy system, including Sodium cooled Fast Reactor (SFR) development. All of the key technologies for SFR development need an appropriate level of QA activities to achieve the GIF safety and performance objectives. Therefore, QA activities have been conducted as an essential part of the national SFR project. As a result, QAM (Quality Assurance Manual) and QAP (Quality Assurance Procedures) have been developed for the SFR project, which are based on ASME NQA-1, KEPIC QAP and the GIF Quality Management System Guidelines. In this work, the introduction background and application examples of the QA program for the STELLA project were investigated. Application of the QA for the STELLA project has great significance because the QA has been mainly applied for the nuclear power plant area in operation, which helps ensure the reliability of the test data and completeness of the research performance. Nevertheless, developing more appropriate QA procedures remains a major task because some parts of them are not applicable to the Na-experiment.

  3. Glucose stability in lyophilized chemistry quality control serum. A study of data from the quality assurance service (QAS) program of the College of American Pathologists.

    Science.gov (United States)

    Lawson, N S; Haven, G T; DiSilvio, T V; Gilmore, B F

    1982-10-01

    Data from 2.5 million glucose analyses on pools of lyophilized human quality control serum were used to evaluate analyte stability in the prereconstitution phase. Input information was from laboratories in Regional Quality Control Programs that use CAP Quality Assurance Service (QAS) data processing. Of 31 pools in use between 1977 and 1981, decreasing glucose concentration was detected by, at least, one method in 26 pools, and by two or more methods in 21 pools. Method-associated average decrease in concentration varied from 0.13 mg/dL/month (glucose oxidase-electrode) to 0.19 mg/dL/month (automated glucose oxidase-colorimetric). Bidirectional instability as a function of analytic method, i.e., increase with "mild" methods, decrease with "rigorous" methods that was noticed previously with pools analyzed between 1973 and 1977, was no longer seen. Dominant directional changes in the later pools were downward by all methods, when statistically significant trends were demonstrated.

  4. Software Assurance Using Structured Assurance Case Models.

    Science.gov (United States)

    Rhodes, Thomas; Boland, Frederick; Fong, Elizabeth; Kass, Michael

    2010-01-01

    Software assurance is an important part of the software development process to reduce risks and ensure that the software is dependable and trustworthy. Software defects and weaknesses can often lead to software errors and failures and to exploitation by malicious users. Testing, certification and accreditation have been traditionally used in the software assurance process to attempt to improve software trustworthiness. In this paper, we examine a methodology known as a structured assurance model, which has been widely used for assuring system safety, for its potential application to software assurance. We describe the structured assurance model and examine its application and use for software assurance. We identify strengths and weaknesses of this approach and suggest areas for further investigation and testing.

  5. GSFC Safety and Mission Assurance Organization

    Science.gov (United States)

    Kelly, Michael P.

    2010-01-01

    This viewgraph presentation reviews NASA Goddard Space Flight Center's approach to safety and mission assurance. The contents include: 1) NASA GSFC Background; 2) Safety and Mission Assurance Directorate; 3) The Role of SMA-D and the Technical Authority; 4) GSFC Mission assurance Requirements; 5) GSFC Systems Review Office (SRO); 6) GSFC Supply Chain Management Program; and 7) GSFC ISO9001/AS9100 Status Brief.

  6. Quality Assurance - Construction

    DEFF Research Database (Denmark)

    Gaarslev, Axel

    1996-01-01

    Gives contains three main chapters:1. Quality Assurance initiated by external demands2. Quality Assurance initiated by internal company goals3. Innovation strategies......Gives contains three main chapters:1. Quality Assurance initiated by external demands2. Quality Assurance initiated by internal company goals3. Innovation strategies...

  7. 7 CFR 90.102 - Quality assurance review.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) COMMODITY LABORATORY TESTING PROGRAMS INTRODUCTION Quality Assurance § 90.102 Quality assurance review. (a) Each laboratory performing tests...

  8. Implementation of a program of quality assurance of image in an imaging system of flat panel portal; Puesta en marcha de un programa de garantia de calidad de imagen en un sistema de imagen portal de panel plano

    Energy Technology Data Exchange (ETDEWEB)

    Gomez Barrado, A.; Sanchez Jimenez, E.; Benitez, J. A.; Sanchez-Reyes, A.

    2013-07-01

    (IGRT) image-guided radiation therapy is the one in which images are used to locate the area of treatment. Modern irradiation systems are equipped with different modalities for obtaining images, such as flat panel systems, systems conebeam, tomoimagen, etc. This paper describes the start-up and the experience of a quality assurance program based on a flat panel portal Imaging System. (Author)

  9. An analysis of current and former mathematics and science teacher education program participants' perceptions for quality assurance

    Science.gov (United States)

    Williams-Duncan, Omah Makebbe

    State curriculum and professional standards characterize the level of proficiency pre-service teachers must attain to be prepared to teach in Texas classrooms. Teacher education programs are being scrutinized for their ability to help pre-service teachers reach a level of proficiency commensurate with these state standards. This dissertation presents an understanding of a teacher education program's quality via analysis of its current student teacher and former student perceptions. There are two participant groups in this study - current student teachers (n=11) and former students (n=78) from one program called, aggieTEACH, a traditional baccalaureate secondary mathematics and science teacher education program. Of the current student teachers and former students participating in this study, 77.5% (n = 69) were female, 21.3% (n = 19) were male and 1.1% (n = 1) did not disclose their gender; additionally, 80.9% (n = 72) identify as white or Caucasian, 9% (n = 8) identify as Hispanic, 7.8% (n = 7) identifying as African American, Asian, or other, and 2.2% (n = 2) decided not to disclose their race. This mixed methods study reveals participant's agreement and confidence levels in mentoring, confidence, TEP quality, and program characteristics of aggieTEACH. The researcher used principal components analysis, exploratory factor analysis, and content analysis to review secondary data from administered web-based surveys. The surveys have Likert-scaled, single-response items and open-ended response items. Specific survey items were identified per categories called (a) mentoring, (b) confidence, (c) TEP quality, and (d) program characteristics. The mentoring scale yielded an alpha of .903. The confidence subscale yielded an alpha .951. The quality items yielded an alpha .881 and the characteristics items yielded an alpha of .919. Significant differences occurred between current student teacher and former student participants' agreement and confidence levels about the teacher

  10. Development of a postal dosimetric system for quality assurance programs in radiotherapy using fotons beams in non references conditions

    CERN Document Server

    Marin, A

    2003-01-01

    In radiotherapy, to cure the primary tumor, the absorbed dose delivered at the target volume should have an accuracy better than +- 5%. As the basic aim in radiotherapy is the eradication of the primary tumor with the smallest possible damage to the health tissues, it is necessary to guarantee that the dose delivered to the patient in different depths and treatment configurations has the right accuracy. For this reason, a quality control program should be carried out by regulatory and national standardization programs including postal evaluation of the beam dosimetry are also necessary. Since many years Brazil is running a postal quality control program in radiotherapy in reference conditions, Nevertheless it should be increased to include also measurements in non reference conditions. In this paper we present a new dosimetric postal system using thermoluminescent dosimeters (TLD-100 in powder) for photon beams quality control in radiotherapy, in non reference conditions. This system has been checked and appl...

  11. Quality assurance and quality control data validation procedures used for the Love Canal and Dallas lead soil monitoring programs.

    Science.gov (United States)

    Brown, K W; Black, S C

    1983-06-01

    Public awareness of soils contamination has increased in recent years due in part to the notoriety associated with the indiscriminate release, packaging, transporting and disposal of hazardous materials. In 1980, and again in 1982, the U.S. Environmental Protection Agency (EPA) was responsible for designing, implementing and conducting environmental monitoring programs at Love Canal in Niagara Falls, New York, and in Dallas, Texas, that dealt with suspected contaminated soils. Both of these monitoring programs were conducted over a relatively short time with the collection and analysis of over 4000 soil samples. The methods employed by the Environmental Protection Agency for providing soil data that was scientifically valid and of defensible quality for each of these monitoring programs are presented. Also, methods for identifying data bias, its precision and its uncertainty are identified.

  12. Application of principles of quality assurance recommended by ISO 9000 Standards to Regulatory Program; Aplicacion de los principios de garantia de calidad recomendados por las normas ISO 9000 a un programa regulador

    Energy Technology Data Exchange (ETDEWEB)

    Jova Sed, Luis Andres [Centro de Proteccion y Higiene de las Radiaciones, La Habana (Cuba); Bilbao Alfonso, Alejandro Victor [International Atomic Energy Agency, Vienna (Austria)

    2001-07-01

    For several years, the necessity of applying the programs of quality assurance to the radiation protection activities has been highlighted; however there has been little progress in this direction, even in the philosophical and methodological development of the topic. The objective of this work is to transmit some recommendations of how the Regulatory Authorities of developing countries can organize the quality assurance system of their own activity, following the main precepts of the international standard series ISO 9000. In very tight synthesis it describes the importance that has the definition of a policy of quality for a Regulatory Authority, the quality objectives, the definition of the responsibilities and attributions in relation with quality assurance, and others elements of the ISO 9000, and how to apply it. (author)

  13. Multinational Quality Assurance

    Science.gov (United States)

    Kinser, Kevin

    2011-01-01

    Multinational colleges and universities pose numerous challenges to the traditional models of quality assurance that are designed to validate domestic higher education. When institutions cross international borders, at least two quality assurance protocols are involved. To guard against fraud and abuse, quality assurance in the host country is…

  14. 10 CFR 26.137 - Quality assurance and quality control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Quality assurance and quality control. 26.137 Section 26....137 Quality assurance and quality control. (a) Quality assurance program. Each licensee testing... metabolites. (b) Performance testing and quality control requirements for validity screening tests....

  15. 44 CFR 7.9 - Assurances from institutions.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Assurances from institutions...) Nondiscrimination in FEMA-Assisted Programs-General § 7.9 Assurances from institutions. (a) In the case of any application for Federal financial assistance to an institution of higher education, the assurance required...

  16. Set up and programming of an ALICE Time-Of-Flight trigger facility and software implementation for its Quality Assurance (QA) during LHC Run 2

    CERN Document Server

    Toschi, Francesco

    2016-01-01

    The Cosmic and Topology Trigger Module (CTTM) is the main component of a trigger based on the ALICE TOF detector. Taking advantage of the TOF fast response, this VME board implements the trigger logic and delivers several L0 trigger outputs, used since Run 1, to provide cosmic triggers and rare triggers in pp, p+Pb and Pb+Pb data taking. Due to TOF DCS architectural change of the PCs controlling the CTTM (from 32 bits to 64 bits) it is mandatory to upgrade the software related to the CTTM including the code programming the FPGA firmware. A dedicated CTTM board will be installed in a CERN lab (Meyrin site), with the aim of recreating the electronics chain of the TOF trigger, to get a comfortable porting of the code to the 64 bit environment. The project proposed to the summer student is the setting up of the CTTM and the porting of the software. Moreover, in order to monitor the CTTM Trigger board during the real data taking, the implementation of a new Quality Assurance (QA) code is also crucial, together wit...

  17. Quality assurance programs developed and implemented by the US Department of Energy`s Analytical Services Program for environmental restoration and waste management activities

    Energy Technology Data Exchange (ETDEWEB)

    Lillian, D.; Bottrell, D. [Dept. of Energy, Germntown, MD (United States)

    1993-12-31

    The U.S. Department of Energy`s (DOE`s) Office of Environmental Restoration and Waste Management (EM) has been tasked with addressing environmental contamination and waste problems facing the Department. A key element of any environmental restoration or waste management program is environmental data. An effective and efficient sampling and analysis program is required to generate credible environmental data. The bases for DOE`s EM Analytical Services Program (ASP) are contained in the charter and commitments in Secretary of Energy Notice SEN-13-89, EM program policies and requirements, and commitments to Congress and the Office of Inspector General (IG). The Congressional commitment by DOE to develop and implement an ASP was in response to concerns raised by the Chairman of the Congressional Environment, Energy, and Natural Resources Subcommittee, and the Chairman of the Congressional Oversight and Investigations Subcommittee of the Committee on Energy and Commerce, regarding the production of analytical data. The development and implementation of an ASP also satisfies the IG`s audit report recommendations on environmental analytical support, including development and implementation of a national strategy for acquisition of quality sampling and analytical services. These recommendations were endorsed in Departmental positions, which further emphasize the importance of the ASP to EM`s programs. In September 1990, EM formed the Laboratory Management Division (LMD) in the Office of Technology Development to provide the programmatic direction needed to establish and operate an EM-wide ASP program. In January 1992, LMD issued the {open_quotes}Analytical Services Program Five-Year Plan.{close_quotes} This document described LMD`s strategy to ensure the production of timely, cost-effective, and credible environmental data. This presentation describes the overall LMD Analytical Services Program and, specifically, the various QA programs.

  18. Quality Assurance Project Plan for the Environmental Monitoring Program in Waste Area Grouping 6 at Oak Ridge National Laboratory, Oak Ridge, Tennessee. Environmental Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    1993-12-01

    Waste Area Grouping (WAG) 6 is a hazardous and low-level radioactive waste disposal site at Oak Ridge National Laboratory (ORNL). Extensive site investigations have revealed contaminated surface water, sediments, groundwater, and soils. Based on the results of the Resource Conservation and Recovery Act (RCRA) Facility Investigation (RFI) conducted from 1989--1991 and on recent interactions with the US Environmental Protection Agency (EPA) and the Tennessee Department of Environment and Conservation (TDEC), a decision was made to defer implementing source control remedial measures at the WAG. The information shows WAG 6 contributes < 2% of the total off-site contaminant risk released over White Oak Dam (WOD). The alternative selected to address hazards at WAG 6 involves maintenance of site access controls to prevent public exposure to on-site contaminants, continued monitoring of contaminant releases to determine if source control measures will be required in the future, and development of technologies to support final remediation of WAG 6. This Quality Assurance Project Plan (QAPjP) has been developed as part of the Environmental Monitoring Plan for Waste Area Grouping 6 at Oak Ridge National Laboratory, Oak Ridge, Tennessee (DOE/OR/01-1192&D1). Environmental monitoring will be conducted in two phases: the baseline monitoring phase and the routine annual monitoring phase. The baseline monitoring phase will be conducted to establish the baseline contaminant release conditions at the Waste Area Grouping (WAG), to confirm the site-related chemicals of concern (COC), and to gather data to confirm the site hydrologic model. The baseline monitoring phase is expected to begin in 1994 and continue for 12-18 months. The routine annual monitoring phase will consist of continued sampling and analyses of COC to determine off-WAG contaminant flux, to identify trends in releases, and to confirm the COC. The routine annual monitoring phase will continue for {approximately}4 years.

  19. Quality Assurance for Higher Education Franchising.

    Science.gov (United States)

    Yorke, Mantz

    1993-01-01

    The practice of "franchising" higher education programs, or provision of educational programs through vendors, is examined as it occurs in the United Kingdom as a result of recent educational policy changes. A set of principles for assuring the quality of such programs is proposed. (MSE)

  20. SWiFT Software Quality Assurance Plan.

    Energy Technology Data Exchange (ETDEWEB)

    Berg, Jonathan Charles [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2016-01-01

    This document describes the software development practice areas and processes which contribute to the ability of SWiFT software developers to provide quality software. These processes are designed to satisfy the requirements set forth by the Sandia Software Quality Assurance Program (SSQAP). APPROVALS SWiFT Software Quality Assurance Plan (SAND2016-0765) approved by: Department Manager SWiFT Site Lead Dave Minster (6121) Date Jonathan White (6121) Date SWiFT Controls Engineer Jonathan Berg (6121) Date CHANGE HISTORY Issue Date Originator(s) Description A 2016/01/27 Jon Berg (06121) Initial release of the SWiFT Software Quality Assurance Plan

  1. Modality-dependent dose requirements in the Austrian breast cancer early detection program. First results from technical quality assurance; Geraeteabhaengiger Dosisbedarf im Oesterreichischen Brustkrebsfrueherkennungsprogramm. Erste Ergebnisse aus der technischen Qualitaetssicherung

    Energy Technology Data Exchange (ETDEWEB)

    Osanna-Elliott, A.; Semturs, F.; Menhart, S.; Schloegl, C.; Wildner, S.; Zwettler, G. [AGES, Wien (Austria). Referenzzentrum fuer technische Qualitaetssicherung im Brustkrebsfrueherkennungsprogramm

    2015-07-01

    The Austrian Breast Cancer Early Detection Program (BKFP) has officially started in January 2014. In order to ensure that all participating women can rely on a sufficient cancer detection rate while at the same time the required dose is as low as reasonably achievable, all participating radiology institutes (approx. 200) have to fulfill strict quality assurance requirements. The control and certification is performed by the Reference Center for Technical Quality Assurance (RefZQS), which has been developing the methods and tolerances in a pilot project since 2007. The limits are defined in the EUREF-Oeprotocol which is based on the European EPQC guidelines. From the requirement for optimized image quality while simultaneously following the ALARA principle, we found modality-dependent dose requirements, which we had expected but which have now been compiled for the first time for Austria.

  2. High assurance services computing

    CERN Document Server

    2009-01-01

    Covers service-oriented technologies in different domains including high assurance systemsAssists software engineers from industry and government laboratories who develop mission-critical software, and simultaneously provides academia with a practitioner's outlook on the problems of high-assurance software development

  3. Building Assured Systems Framework

    Science.gov (United States)

    2010-09-01

    Extraction (FX) Techniques to Reverse Engineer Virtual Machines Mark Pleszkoch, Stacy Prowell, Cory F. Cohen, and Jeffrey S. Havrilla 6.3 Assured...Cory F. Cohen and Jeffrey S. Havrilla 5.1.2 Potential attack methods, 5.2.1 Historic and potential operational attack methods, 6.3 Assured

  4. Medicare: a strategy for quality assurance.

    Science.gov (United States)

    Lohr, K N

    1991-01-01

    This paper has outlined a strategy proposed by an IOM study committee for a quality review and assurance program for Medicare. The committee intended that such a program respond to several major issues, including: the burdens of harm of poor quality of care (poor performance of clinicians in both technical and interpersonal ways, unnecessary and inappropriate services, and lack of needed and appropriate services); difficulties and incentives presented by the organization and financing of healthcare; the state of scientific knowledge; the problems of adversarial, punitive, and burdensome external QA activities and the need to foster successful internal, organization-based QA programs; the adequacy of quality review and assurance methods and tools; and the human and financial resources for quality assurance. In comparison with the existing federal peer review organization program, the IOM's proposed program is intended to focus far more directly on quality assurance, cover all major settings of care, emphasize both a wide range of patient outcomes and the process of care, and have a greatly expanded program evaluation component and greater public oversight and accountability. In laying out the details of such a program, the IOM committee advanced 10 recommendations to support its proposed program. Two of these call for the Secretary of DHHS to support and expand research and educational activities designed to improve the nation's knowledge base and capacity for quality assurance. Finally, the committee emphasized both the extraordinary challenges of quality assurance and the diversity of support for addressing those challenges, noting that patients, providers, and societal agents all have a responsibility in this regard. Building the nation's capacity through additional research and expanded educational efforts is a major cornerstone of the entire enterprise.

  5. MCNP{trademark} Software Quality Assurance plan

    Energy Technology Data Exchange (ETDEWEB)

    Abhold, H.M.; Hendricks, J.S.

    1996-04-01

    MCNP is a computer code that models the interaction of radiation with matter. MCNP is developed and maintained by the Transport Methods Group (XTM) of the Los Alamos National Laboratory (LANL). This plan describes the Software Quality Assurance (SQA) program applied to the code. The SQA program is consistent with the requirements of IEEE-730.1 and the guiding principles of ISO 900.

  6. Quality assurance of metabolomics.

    Science.gov (United States)

    Bouhifd, Mounir; Beger, Richard; Flynn, Thomas; Guo, Lining; Harris, Georgina; Hogberg, Helena; Kaddurah-Daouk, Rima; Kamp, Hennicke; Kleensang, Andre; Maertens, Alexandra; Odwin-DaCosta, Shelly; Pamies, David; Robertson, Donald; Smirnova, Lena; Sun, Jinchun; Zhao, Liang; Hartung, Thomas

    2015-01-01

    Metabolomics promises a holistic phenotypic characterization of biological responses to toxicants. This technology is based on advanced chemical analytical tools with reasonable throughput, including mass-spectroscopy and NMR. Quality assurance, however - from experimental design, sample preparation, metabolite identification, to bioinformatics data-mining - is urgently needed to assure both quality of metabolomics data and reproducibility of biological models. In contrast to microarray-based transcriptomics, where consensus on quality assurance and reporting standards has been fostered over the last two decades, quality assurance of metabolomics is only now emerging. Regulatory use in safety sciences, and even proper scientific use of these technologies, demand quality assurance. In an effort to promote this discussion, an expert workshop discussed the quality assurance needs of metabolomics. The goals for this workshop were 1) to consider the challenges associated with metabolomics as an emerging science, with an emphasis on its application in toxicology and 2) to identify the key issues to be addressed in order to establish and implement quality assurance procedures in metabolomics-based toxicology. Consensus has still to be achieved regarding best practices to make sure sound, useful, and relevant information is derived from these new tools.

  7. Software quality assurance handbook

    Energy Technology Data Exchange (ETDEWEB)

    1990-09-01

    There are two important reasons for Software Quality Assurance (SQA) at Allied-Signal Inc., Kansas City Division (KCD): First, the benefits from SQA make good business sense. Second, the Department of Energy has requested SQA. This handbook is one of the first steps in a plant-wide implementation of Software Quality Assurance at KCD. The handbook has two main purposes. The first is to provide information that you will need to perform software quality assurance activities. The second is to provide a common thread to unify the approach to SQA at KCD. 2 figs.

  8. RAVEN Quality Assurance Activities

    Energy Technology Data Exchange (ETDEWEB)

    Cogliati, Joshua Joseph [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-01

    This report discusses the quality assurance activities needed to raise the Quality Level of Risk Analysis in a Virtual Environment (RAVEN) from Quality Level 3 to Quality Level 2. This report also describes the general RAVEN quality assurance activities. For improving the quality, reviews of code changes have been instituted, more parts of testing have been automated, and improved packaging has been created. For upgrading the quality level, requirements have been created and the workflow has been improved.

  9. Quality-assurance needs and goals in solar energy conversion

    Energy Technology Data Exchange (ETDEWEB)

    Gross, G. E.

    1980-07-01

    A discussion of the status of quality assurance activities in solar energy conversion technologies and of the needs for further efforts in this area is presented. The importance of reliability and quality assurance activities to various end users is briefly discussed. Some details of such activities in wind, active heating and cooling, and photovoltaic technologies are given. Suggestions for an inegrated reliability, quality assurance program are presented and their importance to the growth of solar energy application is discussed.

  10. Quality assurance and organizational effectiveness in hospitals.

    Science.gov (United States)

    Hetherington, R W

    1982-01-01

    The purpose of this paper is to explore some aspects of a general theoretical model within which research on the organizational impacts of quality assurance programs in hospitals may be examined. Quality assurance is conceptualized as an organizational control mechanism, operating primarily through increased formalization of structures and specification of procedures. Organizational effectiveness is discussed from the perspective of the problem-solving theory of organizations, wherein effective organizations are those which maintain at least average performance in all four system problem areas simultaneously (goal-attainment, integration, adaptation and pattern-maintenance). It is proposed that through the realization of mutual benefits for both professionals and the bureaucracy, quality assurance programs can maximize such effective performance in hospitals.

  11. Quality assurance program guidelines for application to and use by manufacturers of rail/guideway vehicles, buses, automatic train control systems, and their major subsystems

    Science.gov (United States)

    Witkin, S. A.

    1976-01-01

    Guidelines are presented for a quality assurance system to be implemented by the manufacturer in support of designing, developing, fabricating, assembling, inspecting, testing, handling, and delivery of equipment being procured for use in public urban mass transit systems. The guidelines apply to this equipment when being procured for: (1) use in revenue service; (2) demonstration of systems that will be revenue producing or used by the public; (3) use as a prototype for follow-on operational/revenue producing equipment procurements; and (4) qualification tests.

  12. The use of 'grading' in the application of the CSA N286.7 standard for quality assurance of analytical, scientific and design computer programs for nuclear power plants

    Energy Technology Data Exchange (ETDEWEB)

    Pascoe, J. [AMEC-Nuclear Safety Solutions, Toronto, Ontario (Canada); Richards, D.J. [Atomic Energy of Canada Limited, Chalk River, Ontario (Canada); Mileta, E. [Ontario Power Generation, Toronto, Ontario (Canada); Skears, J. [CANDU Owners Group, Toronto, Ontario (Canada)

    2009-07-01

    Computer programs used for the design and safety analysis of nuclear reactors must comply with the Canadian standard CSA N286.7-99, 'Quality Assurance of Analytical, Scientific, and Design Computer Programs for Nuclear Power Plants'. Although 'grading' is acknowledged in the N286 series of Standards, an appropriate level of guidance for implementation is not provided. A collaborative effort was undertaken by the CANDU Industry to provide guidance on the application of the Standard - based on Industry experience. This guidance included a graded approach to meeting the requirements of the Standard and that approach is described and illustrated with a worked example in this paper. (author)

  13. Where Is Quality Assurance Going in Dental School Curricula?

    Science.gov (United States)

    Loupe, Michael J.

    1990-01-01

    The quality assurance consortium begun in 1979 and similar professional and foundation projects have influenced dental school curriculum development in the last decade. Other forces driving development of academic and practice programs for quality assurance include cost containment, risk management, electronic technology, and developments in…

  14. Vega flow assurance system

    Energy Technology Data Exchange (ETDEWEB)

    Larsen, Marit; Munaweera, Sampath

    2010-07-01

    Vega is a gas condensate field located at the west coast of Norway and developed as a tie-in to the Gjoea platform. Operator is Statoil, production startup is estimated to the end of 2010. Flow assurance challenges are high reservoir pressure and temperature, hydrate and wax control, liquid accumulation and monitoring the well/template production rates. The Vega Flow Assurance System (FAS) is a software that supports monitoring and operation of the field. The FAS is based FlowManagerTM designed for real time systems. This is a flexible tool with its own steady state multiphase- and flow assurance models. Due to the long flowlines lines and the dynamic behavior, the multiphase flow simulator OLGA is also integrated in the system. Vega FAS will be used as: - An online monitoring tool - An offline what-if simulation and validation tool - An advisory control system for well production allocation. (Author)

  15. Software quality assurance plan for GCS

    Science.gov (United States)

    Duncan, Stephen E.; Bailey, Elizabeth K.

    1990-01-01

    The software quality assurance (SQA) function for the Guidance and Control Software (GCS) project which is part of a software error studies research program is described. The SQA plan outlines all of the procedures, controls, and audits to be carried out by the SQA organization to ensure adherence to the policies, procedures, and standards for the GCS project.

  16. Benchmarking Software Assurance Implementation

    Science.gov (United States)

    2011-05-18

    product The chicken#. (a.k.a. Process Focused Assessment ) – Management Systems ( ISO 9001 , ISO 27001, ISO 2000) – Capability Maturity Models (CMMI...Assurance PRM, RMM, Assurance for CMMI)) – Lifecycle Processes ( ISO /IEEE 15288, ISO /IEEE 12207) – COBIT, ITIL, MS SDL, OSAMM, BSIMM 5 The egg...a.k.a Product Focused Assessments) – SCAP - NIST-SCAP – ISO /OMG W3C – KDM, BPMN, RIF, XMI, RDF – OWASP Top 10 – SANS TOP 25 – Secure Code Check Lists

  17. Rastreabilidade das referências metrológicas em dose absorvida na água do Programa de Qualidade em Dosimetria Traceability of metrologic references of dose absorbed to water used in a Dosimetry Quality Assurance Program

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo de Almeida

    2005-06-01

    Full Text Available OBJETIVO: Este trabalho tem por objetivo apresentar a estrutura solidamente estabelecida de rastreabilidade dos padrões ionométricos e do sistema de medidas com dosímetros termoluminescentes, como parte da confiabilidade do Programa de Qualidade em Dosimetria (PQD, que visa a garantir o mais elevado nível de exatidão às suas medidas. MATERIAIS E MÉTODOS: A exemplo de outros programas, usaram-se dosímetros termoluminescentes (DTL 937 na forma de pó, colocados em uma cápsula de plástico, em "kits" específicos para cada aplicação, os quais foram enviados, por via postal, aos centros participantes. RESULTADOS: Os resultados da intercomparação realizada entre o Laboratório de Ciências Radiológicas da Universidade do Estado do Rio de Janeiro e o EQUAL-ESTRO para o feixe de raios gama de 60Co, expressos para (1sigma, e os resultados das medidas de dose absorvida, obtidos com as câmaras dp Programa EQUAL e as câmaras do PQD, apresentaram discordância menor que 0,5%. CONCLUSÃO: Dos resultados conclui-se que o PQD alcançou o nível desejado de confiabilidade, necessário à implementação do Programa.OBJECTIVE: To present the solidly established traceability structure for ionometric standards and for thermoluminescent dosimetry system that ensures reliability of the Dosimetry Quality Assurance Program and is aimed to certify the highest level of accuracy of the measurements. MATERIALS AND METHODS: Thermoluminescent powder dosimeters (DTL 937 placed into plastic capsules and packed in specific kits for each intended application were mailed to the participant centers. RESULTS: The results of the intercomparisons performed between "Laboratório de Ciências Radiológicas da Universidade do Estado do Rio de Janeiro" and EQUAL-ESTRO for the beam of 60Co gamma rays, expressed for (1sigma, and the results of the dose absorbed measurements obtained with the chambers of the Program EQUAL and the chambers of the Dosimetry Quality Assurance

  18. Quality Assurance Source Requirements Traceability Database

    Energy Technology Data Exchange (ETDEWEB)

    MURTHY, R., NAYDENOVA, A., DEKLEVER, R., BOONE, A.

    2006-01-30

    At the Yucca Mountain Project the Project Requirements Processing System assists in the management of relationships between regulatory and national/industry standards source criteria, and Quality Assurance Requirements and Description document (DOE/R W-0333P) requirements to create compliance matrices representing respective relationships. The matrices are submitted to the U.S. Nuclear Regulatory Commission to assist in the commission's review, interpretation, and concurrence with the Yucca Mountain Project QA program document. The tool is highly customized to meet the needs of the Office of Civilian Radioactive Waste Management Office of Quality Assurance.

  19. Mission Operations Assurance

    Science.gov (United States)

    Faris, Grant

    2012-01-01

    Integrate the mission operations assurance function into the flight team providing: (1) value added support in identifying, mitigating, and communicating the project's risks and, (2) being an essential member of the team during the test activities, training exercises and critical flight operations.

  20. Design quality assurance for plant modifications

    Energy Technology Data Exchange (ETDEWEB)

    Ankrum, G.T.; Norkin, D.P.; Architzel, R.

    1985-11-01

    The US Nuclear Regulatory Commission's Office of Inspection and Enforcement has conducted direct inspections of the technical aspects of the nuclear plant design process for several plants under construction. It has also evaluated independent design verification programs and engineering assurance programs at a number of other plants under construction. Many of the lessons learned from these construction phase efforts are directly applicable to operating plants undergoing major modifications.

  1. Assuring quality in high-consequence engineering

    Energy Technology Data Exchange (ETDEWEB)

    Hoover, Marcey L.; Kolb, Rachel R.

    2014-03-01

    In high-consequence engineering organizations, such as Sandia, quality assurance may be heavily dependent on staff competency. Competency-dependent quality assurance models are at risk when the environment changes, as it has with increasing attrition rates, budget and schedule cuts, and competing program priorities. Risks in Sandia's competency-dependent culture can be mitigated through changes to hiring, training, and customer engagement approaches to manage people, partners, and products. Sandia's technical quality engineering organization has been able to mitigate corporate-level risks by driving changes that benefit all departments, and in doing so has assured Sandia's commitment to excellence in high-consequence engineering and national service.

  2. Mentoring in Higher Education Should Be the Norm to Assure Success: Lessons Learned from the Faculty Mentoring Program, West Chester University, 2008-2011

    Science.gov (United States)

    Bean, Nadine M.; Lucas, Lisa; Hyers, Lauri L.

    2014-01-01

    Despite a wealth of qualitative and quantitative data regarding the positive effects of higher education mentoring programs on faculty satisfaction, retention, tenure, and promotion, mentoring programs are not widespread. The authors examine evaluative data from the first four years of the Faculty Mentoring Program at West Chester University. Of…

  3. BYU Food Quality Assurance Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Quality Assurance Lab is located in the Eyring Science Center in the department of Nutrition, Dietetics, and Food Science. The Quality Assurance Lab has about 10...

  4. Quality assurance for gamma knives

    Energy Technology Data Exchange (ETDEWEB)

    Jones, E.D.; Banks, W.W.; Fischer, L.E. [Lawrence Livermore National Lab., CA (United States)

    1995-09-01

    This report describes and summarizes the results of a quality assurance (QA) study of the Gamma Knife, a nuclear medical device used for the gamma irradiation of intracranial lesions. Focus was on the physical aspects of QA and did not address issues that are essentially medical, such as patient selection or prescription of dose. A risk-based QA assessment approach was used. Sample programs for quality control and assurance are included. The use of the Gamma Knife was found to conform to existing standards and guidelines concerning radiation safety and quality control of external beam therapies (shielding, safety reviews, radiation surveys, interlock systems, exposure monitoring, good medical physics practices, etc.) and to be compliant with NRC teletherapy regulations. There are, however, current practices for the Gamma Knife not covered by existing, formalized regulations, standards, or guidelines. These practices have been adopted by Gamma Knife users and continue to be developed with further experience. Some of these have appeared in publications or presentations and are slowly finding their way into recommendations of professional organizations.

  5. Creating Quality Assurance and International Transparency for Quality Assurance Agencies

    DEFF Research Database (Denmark)

    Kristoffersen, Dorte; Lindeberg, Tobias

    2004-01-01

    The paper presents the experiences gained in the pilot project on mutual recognition conducted by the quality assurance agencies in the Nordic countries and the future perspective for international quality assurance of national quality assurance agencies. The background of the project was the need......, on the one hand, to advance internationalisation of quality assurance of higher education, and on the other hand, allow for the differences in the national approaches to quality assurance. The paper will focus on two issues: first, the strength and weaknesses of the method employed and of the use of the ENQA...

  6. Power transformers quality assurance

    CERN Document Server

    Dasgupta, Indrajit

    2009-01-01

    About the Book: With the view to attain higher reliability in power system operation, the quality assurance in the field of distribution and power transformers has claimed growing attention. Besides new developments in the material technology and manufacturing processes of transformers, regular diagnostic testing and maintenance of any engineering product may be ascertained by ensuring: right selection of materials and components and their quality checks. application of correct manufacturing processes any systems engineering. the user`s awareness towards preventive maintenance. The

  7. ENVIRONMENTAL TECHNOLOGY VERIFICATION COATINGS AND COATING EQUIPMENT PROGRAM (ETV CCEP), FINAL TECHNOLOGY APPLICATIONS GROUP TAGNITE--TESTING AND QUALITY ASSURANCE PLAN (T/QAP)

    Science.gov (United States)

    The overall objective of the Environmental Testing and Verification Coatings and Coating Equipment Program is to verify pollution prevention and performance characteristics of coating technologies and make the results of the testing available to prospective coating technology use...

  8. Directory of Certificates of Compliance for radioactive materials packages: Report of NRC approved quality assurance programs for radioactive materials packages. Volume 3, Revision 15

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-01

    The purpose of this directory is to make available a convenient source of information on packagings which have been approved by the US Nuclear Regulatory Commission. To assist in identifying packaging, an index by Model Number and corresponding Certificate of Compliance Number is included at the front of Volumes 1 and 2. An alphabetical listing by user name is included in the back of Volume 3 of approved QA programs. The reports include a listing of all users of each package design and approved QA programs prior to the publication date.

  9. Integrating the Master of Software Assurance Reference Curriculum into the Model Curriculum and Guidelines for Graduate Degree Programs in Information Systems

    Science.gov (United States)

    2011-02-01

    promulgate best practices and metho - dologies that promote integrity, security, and reliability in software code development, including processes and...methods for physical and personnel environments 5.3. Ethics and Integrity in Creation, Acquisition, and Operation of Software Systems 5.3.1. Overview of...business (CBB), finite mathematics , elementary statistics, elementary computer programming, elementary economics, and elementary psychology. The

  10. The case of sustainability assurance: constructing a new assurance service

    NARCIS (Netherlands)

    O'Dwyer, B.

    2011-01-01

    This paper presents an in-depth longitudinal case study examining the processes through which practitioners in two Big 4 professional services firms have attempted to construct sustainability assurance (independent assurance on sustainability reports). Power’s (1996, 1997, 1999, 2003) theorization o

  11. Project specific quality assurance plan, W-151, Tank 241-AZ-101 waste retrieval system. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Manthei, M.E.

    1994-11-21

    This project specific quality assurance program plan establishes the responsibility for the implementation of QA requirements, defines and documents the QA requirements associated with design, procurement, and construction, and defines and documents the degree of QA reviews and verifications on the design and construction necessary to assure compliance to project and DOE requirements. Revision 2 updates the QAPP to provide concurrence with approved work scope deletion. In addition, the Quality Assurance Program Index is being updated to reflect the current Quality Assurance Program requirements per DOE Order 5700.6C.

  12. Measurement quality assurance for radioassay laboratories

    Energy Technology Data Exchange (ETDEWEB)

    McCurdy, D.E. [Yankee Atomic Environmental Laboratory, Boston, MA (United States)

    1993-12-31

    Until recently, the quality of U.S. radioassay laboratory services has been evaluated by a limited number of governmental measurement assurance programs (MAPs). The major programs have been limited to the U.S. Department of Energy (DOE), the U.S. Environmental Protection Agency (EPA) and the U.S. Nuclear Regulatory Commission (NRC). In 1988, an industry MAP was established for the nuclear power utility industry through the U.S. Council for Energy Awareness/National Institute of Standards and Technology (USCEA/NIST). This program functions as both a MAP for utility laboratories and/or their commercial contractor laboratories, and as a traceability program for the U.S. radioactive source manufacturers and the utility laboratories. Each of these generic MAPs has been initiated and is maintained to serve the specific needs of the sponsoring agency or organization. As a result, there is diversification in their approach, scope, requirements, and degree of traceability to NIST. In 1987, a writing committee was formed under the American National Standards Institute (ANSI) N42.2 committee to develop a standard to serve as the basis document for the creation of a national measurement quality assurance (MQA) program for radioassay laboratories in the U.S. The standard is entitled, {open_quotes}Measurement Quality Assurance For Radioassay Laboratories.{open_quotes} The document was developed to serve as a guide for MQA programs maintained for the specialized sectors of the radioassay community, such as bioassay, routine environmental monitoring, environmental restoration and waste management, radiopharmaceuticals, and nuclear facilities. It was the intent of the writing committee to develop a guidance document that could be utilized to establish a laboratory`s specific data quality objectives (DQOs) that govern the operational requirements of the radioassay process, including mandated protocols and recommendations.

  13. Development and implementation challenges of a quality assured HIV infant diagnosis program in Nigeria using dried blood spots and DNA polymerase chain reaction.

    Science.gov (United States)

    Audu, Rosemary; Onwuamah, Chika; Salu, Olumuyiwa; Okwuraiwe, Azuka; Ou, Chin-Yih; Bolu, Omotayo; Bond, Kyle B; Diallo, Karidia; Lu, Lydia; Jelpe, Tapdiyel; Okoye, McPaul; Ngige, Evelyn; Vertefeuille, John

    2015-04-01

    Nigeria has one of the highest HIV burdens as well as mother-to-infant transmission rates in the world. A pilot program using polymerase chain reaction (PCR)-based testing of dried blood spot (DBS) specimens was implemented to enable early identification of HIV-infected infants and timely referral and linkage to care. From February 2007 to October 2008, whole blood was collected by finger prick to prepare DBS from infants HIV-1 DNA Test, v1.5. To monitor laboratory testing quality, all of the PCR-positive and 10% of the PCR-negative DBS were retested by the same method at another reference laboratory. Three hundred and sixty-five randomly selected infants were screened using HIV rapid tests (RT) according to the national algorithm and RT-negative and PCR-positive specimens were also tested using Genscreen enzyme-linked immunosorbent assay (EIA) (Bio-Rad, France). The turnaround time (TAT) from sample collection, testing, and dispatching of results from each health facility was monitored. A total of 1,273 infants with a median age of 12.6 weeks (1 day to 71.6 weeks) participated in the program and 280 (22.0%) were PCR positive. HIV transmission levels varied greatly in the different health facilities ranging from 7.1% to 38.4%. Infants aged 48 to 72 weeks had the highest level of PCR positivity (41.1%). All PCR-positive specimens were confirmed by retesting. The mean turnaround time from DBS collection to returning of the laboratory result to the health facilities was 25 days. Three infants were found to be HIV antibody negative by rapid tests but were positive by both PCR and the fourth generation EIA. The DBS-based PCR program accurately identified all of the HIV-infected infants. However, many programmatic challenges related to the laboratory and TAT were identified.

  14. FESA Quality Assurance

    CERN Document Server

    CERN. Geneva

    2015-01-01

    FESA is a framework used by 100+ developers at CERN to design and implement the real-time software used to control the accelerators. Each new version must be tested and qualified to ensure that no backward compatibility issues have been introduced and that there is no major bug which might prevent accelerator operations. Our quality assurance approach is based on code review and a two-level testing process. The first level is made of unit-test (Python unittest & Google tests for C++). The second level consists of integration tests running on an isolated test environment. We also use a continuous integration service (Bamboo) to ensure the tests are executed periodically and the bugs caught early. In the presentation, we will explain the reasons why we took this approach, the results and some thoughts on the pros and cons.

  15. Construction quality assurance report

    Energy Technology Data Exchange (ETDEWEB)

    Roscha, V.

    1994-09-08

    This report provides a summary of the construction quality assurance (CQA) observation and test results, including: The results of the geosynthetic and soil materials conformance testing. The observation and testing results associates with the installation of the soil liners. The observation and testing results associated with the installation of the HDPE geomembrane liner systems. The observation and testing results associated with the installation of the leachate collection and removal systems. The observation and testing results associated with the installation of the working surfaces. The observation and testing results associated with in-plant manufacturing process. Summary of submittal reviews by Golder Construction Services, Inc. The submittal and certification of the piping material specifications. The observation and verification associated of the Acceptance Test Procedure results of the operational equipment functions. Summary of the ECNs which are incorporated into the project.

  16. Recent Trends in Quality Assurance

    Science.gov (United States)

    Amaral, Alberto; Rosa, Maria Joao

    2010-01-01

    In this paper we present a brief description of the evolution of quality assurance in Europe, paying particular attention to its relationship to the rising loss of trust in higher education institutions. We finalise by analysing the role of the European Commission in the setting up of new quality assurance mechanisms that tend to promote…

  17. Quality Assurance Plan for the remedial investigation of Waste Area Grouping 2 at Oak Ridge National Laboratory, Oak Ridge, Tennessee. Environmental Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    Atwood, G.P.; Miller, D.E. [Automated Sciences Group, Inc., Oak Ridge, TN (United States)

    1992-12-01

    The Oak Ridge National Laboratory (ORNL) Waste Area Grouping (WAG) 2 Site Investigation (SI)includes the lower portion of the White Oak Creek (WOC) drainage and enbayment, and associated floodplain and subsurface environment. The ORNL main plant and the major waste storage and disposal facilities at ORNL are located in the WOC watershed and are drained by the WOC system to the Clinch River, located off-site. Environmental media are contaminated and continue to receive contaminants from hydrologically upgradient WAGS. WAG 2 is important as a conduit from upgradient areas to the Clinch River. The general objectives of the WAG 2 SI Project are to conduct a multimedia monitoring and characterization program to define and monitor the input of contaminants from adjacent WAGS, monitor and gather sufficient information for processes controlling or driving contaminant fluxes to construct an appropriate conceptual model for WAG 2, and prepare for the eventual remediation of WAG 2.

  18. Implementation of a Quality Assurance Program in a new Radiotherapy Center taking as base the TG-40; Implementacion del programa de Garantia de Calidad en un Centro nuevo de Radioterapia tomando como base el TG-40

    Energy Technology Data Exchange (ETDEWEB)

    Marles, A.; Besa, P.; Hecht, P.; Arriagada, L.; Ruz, A.; Garay, C. [Pontificia Universidad Catolica de Chile, Centro de Cancer. Diagonal Paraguay, 319. Santiago (Chile)

    1998-12-31

    The recommended principles in the `Comprehensive QA for radiation oncology: Report of AAPM Radiation Therapy Committee Task Group 40`, TG-40, have been the base for implementation of the Quality Assurance Program of a modern Radiotherapy service. During its application has been necessary: to initiate its implementation before the equipment installation, assuming the costs of the contracts of the qualified personnel, realizing an initial investment adequate for equipment acquisition necessary for acceptation, commissioning and routinary control, the experienced formation of the personnel in the protocol philosophy, establishing procedures for day by day process which would allow the retrofeeding, the elaboration of templates and opening to changes and adjustments according to the necessities. The experience of two years had been demonstrated that the TG-40: a) It is feasible to be implemented but sometimes no strict totally and it is essential to have qualified personnel and the necessary material resources; b) It does not contains all the necessary for its practical implementation and must be completing with procedures and routine formats which facilitate their application; c) It allows the detection and opportune failure correction in the process; d) It is a continuous process that does not finishes. (Author)

  19. Assured Access/Mobile Computing Initiatives on Five University Campuses.

    Science.gov (United States)

    Blurton, Craig; Chee, Yam San; Long, Phillip D.; Resmer, Mark; Runde, Craig

    Mobile computing and assured access are becoming popular terms to describe a growing number of university programs which take advantage of ubiquitous network access points and the portability of notebook computers to ensure all students have access to digital tools and resources. However, the implementation of such programs varies widely from…

  20. Workshop on measurement quality assurance for ionizing radiation: Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Heath, J.A.; Swinth, K.L. [comps.

    1993-12-31

    This workshop was held to review the status of secondary level calibration accreditation programs, review related measurement accreditation programs, document lessons learned, and to present changes in programs due to new national priorities involving radioactivity measurements. Contents include: fundamentals of measurement quality assurance (MQA), standards for MQA programs; perspectives and policies; complete MQA programs; future MQA programs; QA/QC programs--radioactivity; QA/QC programs--dosimetry; laboratory procedures for QA/QC; in-house control of reference dosimetry laboratories; in-house controls of radioactivity laboratories; and poster session. Selected papers are indexed separately for inclusion in the Energy Science and Technology Database.

  1. Central online quality assurance in radiology. An IT solution exemplified by the German Breast Cancer Screening Program; Zentrale Online-Qualitaetssicherung in der Radiologie. Eine IT-Loesung am Beispiel des deutschen Mammografie-Screening-Programms

    Energy Technology Data Exchange (ETDEWEB)

    Czwoydzinski, J.; Girnus, R.; Sommer, A. [Universitaetsklinikum Muenster (Germany). Referenzzentrum Mammographie; Heindel, W.; Lenzen, H. [Universitaetsklinikum Muenster (Germany). Referenzzentrum Mammographie; Universitaetsklinikum Muenster (Germany). Inst. fuer Klinische Radiologie

    2011-09-15

    Purpose: Physical-technical quality assurance is one of the essential tasks of the National Reference Centers in the German Breast Cancer Screening Program. For this purpose the mammography units are required to transfer the measured values of the constancy tests on a daily basis and all phantom images created for this purpose on a weekly basis to the reference centers. This is a serious logistical challenge. To meet these requirements, we developed an innovative software tool. Materials and Methods: By the end of 2005, we had already developed web-based software (MammoControl) allowing the transmission of constancy test results via entry forms. For automatic analysis and transmission of the phantom images, we then introduced an extension (MammoControl DIANA). This was based on Java, Java Web Start, the NetBeans Rich Client Platform, the Pixelmed Java DICOM Toolkit and the ImageJ library. Results: MammoControl DIANA was designed to run locally in the mammography units. This allows automated on-site image analysis. Both results and compressed images can then be transmitted to the reference center. We developed analysis modules for the daily and monthly consistency tests and additionally for a homogeneity test. Conclusion: The software we developed facilitates the immediate availability of measurement results, phantom images, and DICOM header data in all reference centers. This allows both targeted guidance and short response time in the case of errors. We achieved a consistent IT-based evaluation with standardized tools for the entire screening program in Germany. (orig.)

  2. NASA's Approach to Software Assurance

    Science.gov (United States)

    Wetherholt, Martha

    2015-01-01

    NASA defines software assurance as: the planned and systematic set of activities that ensure conformance of software life cycle processes and products to requirements, standards, and procedures via quality, safety, reliability, and independent verification and validation. NASA's implementation of this approach to the quality, safety, reliability, security and verification and validation of software is brought together in one discipline, software assurance. Organizationally, NASA has software assurance at each NASA center, a Software Assurance Manager at NASA Headquarters, a Software Assurance Technical Fellow (currently the same person as the SA Manager), and an Independent Verification and Validation Organization with its own facility. An umbrella risk mitigation strategy for safety and mission success assurance of NASA's software, software assurance covers a wide area and is better structured to address the dynamic changes in how software is developed, used, and managed, as well as it's increasingly complex functionality. Being flexible, risk based, and prepared for challenges in software at NASA is essential, especially as much of our software is unique for each mission.

  3. Mission Assurance Modeling and Simulation: A Cyber Security Roadmap

    Science.gov (United States)

    Gendron, Gerald; Roberts, David; Poole, Donold; Aquino, Anna

    2012-01-01

    This paper proposes a cyber security modeling and simulation roadmap to enhance mission assurance governance and establish risk reduction processes within constrained budgets. The term mission assurance stems from risk management work by Carnegie Mellon's Software Engineering Institute in the late 19905. By 2010, the Defense Information Systems Agency revised its cyber strategy and established the Program Executive Officer-Mission Assurance. This highlights a shift from simply protecting data to balancing risk and begins a necessary dialogue to establish a cyber security roadmap. The Military Operations Research Society has recommended a cyber community of practice, recognizing there are too few professionals having both cyber and analytic experience. The authors characterize the limited body of knowledge in this symbiotic relationship. This paper identifies operational and research requirements for mission assurance M&S supporting defense and homeland security. M&S techniques are needed for enterprise oversight of cyber investments, test and evaluation, policy, training, and analysis.

  4. High-Assurance Software: LDRD Report.

    Energy Technology Data Exchange (ETDEWEB)

    Hulette, Geoffrey Compton

    2014-06-01

    This report summarizes our work on methods for developing high-assurance digital systems. We present an approach for understanding and evaluating trust issues in digital systems, and for us- ing computer-checked proofs as a means for realizing this approach. We describe the theoretical background for programming with proofs based on the Curry-Howard correspondence, connect- ing the field of logic and proof theory to programs. We then describe a series of case studies, intended to demonstrate how this approach might be adopted in practice. In particular, our stud- ies elucidate some of the challenges that arise with this style of certified programming, including induction principles, generic programming, termination requirements, and reasoning over infinite state spaces.

  5. Quality Assurance Training Tracking (QATTS)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This is metadata documentation for the Quality Assurance Training Tracking System (QATTS) which tracks Quality Assurace training given by R7 QA staff to in-house...

  6. BUILDING "BRIDGES" WITH QUALITY ASSURANCE

    Science.gov (United States)

    The papr describes how, rather than building "bridges" across centuries, quality assurance (QA) personnel have the opportunity to build bridges across technical disciplines, between public and private organizations, and between different QA groups. As reviewers and auditors of a...

  7. Radiation Hardness Assurance for Space Systems

    Science.gov (United States)

    Poivey, Christian; Day, John H. (Technical Monitor)

    2002-01-01

    The space radiation environment can lead to extremely harsh operating conditions for on-board electronic box and systems. The characteristics of the radiation environment are highly dependent on the type of mission (date, duration and orbit). Radiation accelerates the aging of the electronic parts and material and can lead to a degradation of electrical performance; it can also create transient phenomena on parts. Such damage at the part level can induce damage or functional failure at electronic box, subsystem, and system levels. A rigorous methodology is needed to ensure that the radiation environment does not compromise the functionality and performance of the electronics during the system life. This methodology is called hardness assurance. It consists of those activities undertaken to ensure that the electronic piece parts placed in the space system perform to their design specifications after exposure to the space environment. It deals with system requirements, environmental definitions, part selection, part testing, shielding and radiation tolerant design. All these elements should play together in order to produce a system tolerant to.the radiation environment. An overview of the different steps of a space system hardness assurance program is given in section 2. In order to define the mission radiation specifications and compare these requirements to radiation test data, a detailed knowledge of the space environment and the corresponding electronic device failure mechanisms is required. The presentation by J. Mazur deals with the Earth space radiation environment as well as the internal environment of a spacecraft. The presentation by J. Schwank deals with ionization effects, and the presentation by T. Weatherford deals with Single particle Event Phenomena (SEP) in semiconductor devices and microcircuits. These three presentations provide more detailed background to complement the sections 3 and 4. Part selection and categorization are discussed in section

  8. Implementation of a quality assurance program for computerized treatment planning systems according to TRS 430; Implantacao de um programa de controle de qualidade para sistemas de planejamento de tratamento computadorizados de acordo com o TRS 430

    Energy Technology Data Exchange (ETDEWEB)

    Camargo, Priscilla Roberta Tavares Leite

    2006-07-01

    This work presents the guidelines and necessary tests tom implement a quality assurance program for Eclipse 7.3.10 from Varian at Hospital das Clinicas, Sao Paulo University School of Medicine - Brazil, in accordance with the new IAEA publication TRS 430. The recommended tests for the TRS 430 air mainly classified into acceptance tests, commissioning (dosimetric and non-dosimetric tests), and routine tests. The IAEA document's recommendations are being implemented at the hospital for two Varian linear accelerators - Clinac 600C e Clinac 2100C. The acceptance tests verified 'hardware', integration of network systems, data transfer and 'software' parameters. The results obtained are in a good agreement with the manufacturer's specifications. Measurements of absolute dose in several set-ups were made for the commissioning dosimetric tests. These data were compared to the absolute doses determined by the TPS. The great majority of the tests showed 90% to 80% of the analyzed data in acceptance levels, with a good agreement between the experimental data and the data determined by the TPS. Only settings with asymmetric fields presented significant discords, showing the need for a more detailed inquiry for these settings. The non-dosimetric commissioning tests have also presented excellent results, with virtually all the system tools and general performance in compliance with TRS 430. The acceptance criteria have been applied for a comparison between the values of MUs generated by TPS and the calculated manually ones. The beams have been characterized for Eclipse with data transferred from CadPlan and with data from recommissioning of accelerators, so for these tests it was found a difference of at least 3% for the conformal field shape for the data originated in the beams of recommissioning and at least 4% for the data proceeded from CadPlan. The tolerance level established by TRS 430 for this setting was 3%. (author)

  9. Use of EORTC Target Definition Guidelines for Dose-Intensified Salvage Radiation Therapy for Recurrent Prostate Cancer: Results of the Quality Assurance Program of the Randomized Trial SAKK 09/10

    Energy Technology Data Exchange (ETDEWEB)

    Sassowsky, Manfred [Department of Radiation Oncology and Division of Medical Radiation Physics, Bern University Hospital (Switzerland); Gut, Philipp [Department of Radiation Oncology Kantonsspital Luzern (Switzerland); Hölscher, Tobias [University Hospital Dresden (Germany); Hildebrandt, Guido [University Hospital Rostock (Germany); Müller, Arndt-Christian [University Hospital Tübingen (Germany); Najafi, Yousef [University Hospital Zürich (Switzerland); Kohler, Götz [University Hospital Basel (Switzerland); Kranzbühler, Helmut [Stadtspital Triemli, Zürich (Switzerland); Guckenberger, Matthias [University Hospital Würzburg (Germany); Zwahlen, Daniel R. [Kantonsspital Graubünden, Chur (Switzerland); Azinwi, Ngwa C. [Istituto Oncologico della Svizzera Italiana, Bellinzona (Switzerland); Plasswilm, Ludwig [Kantonsspital St. Gallen (Switzerland); Takacs, Istvan [Kantonsspital Aarau (Switzerland); Reuter, Christiane [Kantonsspital Münsterlingen (Switzerland); Sumila, Marcin [Hirslanden Hospital Group, Zürich (Switzerland); Manser, Peter [Department of Radiation Oncology and Division of Medical Radiation Physics, Bern University Hospital (Switzerland); Ost, Piet [Ghent University Hospital (Belgium); Böhmer, Dirk [Charité University Medicine, Berlin (Germany); Pilop, Christiane [Swiss Group for Clinical Cancer Research, Coordinating Center, Bern (Switzerland); Aebersold, Daniel M. [Department of Radiation Oncology and Division of Medical Radiation Physics, Bern University Hospital (Switzerland); and others

    2013-11-01

    Purpose: Different international target volume delineation guidelines exist and different treatment techniques are available for salvage radiation therapy (RT) for recurrent prostate cancer, but less is known regarding their respective applicability in clinical practice. Methods and Materials: A randomized phase III trial testing 64 Gy vs 70 Gy salvage RT was accompanied by an intense quality assurance program including a site-specific and study-specific questionnaire and a dummy run (DR). Target volume delineation was performed according to the European Organisation for the Research and Treatment of Cancer guidelines, and a DR-based treatment plan was established for 70 Gy. Major and minor protocol deviations were noted, interobserver agreement of delineated target contours was assessed, and dose-volume histogram (DVH) parameters of different treatment techniques were compared. Results: Thirty European centers participated, 43% of which were using 3-dimensional conformal RT (3D-CRT), with the remaining centers using intensity modulated RT (IMRT) or volumetric modulated arc technique (VMAT). The first submitted version of the DR contained major deviations in 21 of 30 (70%) centers, mostly caused by inappropriately defined or lack of prostate bed (PB). All but 5 centers completed the DR successfully with their second submitted version. The interobserver agreement of the PB was moderate and was improved by the DR review, as indicated by an increased κ value (0.59 vs 0.55), mean sensitivity (0.64 vs 0.58), volume of total agreement (3.9 vs 3.3 cm{sup 3}), and decrease in the union volume (79.3 vs 84.2 cm{sup 3}). Rectal and bladder wall DVH parameters of IMRT and VMAT vs 3D-CRT plans were not significantly different. Conclusions: The interobserver agreement of PB delineation was moderate but was improved by the DR. Major deviations could be identified for the majority of centers. The DR has improved the acquaintance of the participating centers with the trial

  10. Quality assurance in production and use of special form radioactive material - focal points in BAM approvals

    Energy Technology Data Exchange (ETDEWEB)

    Rolle, A.; Buhlemann, L. [Bundesanstalt fuer Materialforschung und -pruefung (BAM), Berlin (Germany)

    2004-07-01

    BAM as the competent authority for approval of special form radioactive material attaches great importance to a detailed audit of the required quality assurance programs for design, manufacture, testing, documentation, use, maintenance and inspection. Applicants have to submit, together with application documentation information on general arrangements for quality assurance, as well as on quality assurance in production and in operation. Fields where BAM has often found deficiencies are leak test methods, weld seam quality and the safety level after use.

  11. Assurance Cases for Design Analysis of Complex System of Systems Software

    Science.gov (United States)

    2016-06-13

    2009 Carnegie Mellon University Assurance Cases for Design Analysis of Complex System of Systems Software Presented at AIAA Infotech@Aerospace...Conference Software Assurance Session 8 April 2009 Stephen Blanchette, Jr. Report Documentation Page Form ApprovedOMB No. 0704-0188 Public reporting...TITLE AND SUBTITLE Assurance Cases for Design Analysis of Complex System of Systems Software 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM

  12. Thoughts on Internal and External Quality Assurance

    Science.gov (United States)

    Zhang, Jianxin

    2012-01-01

    Quality assurance of higher education is made up of two parts: internal quality assurance (IQA) and external quality assurance (EQA). Both belong to a union of the coexistence and balance of yin and yang. But in reality there exists a paradox of "confusion of quality assurance (QA) subject consciousness, singularity of social QA and lack of QA…

  13. Highly Integrated Quality Assurance – An Empirical Case

    Energy Technology Data Exchange (ETDEWEB)

    Drake Kirkham; Amy Powell; Lucas Rich

    2011-02-01

    Highly Integrated Quality Assurance – An Empirical Case Drake Kirkham1, Amy Powell2, Lucas Rich3 1Quality Manager, Radioisotope Power Systems (RPS) Program, Idaho National Laboratory, P.O. Box 1625 M/S 6122, Idaho Falls, ID 83415-6122 2Quality Engineer, RPS Program, Idaho National Laboratory 3Quality Engineer, RPS Program, Idaho National Laboratory Contact: Voice: (208) 533-7550 Email: Drake.Kirkham@inl.gov Abstract. The Radioisotope Power Systems Program of the Idaho National Laboratory makes an empirical case for a highly integrated Quality Assurance function pertaining to the preparation, assembly, testing, storage and transportation of 238Pu fueled radioisotope thermoelectric generators. Case data represents multiple campaigns including the Pluto/New Horizons mission, the Mars Science Laboratory mission in progress, and other related projects. Traditional Quality Assurance models would attempt to reduce cost by minimizing the role of dedicated Quality Assurance personnel in favor of either functional tasking or peer-based implementations. Highly integrated Quality Assurance adds value by placing trained quality inspectors on the production floor side-by-side with nuclear facility operators to enhance team dynamics, reduce inspection wait time, and provide for immediate, independent feedback. Value is also added by maintaining dedicated Quality Engineers to provide for rapid identification and resolution of corrective action, enhanced and expedited supply chain interfaces, improved bonded storage capabilities, and technical resources for requirements management including data package development and Certificates of Inspection. A broad examination of cost-benefit indicates highly integrated Quality Assurance can reduce cost through the mitigation of risk and reducing administrative burden thereby allowing engineers to be engineers, nuclear operators to be nuclear operators, and the cross-functional team to operate more efficiently. Applicability of this case

  14. Assurance of Learning and Study Abroad: A Case Study

    Science.gov (United States)

    Rexeisen, Richard J.; Al-Khatib, Jamal

    2009-01-01

    Most academic programs are now held accountable for measuring student-learning outcomes. This article reports the results of an assurance of learning (AOL) project designed to measure the impact of study abroad on the development of ethical reasoning, intercultural sensitivity, and environmental attitudes. The Association to Advance Collegiate…

  15. Total Dose Hardness Assurance. Volume I. Identification of Techniques.

    Science.gov (United States)

    1980-02-01

    under Contract F29601-78-C-0022. The project officer for the Air Force was Mr. Roe J. Maier. The program manager and principal investigator for BDM was...Assurance Techniques," AFWL-TR-73-134, 3 Volumes, January 1974. 44. Bruncke, W. C. et al. " Tecniques for Screening Bipolar Transistor Degradation Due to

  16. Quality Assurance: One School's Response.

    Science.gov (United States)

    Wittemann, K. Joseph

    1990-01-01

    Since 1987, the Virginia Commonwealth University School of Dentistry has established a system of committee responsibilities for quality assurance, involving the committees for clinical affairs, academic performance, safety and therapeutics, and a council composed largely of department chairs. Additional review of procedures and records management…

  17. Redefining and expanding quality assurance.

    Science.gov (United States)

    Robins, J L

    1992-12-01

    To meet the current standards of excellence necessary for blood establishments, we have learned from industry that a movement toward organization-wide quality assurance/total quality management must be made. Everyone in the organization must accept responsibility for participating in providing the highest quality products and services. Quality must be built into processes and design systems to support these quality processes. Quality assurance has been redefined to include a quality planning function described as the most effective way of designing quality into processes. A formalized quality planning process must be part of quality assurance. Continuous quality improvement has been identified as the strategy every blood establishment must support while striving for error-free processing as the long-term objective. The auditing process has been realigned to support and facilitate this same objective. Implementing organization-wide quality assurance/total quality management is one proven plan for guaranteeing the quality of the 20 million products that are transfused into 4 million patients each year and for moving toward the new order.

  18. Mission Assurance: Issues and Challenges

    Science.gov (United States)

    2010-07-15

    JFQ), Summer 1995. [9] Alberts , C.J. & Dorofee, A.J., “Mission Assurance Analysis Protocol (MAAP): Assessing Risk in Complex Environments... CAMUS : Automatically Mapping Cyber Assets to Missions and Users,” Proc. of the 2010 Military Communications Conference (MILCOM 2009), 2009. [23

  19. Management of government quality assurance functions for NASA contracts

    Science.gov (United States)

    1993-01-01

    This handbook sets forth requirements for NASA direction and management of government quality assurance functions performed for NASA contracts and is applicable to all NASA installations. These requirements will standardize management to provide the minimum oversight and effective use of resources. This handbook implements Federal Acquisition Regulation (FAR) Part 46, NASA FAR Supplement 18-46, Quality Assurance, and NMI 7410.1. Achievement of established quality and reliability goals at all levels is essential to the success of NASA programs. Active participation by NASA and other agency quality assurance personnel in all phases of contract operations, including precontract activity, will assist in the economic and timely achievement of program results. This involves broad participation in design, development, procurement, inspection, testing, and preventive and corrective actions. Consequently, government, as well as industry, must place strong emphasis on the accomplishment of all functions having a significant bearing on quality and reliability from program initiation through end-use of supplies and services produced. For purposes of implementing NASA and other agency agreements, and to provide for uniformity and consistency, the terminology and definitions prescribed herein and in a future handbook shall be utilized for all NASA quality assurance delegations and subsequent redelegations.

  20. NIF Projects Controls and Information Systems Software Quality Assurance Plan

    Energy Technology Data Exchange (ETDEWEB)

    Fishler, B

    2011-03-18

    Quality achievement for the National Ignition Facility (NIF) and the National Ignition Campaign (NIC) is the responsibility of the NIF Projects line organization as described in the NIF and Photon Science Directorate Quality Assurance Plan (NIF QA Plan). This Software Quality Assurance Plan (SQAP) is subordinate to the NIF QA Plan and establishes quality assurance (QA) activities for the software subsystems within Controls and Information Systems (CIS). This SQAP implements an activity level software quality assurance plan for NIF Projects as required by the LLNL Institutional Software Quality Assurance Program (ISQAP). Planned QA activities help achieve, assess, and maintain appropriate quality of software developed and/or acquired for control systems, shot data systems, laser performance modeling systems, business applications, industrial control and safety systems, and information technology systems. The objective of this SQAP is to ensure that appropriate controls are developed and implemented for management planning, work execution, and quality assessment of the CIS organization's software activities. The CIS line organization places special QA emphasis on rigorous configuration control, change management, testing, and issue tracking to help achieve its quality goals.

  1. Quality assurance for environmental analytical chemistry: 1980

    Energy Technology Data Exchange (ETDEWEB)

    Gladney, E.S.; Goode, W.E.; Perrin, D.R.; Burns, C.E.

    1981-09-01

    The continuing quality assurance effort by the Environmental Surveillance Group is presented. Included are all standard materials now in use, their consensus or certified concentrations, quality control charts, and all quality assurance measurements made by H-8 during 1980.

  2. Quality assurance - how to involve the employees

    DEFF Research Database (Denmark)

    Jørgensen, Michael Søgaard

    1996-01-01

    An overview of strategies for involvement of employees in quality assurance developement and implementation.......An overview of strategies for involvement of employees in quality assurance developement and implementation....

  3. 40 CFR 31.45 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Quality assurance. 31.45 Section 31.45... Requirements Reports, Records, Retention, and Enforcement § 31.45 Quality assurance. If the grantee's project... quality assurance practices consisting of policies, procedures, specifications, standards,...

  4. 40 CFR 30.54 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Quality assurance. 30.54 Section 30.54... NON-PROFIT ORGANIZATIONS Post-Award Requirements Reports and Records § 30.54 Quality assurance. If the... data generation, the grantee shall develop and implement quality assurance practices consisting...

  5. Power Supplies for Space Systems Quality Assurance by Sandia Laboratories

    Science.gov (United States)

    Hannigan, R. L.; Harnar, R. R.

    1976-07-01

    The Sandia Laboratories` participation in Quality Assurance programs for Radioisotopic Thermoelectric Generators which have been used in space systems over the past 10 years is summarized. Basic elements of this QA program are briefly described and recognition of assistance from other Sandia organizations is included. Descriptions of the various systems for which Sandia has had the QA responsibility are presented, including SNAP 19 (Nimbus, Pioneer, Viking), SNAP 27 (Apollo), Transit, Multi Hundred Watt (LES 8/9 and MJS), and a new program, High Performance Generator Mod 3. The outlook for Sandia participation in RTG programs for the next several years is noted.

  6. Quality assurance and quality control in clinical cytogenetics.

    Science.gov (United States)

    Mikhail, Fady M; Watson, Michael S

    2014-07-14

    The goal of any clinical laboratory should be to provide patients with the most accurate test results possible. This is accomplished through various overlapping programs that continuously monitor and optimize all aspects of a test, including decisions by the laboratory to offer a test, the decision of providers to request the test, the testing itself, and the reporting of results to the referral source and patient. The levels at which test performance and accuracy can be optimized are encompassed under quality control (QC) and quality assurance (QA). The monitoring of QC and QA problems allows for the integration of these parameters into a total quality management program. This unit reviews QC and QA guidelines, in addition to discussing how to establish a quality assurance program.

  7. Requirement Assurance: A Verification Process

    Science.gov (United States)

    Alexander, Michael G.

    2011-01-01

    Requirement Assurance is an act of requirement verification which assures the stakeholder or customer that a product requirement has produced its "as realized product" and has been verified with conclusive evidence. Product requirement verification answers the question, "did the product meet the stated specification, performance, or design documentation?". In order to ensure the system was built correctly, the practicing system engineer must verify each product requirement using verification methods of inspection, analysis, demonstration, or test. The products of these methods are the "verification artifacts" or "closure artifacts" which are the objective evidence needed to prove the product requirements meet the verification success criteria. Institutional direction is given to the System Engineer in NPR 7123.1A NASA Systems Engineering Processes and Requirements with regards to the requirement verification process. In response, the verification methodology offered in this report meets both the institutional process and requirement verification best practices.

  8. Quality assurance of qualitative analysis

    DEFF Research Database (Denmark)

    Ríos, Ángel; Barceló, Damiá; Buydens, Lutgarde

    2003-01-01

    The European Commission has supported the G6MA-CT-2000-01012 project on "Metrology of Qualitative Chemical Analysis" (MEQUALAN), which was developed during 2000-2002. The final result is a document produced by a group of scientists with expertise in different areas of chemical analysis, metrology......: traceability, reliability (uncertainty), validation, and internal/external quality control for qualitative methods.......The European Commission has supported the G6MA-CT-2000-01012 project on "Metrology of Qualitative Chemical Analysis" (MEQUALAN), which was developed during 2000-2002. The final result is a document produced by a group of scientists with expertise in different areas of chemical analysis, metrology...... and quality assurance. One important part of this document deals, therefore, with aspects involved in analytical quality assurance of qualitative analysis. This article shows the main conclusions reported in the document referring to the implementation of quality principles in qualitative analysis...

  9. 中国消除新生儿破伤风现场认证调查%Validation on the elimination of neonatal tetanus programs through Lot Quality Assurance-Cluster Sample Survey in China

    Institute of Scientific and Technical Information of China (English)

    樊朝阳; 关宏岩; 罗树生; 左树岩; 朱徐; 夏伟; 罗会明; 徐晓超; 曹彬

    2014-01-01

    Objective Field surveys were performed under WHO recommended validation procedures,using the Lot Quality Assurance-Cluster Sample (LQA-CS) method to validate the elimination status regarding neonatal tetanus in China.Methods LQA-CS surveys were conducted in two areas under the highest risk of neonatal tetanus-Jiangrnen prefecture in Guangdong and Hechi in Guangxi.Random sampling method was conducted on 96 survey clusters in each prefecture with 12 eligible live births (live birth born one year before the survey) for each cluster,by trained investigators.Results There were 1 153 eligible live births from 23 465 families surveyed in Jiangmen and 1 152 eligible live births from 21 623 families being studied in Hechi.All the indices on quality control were strictly followed.There was no neonatal tetanus case which met the criteria of neonatal elimination found in either of the areas.Data showed that neonatal tetanus had been eliminated in both Jiangmen and Hechi cities.Conclusion Since both Jiangmen and Hechi were cities having the highest-risk in China,it was most likely that neonatal tetanus had also been eliminated in other prefectures at lower risk.Elimination programs on MNT was therefore considered validate in China when the study was carried out.However,the achievements needed to be maintained.%目的 现场调查认证中国是否消除新生儿破伤风(NT).方法 采用批质量保证-群抽样(LQA-CS)方法,现场入户调查中国NT发病风险最高的广东省江门市和广西壮族自治区河池市各随机抽取的96个调查点、每个点调查12名符合条件(调查前一年内出生)活产儿的NT发病情况.结果 江门市共调查23 465户家庭、1 153名合格活产儿,河池市共调查21 623户家庭、1 152名合格活产儿.现场认证调查所设立的各项质控指标均符合要求.调查中两市均未发现因NT引起的死亡或者住院病例,已达到消除NT的标准,结合现场调查各项可靠质控指标,也

  10. Laboratory testing for von Willebrand's disease: an assessment of current diagnostic practice and efficacy by means of a multi-laboratory survey. RCPA Quality Assurance Program (QAP) in Haematology Haemostasis Scientific Advisory Panel.

    Science.gov (United States)

    Favaloro, E J; Smith, J; Petinos, P; Hertzberg, M; Koutts, J

    1999-10-01

    We report an evaluation of current laboratory practice for the diagnosis of von Willebrand's disease (VWD) by means of a multilaboratory survey. This assessment was undertaken with the RCPA Quality Assurance Program (QAP) in Haematology, which covers a wide geographic area encompassing Australia, New Zealand and Asia. A total of 25 laboratories actively involved in testing for VWD were selected to participate in a sample testing assessment exercise. Samples comprised 10 plasmas: (i) a normal plasma pool (in duplicate), (ii) this pool diluted to 50% (in duplicate), (iii) a normal individual (X1), (iv) severe Type 1 VWD (X1), (v) Type 2B VWD (x2 unrelated donors), (vi) Type 3 VWD (x1), (vii) Type 2A VWD (x1). Laboratories were asked to perform all tests available to them in order to establish a laboratory diagnosis of VWD, and then to comment on the possibility or otherwise of VWD. Overall findings indicated a wide variation in test practice, in the effectiveness of various test procedures in detecting VWD, and in the ability of various composite test panels to identify type 2 VWD subtypes. Firstly, while all laboratories (n = 25) performed tests for FVIII:C activity, von Willebrand factor 'antigen' (VWF:Ag) and a functional VWF assay [using the ristocetin cofactor assay (VWF:RCo; n = 23) and/or the collagen binding assay (VWF:CBA; n = 12)], only three laboratories carried out VWF:Multimer analysis. Secondly, for the three quantitative VWF assays, 10/25 (40%) laboratories performed all three, whereas 15/25 (60%) performed only two [VWF:Ag and VWF:RCo (n = 13); VWF:Ag and VWF:CBA (n = 2)]. Thirdly, a variety of assay methodologies were evident for VWF:Ag [ELISA, electro-immuno diffusion (EID), latex immuno-assay (LIA), and VIDAS assay] and VWF:RCo (platelet agglutination/'aggregometry' and a 'functional VWF:RCo-alternative' ELISA assay). Between method analysis for the quantitative VWF assays showed that the VWF:RCo yielded the greatest degree of inter

  11. Radiation Hardness Assurance (RHA) for Space Systems

    Science.gov (United States)

    Poivey, Christian; Buchner, Stephen

    2007-01-01

    This presentation discusses radiation hardness assurance (RHA) for space systems, providing both the programmatic aspects of RHA and the RHA procedure. RHA consists of all activities undertaken to ensure that the electronics and materials of a space system perform to their design specifications after exposure to the space radiation environment. RHA also pertains to environment definition, part selection, part testing, spacecraft layout, radiation tolerant design, and mission/system/subsystems requirements. RHA procedure consists of establishing mission requirements, defining and evaluating the radiation hazard, selecting and categorizing the appropriate parts, and evaluating circuit response to hazard. The RHA approach is based on risk management and is confined only to parts, it includes spacecraft layout, system/subsystem/circuit design, and system requirements and system operations. RHA should be taken into account in the early phases of a program including the proposal and feasibility analysis phases.

  12. [Quality and quality assurance, a European problem].

    Science.gov (United States)

    Schmitt, H

    1994-01-01

    The problem of quality and quality assurance for the free exchange of blood and blood products in Europe is discussed. The background of all discussion of quality is the categorical theory of Aristoteles. The philosophical basis is described. The fundamental law of the daily work of a blood center has to be a philosophy of quality which depends on the sociodemographic situation in the region. This basic varies from country to country in Europe. The importance of the supranational bodies in Europe is mentioned. The weightness of the Code of Ethics is discussed. Virus safety, purity and validity of blood and blood products are described as parameters of the quality aspects. Finally it is confirmed that a well running blood program is a multicategorical problem.

  13. SAPHIRE 8 Volume 6 - Quality Assurance

    Energy Technology Data Exchange (ETDEWEB)

    C. L. Smith; R. Nims; K. J. Kvarfordt

    2011-03-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) Version 8 is a software application developed for performing a complete probabilistic risk assessment using a personal computer running the Microsoft Windows™ operating system. SAPHIRE 8 is funded by the U.S. Nuclear Regulatory Commission (NRC). The role of the INL in this project is that of software developer and tester. This development takes place using formal software development procedures and is subject to quality assurance (QA) processes. The purpose of this document is to describe how the SAPHIRE software QA is performed for Version 8, what constitutes its parts, and limitations of those processes. In addition, this document describes the Independent Verification and Validation that was conducted for Version 8 as part of an overall QA process.

  14. Developing a Service Oriented Process Management System for University Quality Assurance

    Directory of Open Access Journals (Sweden)

    Prof. Dr. Taher Tawfek Hamza

    2010-01-01

    Full Text Available Quality assurance in universities is an increasing interest in quality and standards reflecting both the growth of higher education and its cost. Institutions should have a policy and associated processes for the assurance of the quality and standards of their programs. To achieve this, institutions should develop and implement a strategy for the continuous enhancement of quality. Formal policies and processes provide a framework within which higher education institutions can develop and monitor the effectiveness of their quality assurance systems.Process management is most suitable model for automating quality assurance in university. Process management isabout modeling, design, execution, and monitoring. In this paper we describe quality assurance process managementsystem built on service oriented architecture (SOA. SOA has been chosen for the transparently, scalability, andIntegrity of this architecture.

  15. Underground Test Area Quality Assurance Project Plan Nevada National Security Site, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Irene Farnham

    2011-05-01

    This Quality Assurance Project Plan (QAPP) provides the overall quality assurance (QA) program requirements and general quality practices to be applied to the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office (NNSA/NSO) Underground Test Area (UGTA) Sub-Project (hereafter the Sub-Project) activities. The requirements in this QAPP are consistent with DOE Order 414.1C, Quality Assurance (DOE, 2005); U.S. Environmental Protection Agency (EPA) Guidance for Quality Assurance Project Plans for Modeling (EPA, 2002); and EPA Guidance on the Development, Evaluation, and Application of Environmental Models (EPA, 2009). The QAPP Revision 0 supersedes DOE--341, Underground Test Area Quality Assurance Project Plan, Nevada Test Site, Nevada, Revision 4.

  16. Wingspread Conference on Quality Assurance in Teacher Education (Racine, Michigan, May 11-13, 1986).

    Science.gov (United States)

    Barr, Robert D., Ed.; Schalock, H. Del, Ed.

    A small group of influential educators participated in a Wingspread Conference to discuss the topic of teacher warranty programs. While each of the warranty programs described at Wingspread was distinctive, there were a number of features that all seemed to have in common: (1) teacher warranty programs are a form of quality assurance for…

  17. Radiation Hardness Assurance (RHA) Guideline

    Science.gov (United States)

    Campola, Michael J.

    2016-01-01

    Radiation Hardness Assurance (RHA) consists of all activities undertaken to ensure that the electronics and materials of a space system perform to their design specifications after exposure to the mission space environment. The subset of interests for NEPP and the REAG, are EEE parts. It is important to register that all of these undertakings are in a feedback loop and require constant iteration and updating throughout the mission life. More detail can be found in the reference materials on applicable test data for usage on parts.

  18. Performance assurance for IT systems

    CERN Document Server

    King, Brian

    2004-01-01

    INDIVIDUAL AREAS OF INTERESTPreparing for the ChallengeAbstractIntroductionIn the BeginningThe Need to Address New ApplicationsDefinition of PerformanceThe Required SkillsPerformance Assurance Within a Project LifecycleSummaryCaveat Emptor (Let the Buyer Beware)AbstractSoftware Product LifecycleHardware Product LifecycleMarketingTechnical Reviews of ProductsLies, Damned Lies and BenchmarksAbstractIntroductionIndustry BenchmarksVendor BenchmarksIndependent BenchmarkingIn-House Benchmarking""Tricks of the Trade""Using Benchmarks Non-Functional Requirements and SolutionsAbstractIntroductionThe Pr

  19. Information security assurance lifecycle research

    Institute of Scientific and Technical Information of China (English)

    XIE Cheng-shan; XUJIA Gu-yue; WANG Li

    2007-01-01

    This article proposes that problems of information security are mainly caused by the ineffective integration of people, operation, and technology, and not merely by the poor use of technology. Based on the information lifecycle, a model of the information security assurance lifecycle is presented. The crucial parts of the model are further discussed, with the information risk value and protect level, and the solution in each step of the lifecycle is presented with an ensured information risk level, in term of the integration of people, operation, and technology.

  20. Legacy Management CERCLA Sites. Quality Assurance Project Plan

    Energy Technology Data Exchange (ETDEWEB)

    Riddle, Donna L.

    2007-05-03

    S.M. Stoller Corporation is the contractor for the Technical Assistance Contract (TAC) for the U.S. Department of Energy (DOE) Office of Legacy Management (LM) operations. Stoller employs a management system that applies to all programs, projects, and business management systems funded through DOE-LM task orders. The management system incorporates the philosophy, policies, and requirements of health and safety, environmental compliance, and quality assurance (QA) in all aspects of project planning and implementation. Health and safety requirements are documented in the Health and Safety Manual (STO 2), the Radiological Control Manual (STO 3), the Integrated Safety Management System Description (STO 10), and the Drilling Health and Safety Requirements (STO 14). Environmental compliance policy and requirements are documented in the Environmental Management Program Implementation Manual (STO 11). The QA Program is documented in the Quality Assurance Manual (STO 1). The QA Manual (STO 1) implements the specific requirements and philosophy of DOE Order 414.1C, Quality Assurance. This manual also includes the requirements of other standards that are regularly imposed by customers, regulators, or other DOE orders. Title 10 Code of Federal Regulations Part 830, “Quality Assurance Requirements,” ANSI/ASQC E4-2004, “Quality Systems for Environmental Data and Technology Programs – Requirements with Guidance for Use,” and ISO 14001-2004, “Environmental Management Systems,” have been included. These standards are similar in content. The intent of the QA Manual (STO 1) is to provide a QA management system that incorporates the requirements and philosophy of DOE and other customers within the QA Manual. Criterion 1, “Quality Assurance Program,” identifies the fundamental requirements for establishing and implementing the QA management system; QA Instruction (QAI) 1.1, “QA Program Implementation,” identifies the TAC organizations that have responsibility for

  1. Static and Dynamic Quality Assurance by Aspect Oriented Techniques

    CERN Document Server

    Knabe, Christoph

    2010-01-01

    The overall goal of the described research project was to create applicable quality assurance patterns for Java software systems using the aspect-oriented programming language extension AspectJ 5. We tried to develop aspects to check static quality criteria as a variable mutator convention and architectural layering rules. We successfully developed aspects for automating the following dynamic quality criteria: Parameterized Exception Chaining, Comfortable Declaration of Parameterized Exceptions, Not-Null Checking of Reference Variables.

  2. Agile Software Development in Defense Acquisition: A Mission Assurance Perspective

    Science.gov (United States)

    2012-03-23

    Process-neutral • Software mission assurance does not assume any particular software development methodology , programming language, or tools • Mission...24 Source: [Guano 2008] ^ AER0SPACE The Life Cycle Perspective of Agile Software Development 26 (A) AEROSPACE Agile Life Cycle Example: Scrum ...Daily Scrum Meeting Monthly Sprint Meeting Scrum is a lean approach to software development - Simple "inspect and adapt management framework

  3. Analysis on the Influencing Factors of Food Enterprises Implementing Quality Assurance Program Based on the Theory of Planned Behavior%基于计划行为理论的食品企业实施质量保证项目影响因素分析

    Institute of Scientific and Technical Information of China (English)

    张君; 姜启军

    2015-01-01

    文章通过对上海市219家食品加工制造企业的调研,运用计划行为理论,从获利态度、主观规范和知觉行为控制三方面分析食品企业实施质量保证项目的影响因素,构建 Logistic 回归模型,进行实证研究。研究结果表明,知觉行为控制对质量保证项目实施具有显著负向影响,企业资源禀赋越差、内部运营障碍越大,越不利于质量保证项目的实施;主观规范有显著正向影响,外部不确定性越大,越有利于质量保证项目的实施;获利态度对项目的实施无显著影响。%By the survey of 219 food processing and manufacturing enterprises in Shanghai,this paper constructs a Logistic re-gression model based on the theory of planned behavior and conducts a empirical study on the influencing factors of food enterpri-ses implementing quality assurance program from profitability attitude,subjective norm and perceived behavioral control.The re-sult shows that perceived behavior control has significant negative influence on quality assurance program implementation.The worse the enterprise resources endowment and the greater the obstacle of enterprise internal operation are,the more difficult the implementation of quality assurance program is.Subjective norm has significant positive influence,and greater external uncer-tainty is conducive to the program implementation.However,profitability attitude has no significant effect on it.

  4. Quality assurance in diagnostic ultrasound

    Energy Technology Data Exchange (ETDEWEB)

    Sipilae, Outi, E-mail: outi.sipila@hus.fi [HUS Helsinki Medical Imaging Center, Helsinki University Central Hospital, P.O. Box 340, 00029 HUS (Finland); Mannila, Vilma, E-mail: vilma.mannila@hus.fi [HUS Helsinki Medical Imaging Center, Helsinki University Central Hospital, P.O. Box 340, 00029 HUS (Finland); Department of Physics, University of Helsinki, P.O. Box 64, 00014 Helsinki University (Finland); Vartiainen, Eija, E-mail: eija.vartiainen@hus.fi [HUS Helsinki Medical Imaging Center, Helsinki University Central Hospital, P.O. Box 750, 00029 HUS (Finland)

    2011-11-15

    Objective: To setup a practical ultrasound quality assurance protocol in a large radiological center, results from transducer tests, phantom measurements and visual checks for physical faults were compared. Materials and methods: Altogether 151 transducers from 54 ultrasound scanners, from seven different manufacturers, were tested with a Sonora FirstCall aPerio{sup TM} system (Sonora Medical Systems, Inc., Longmont, CO, USA) to detect non-functional elements. Phantom measurements using a CIRS General Purpose Phantom Model 040 (CIRS Tissue Simulation and Phantom Technology, VA, USA) were available for 135 transducers. The transducers and scanners were also checked visually for physical faults. The percentages of defective findings in these tests were computed. Results: Defective results in the FirstCall tests were found in 17% of the 151 transducers, and in 16% of the 135 transducers. Defective image quality resulted with 15% of the transducers, and 25% of the transducers had a physical flaw. In 16% of the scanners, a physical fault elsewhere than in the transducer was found. Seven percent of the transducers had a concurrent defective result both in the FirstCall test and in the phantom measurements, 8% in the FirstCall test and in the visual check, 4% in the phantom measurements and in the visual check, and 2% in all three tests. Conclusion: The tested methods produced partly complementary results and seemed all to be necessary. Thus a quality assurance protocol is forced to be rather labored, and therefore the benefits and costs must be closely followed.

  5. Quality assurance in the ambulatory care setting.

    Science.gov (United States)

    Tyler, R D

    1989-01-01

    One of the most utilitarian developments in the field of quality assurance in health care has been the introduction of industrial concepts of quality management. These concepts, coupled with buyer demand for accountability, are bringing new perspectives to health care quality assurance. These perspectives provide a new view of quality assurance as a major responsibility and strategic opportunity for management; a competitive and marketable commodity; and a method of improving safety, effectiveness, and satisfaction with medical care.

  6. Assessing the Need for an Organization Structure for Quality Assurance, Womack Army Community Hospital, Fort Bragg, North Carolina

    Science.gov (United States)

    1983-08-01

    history who have stressed the importance of quality assurance in health care are Florence Nightingale , Dr. Abraham Flexner, Dr. Codman, and Dr...Donabedian. Florence Nightingale helped to lay the groundwork for quality assurance programs in the 1860s by advocating a uniform system for collecting and

  7. Specification Improvement Through Analysis of Proof Structure (SITAPS): High Assurance Software Development

    Science.gov (United States)

    2016-02-01

    SPECIFICATION IMPROVEMENT THROUGH ANALYSIS OF PROOF STRUCTURE (SITAPS): HIGH ASSURANCE SOFTWARE DEVELOPMENT BAE SYSTEMS FEBRUARY...ANALYSIS OF PROOF STRUCTURE (SITAPS): HIGH ASSURANCE SOFTWARE DEVELOPMENT 5a. CONTRACT NUMBER FA8750-13-C-0240 5b. GRANT NUMBER N/A 5c. PROGRAM...General adoption of these techniques has had limited penetration in the software development community. Two interrelated causes may account for

  8. Handbook of software quality assurance techniques applicable to the nuclear industry

    Energy Technology Data Exchange (ETDEWEB)

    Bryant, J.L.; Wilburn, N.P.

    1987-08-01

    Pacific Northwest Laboratory is conducting a research project to recommend good engineering practices in the application of 10 CFR 50, Appendix B requirements to assure quality in the development and use of computer software for the design and operation of nuclear power plants for NRC and industry. This handbook defines the content of a software quality assurance program by enumerating the techniques applicable. Definitions, descriptions, and references where further information may be obtained are provided for each topic.

  9. Professionalism, Profession and Quality Assurance Practitioners in External Quality Assurance Agencies in Higher Education

    Science.gov (United States)

    Cheung, Jordan C. M.

    2015-01-01

    This article seeks to spark a dialectic discussion on the establishment of a set of professional competencies for quality assurance practitioners who serve in external quality assurance agencies in higher education. Such a need is identified due to the shortage of relevant and sufficient coverage in the quality assurance literature. To…

  10. Quality assurance and product quality

    Energy Technology Data Exchange (ETDEWEB)

    Lacroix, D.; Bastiani, P. de [COGEMA Logistics (AREVA Group) (France)

    2004-07-01

    The basic quality assurance requirements have to be completed by means that are oriented towards the quality of products; in COGEMA LOGISTICS our approach is based on four principles: 1) an integrated management system: Quality, health and safety, environment 2) an organization based on the responsibility of all actors, trust and transparency 3) a methodical approach to continuously improve the methods that are employed to achieve quality: -process management -corrective and preventive actions -self assessments and various surveys 4) but at the same time strong procedures for control and monitoring of all activities: -technical and quality audits (external and internal) -at source inspections -engineering activities inspections This performance-based approach is necessary to guaranty the effectiveness of the traditional formal QA means.

  11. Quality assurance and statistical control

    DEFF Research Database (Denmark)

    Heydorn, K.

    1991-01-01

    In scientific research laboratories it is rarely possible to use quality assurance schemes, developed for large-scale analysis. Instead methods have been developed to control the quality of modest numbers of analytical results by relying on statistical control: Analysis of precision serves...... to detect analytical errors by comparing the a priori precision of the analytical results with the actual variability observed among replicates or duplicates. The method relies on the chi-square distribution to detect excess variability and is quite sensitive even for 5-10 results. Interference control...... serves to detect analytical bias by comparing results obtained by two different analytical methods, each relying on a different detection principle and therefore exhibiting different influence from matrix elements; only 5-10 sets of results are required to establish whether a regression line passes...

  12. The limits of sterility assurance.

    Science.gov (United States)

    von Woedtke, Thomas; Kramer, Axel

    2008-09-03

    Sterility means the absence of all viable microorganisms including viruses. At present, a sterility assurance level (SAL) of 10(-6) is generally accepted for pharmacopoeial sterilization procedures, i.e., a probability of not more than one viable microorganism in an amount of one million sterilised items of the final product. By extrapolating the reduction rates following extreme artificial initial contamination, a theoretical overall performance of the procedure of at least 12 lg increments (overkill conditions) is demanded to verify an SAL of 10(-6). By comparison, other recommendations for thermal sterilization procedures demand only evidence that the difference between the initial contamination and the number of test organisms at the end of the process amount to more than six orders of magnitude. However, a practical proof of the required level of sterility assurance of 10(-6) is not possible. Moreover, the attainability of this condition is fundamentally dubious, at least in non-thermal procedures. Thus, the question is discussed whether the undifferentiated adherence to the concept of sterility assurance on the basis of a single SAL of 10(-6) corresponds with the safety requirements in terms of patient or user safety, costs and energy efficiency. Therefore, in terms of practical considerations, a concept of tiered SALs is recommended, analogous to the comparable and well-established categorization into "High-level disinfection", "Intermediate-level disinfection" and "Low-level disinfection". The determination of such tiered SALs is geared both to the intended application of the sterilized goods, as well as to the characteristics of the products and the corresponding treatment options.In the case of aseptic preparation, filling and production procedures, a mean contamination probability of 10(-3) is assumed. In automated processes, lower contamination rates can be realized. In the case of the production of re-usable medical devices, a reduction of at least 2

  13. Quality assurance in the transport of UF{sub 6}

    Energy Technology Data Exchange (ETDEWEB)

    Ravenscroft, N.L. [Edlow International Company, Washington, DC (United States)

    1991-12-31

    Edlow International`s primary business is the international transportation of radioactive materials. Therefore, Edlow has the responsibility to ensure that shipments are performed in compliance with regulatory requirements. In this regard, Edlow maintains a Quality Assurance (QA) Program. A major part of this Program is the establishment and use of QA Procedures. This paper addresses QA procedural requirements and how they are applied to a routine international shipment of low enriched UF{sub 6}. Only the major requirements for scheduling shipments will be addressed.

  14. CT quality assurance: computer assisted slice thickness determination.

    Science.gov (United States)

    Schneiders, N J; Bushong, S C

    1980-01-01

    The precise slice geometry of a CT scanner is an important, albeit tedious to determine, characteristic. A series of computer programs have been developed to analyze the slice thickness insert of the AAPM phantom. Without operator assistance they generate the beam profiles and slice thicknesses at three points in the scan field. A representative analysis is done on an AS&E scanner with slice thickness settings of 2 to 10 mm. The resulting discrepent measured thicknesses, ranging from 3 to 8 mm, indicate the need to perform such slice thickness measurements as part of a regular quality assurance program.

  15. 30 CFR 15.8 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Quality assurance. 15.8 Section 15.8 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND APPROVAL OF... § 15.8 Quality assurance. (a) Applicants granted an approval or an extension of approval under...

  16. 36 CFR 6.10 - Financial assurance.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Financial assurance. 6.10 Section 6.10 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR SOLID WASTE DISPOSAL SITES IN UNITS OF THE NATIONAL PARK SYSTEM § 6.10 Financial assurance. (a) The...

  17. Tool Use Within NASA Software Quality Assurance

    Science.gov (United States)

    Shigeta, Denise; Port, Dan; Nikora, Allen P.; Wilf, Joel

    2013-01-01

    As space mission software systems become larger and more complex, it is increasingly important for the software assurance effort to have the ability to effectively assess both the artifacts produced during software system development and the development process itself. Conceptually, assurance is a straightforward idea - it is the result of activities carried out by an organization independent of the software developers to better inform project management of potential technical and programmatic risks, and thus increase management's confidence in the decisions they ultimately make. In practice, effective assurance for large, complex systems often entails assessing large, complex software artifacts (e.g., requirements specifications, architectural descriptions) as well as substantial amounts of unstructured information (e.g., anomaly reports resulting from testing activities during development). In such an environment, assurance engineers can benefit greatly from appropriate tool support. In order to do so, an assurance organization will need accurate and timely information on the tool support available for various types of assurance activities. In this paper, we investigate the current use of tool support for assurance organizations within NASA, and describe on-going work at JPL for providing assurance organizations with the information about tools they need to use them effectively.

  18. 30 CFR 74.9 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Quality assurance. 74.9 Section 74.9 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH COAL MINE DUST SAMPLING DEVICES Requirements for Continuous Personal Dust Monitors § 74.9 Quality assurance....

  19. Quality Assurance in Sub-Saharan Africa

    Science.gov (United States)

    Materu, Peter; Righetti, Petra

    2010-01-01

    This article assesses the status and practice of higher education quality assurance in sub-Saharan Africa, focusing on degree-granting tertiary institutions. A main finding is that structured national-level quality assurance processes in African higher education are a very recent phenomenon and that most countries face major capacity constraints.…

  20. 30 CFR 7.7 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Quality assurance. 7.7 Section 7.7 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR TESTING, EVALUATION, AND APPROVAL OF MINING PRODUCTS TESTING BY APPLICANT OR THIRD PARTY General § 7.7 Quality assurance. Applicants...

  1. 48 CFR 2453.246 - Quality Assurance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Quality Assurance. 2453.246 Section 2453.246 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS FORMS Prescription of Forms 2453.246 Quality Assurance....

  2. Quality Assurance in Chinese Higher Education

    Science.gov (United States)

    Li, Yuan

    2010-01-01

    Quality assurance has been integrated into the fabric of higher education in China, with the issue of quality in higher education--how to evaluate it and how to enhance it--now taking centre stage in Chinese higher education. In the past decade, the development of quality assurance in Chinese higher education has covered a broad spectrum of…

  3. Quality assurance manual: Volume 2, Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Oijala, J.E.

    1988-06-01

    This paper contains quality assurance information on departments of the Stanford Linear Accelerator Center. Particular quality assurance policies and standards discussed are on: Mechanical Systems; Klystron and Microwave Department; Electronics Department; Plant Engineering; Accelerator Department; Purchasing; and Experimental Facilities Department. (LSP)

  4. Ontario's Quality Assurance Framework: A Critical Response

    Science.gov (United States)

    Heap, James

    2013-01-01

    Ontario's Quality Assurance Framework (QAF) is reviewed and found not to meet all five criteria proposed for a strong quality assurance system focused on student learning. The QAF requires a statement of student learning outcomes and a method and means of assessing those outcomes, but it does not require that data on achievement of intended…

  5. Reinforcing Quality Assurance in Romanian Higher Education

    Directory of Open Access Journals (Sweden)

    Ana-Maria Dima

    2010-07-01

    Full Text Available Since 1993, the quality assurance system in Romania has gained considerable experience. This experience was recently recognized in 2008 by the ENQA: European Association for Quality Assurance in Higher Education through the admission of ARACIS as a full member of EQAR: the European Quality Assurance Register. The Board of ENQA agreed to grant ARACIS’s full membership of ENQA for five years from 2 June 2009. This article explores the benefits of membership for the Romanian Agency for Quality Assurance in Higher Education – ARACIS, comparing to other regional and global quality assurance agencies networks. The common features and differences between ARACIS and other European agencies are questioned through the frameworks of ENQA and INQAAHE as a case study.

  6. EMERGENCY READINESS ASSURANCE PLAN (ERAP) FOR FISCAL YEAR (FY) 2014

    Energy Technology Data Exchange (ETDEWEB)

    Bush, Shane

    2014-09-01

    This Emergency Readiness Assurance Plan (ERAP) for Fiscal Year (FY) 2014 in accordance with DOE O 151.1C, “Comprehensive Emergency Management System.” The ERAP documents the readiness of the INL Emergency Management Program using emergency response planning and preparedness activities as the basis. It describes emergency response planning and preparedness activities, and where applicable, summarizes and/or provides supporting information in tabular form for easy access to data. The ERAP also provides budget, personnel, and planning forecasts for FY-15. Specifically, the ERAP assures the Department of Energy Idaho Operations Office that stated emergency capabilities at INL are sufficient to implement PLN-114, “INL Emergency Plan/RCRA Contingency Plan.

  7. QAP co-sponsors global meeting on quality assurance in developing countries.

    Science.gov (United States)

    1994-01-01

    A consultative meeting on quality health care in developing countries was held in the Netherlands immediately before the 1993 conference of the International Society of Quality Assurance in Health Care. Sponsored by the USAID-funded Quality Assurance Project in collaboration with the World Health Organization and the Danish foreign aid agency, DANIDA, the meeting brought together representatives from 17 developing countries. Participants enthusiastically exchanged experiences in adapting and applying quality assurance methods to resource-strained health care systems and valued the recommendations they received. Technical discussions focused on strategic planning, standard setting and monitoring, problem solving, and quality assurance capacity building. The meeting included background papers on each theme, synopses of the work of representatives of selected countries, and small group sessions. The participants recognized that certain structures, such as a data and health information monitoring system, must be in place to sustain a quality assurance program. There are also key environmental factors, including a commitment in the form of resource allocation from top leadership. The highlights of the meeting were presented at the general conference to great acclaim. Participants in the meeting benefitted from the information generated by the exchange of ideas and became unified in their understanding that quality assurance is a viable and necessary component of health care management. The success of the meeting led to the proposal which is under consideration that a permanent committee be established to ensure the participation of representatives of developing countries in international quality assurance activities.

  8. Up-Stream Dissolved Oxygen TMDL Project Quality Assurance ProjectPlan

    Energy Technology Data Exchange (ETDEWEB)

    Stringfellow, William T.

    2005-05-13

    A quality assurance project plan (QAPP) for the execution of an ecosystem level monitoring and research program examining algal ecology in highly impaired rivers. Procedures for executing both field and laboratory surface water quality and flow analysis are described. The procedures described here are compatible with the California Surface Water Ambient Monitoring program (SWAMP).

  9. Quality assurance for screening mammography data collection systems in 22 countries.

    NARCIS (Netherlands)

    Klabunde, C.N.; Sancho-Garnier, H.; Broeders, M.E.A.C.; Thoresen, S.; Rodrigues, V.J.; Ballard-Barbash, R.

    2001-01-01

    OBJECTIVES: To document the mammography data that are gathered by the organized screening programs participating in the International Breast Cancer Screening Network (IBSN), the nature of their procedures for data quality assurance, and the measures used to assess program performance and impact. MET

  10. [Quality assurance in acupuncture therapy].

    Science.gov (United States)

    Kubiena, G

    1996-04-01

    Quality assurance for acupuncture therapy requires a good basic and on-going training in both conventional western medicine as well as in the theory and practice of acupuncture, the ability to synthesize the patient's objective findings and subjective feelings, and honesty with the patient and towards oneself. Thus, based on the continuous critical evaluation of the objective and subjective parameters, the question of acupunture as the optimal form of therapy for this specific case is honestly answered and one has the courage to admit failures. With regard to the theory, surveys of the acupuncture literature show that a considerable improvement in quality and honesty is necessary. There is a lack of standardised experimental methods (e.g. 28 different placebos in 28 different studies!). Especially German acupuncture journals have a disturbed relation to failures. To hide or deny failures is of no benefit neither to acupuncture, science to the relationship between the physician and the patient since the practitioner must be able to rely on the information in the literature. Furthermore, one should be open minded to alternative methods even if this means to refer a patient to a colleague.

  11. Hanford analytical services quality assurance requirements documents

    Energy Technology Data Exchange (ETDEWEB)

    Hyatt, J.E.

    1997-09-25

    Hanford Analytical Services Quality Assurance Requirements Document (HASQARD) is issued by the Analytical Services, Program of the Waste Management Division, US Department of Energy (US DOE), Richland Operations Office (DOE-RL). The HASQARD establishes quality requirements in response to DOE Order 5700.6C (DOE 1991b). The HASQARD is designed to meet the needs of DOE-RL for maintaining a consistent level of quality for sampling and field and laboratory analytical services provided by contractor and commercial field and laboratory analytical operations. The HASQARD serves as the quality basis for all sampling and field/laboratory analytical services provided to DOE-RL through the Analytical Services Program of the Waste Management Division in support of Hanford Site environmental cleanup efforts. This includes work performed by contractor and commercial laboratories and covers radiological and nonradiological analyses. The HASQARD applies to field sampling, field analysis, and research and development activities that support work conducted under the Hanford Federal Facility Agreement and Consent Order Tri-Party Agreement and regulatory permit applications and applicable permit requirements described in subsections of this volume. The HASQARD applies to work done to support process chemistry analysis (e.g., ongoing site waste treatment and characterization operations) and research and development projects related to Hanford Site environmental cleanup activities. This ensures a uniform quality umbrella to analytical site activities predicated on the concepts contained in the HASQARD. Using HASQARD will ensure data of known quality and technical defensibility of the methods used to obtain that data. The HASQARD is made up of four volumes: Volume 1, Administrative Requirements; Volume 2, Sampling Technical Requirements; Volume 3, Field Analytical Technical Requirements; and Volume 4, Laboratory Technical Requirements. Volume 1 describes the administrative requirements

  12. Introduction: Cybersecurity and Software Assurance Minitrack

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Luanne [JHU Applied Physics Laboratory; George, Richard [JHU Applied Physics Laboratory; Linger, Richard C [ORNL

    2015-01-01

    Modern society is dependent on software systems of remarkable scope and complexity. Yet methods for assuring their security and functionality have not kept pace. The result is persistent compromises and failures despite best efforts. Cybersecurity methods must work together for situational awareness, attack prevention and detection, threat attribution, minimization of consequences, and attack recovery. Because defective software cannot be secure, assurance technologies must play a central role in cybersecurity approaches. There is increasing recognition of the need for rigorous methods for cybersecurity and software assurance. The goal of this minitrack is to develop science foundations, technologies, and practices that can improve the security and dependability of complex systems.

  13. Large hadron collider (LHC) project quality assurance plan

    Energy Technology Data Exchange (ETDEWEB)

    Gullo, Lisa; Karpenko, Victor; Robinson, Kem; Turner, William; Wong, Otis

    2002-09-30

    The LHC Quality Assurance Plan is a set of operating principles, requirements, and practices used to support Berkeley Lab's participation in the Large Hadron Collider Project. The LHC/QAP is intended to achieve reliable, safe, and quality performance in the LHC project activities. The LHC/QAP is also designed to fulfill the following objectives: (1) The LHC/QAP is Berkeley Lab's QA program document that describes the elements necessary to integrate quality assurance, safety management, and conduct of operations into the Berkeley Lab's portion of the LHC operations. (2) The LHC/QAP provides the framework for Berkeley Lab LHC Project administrators, managers, supervisors, and staff to plan, manage, perform, and assess their Laboratory work. (3) The LHC/QAP is the compliance document that conforms to the requirements of the Laboratory's Work Smart Standards for quality assurance (DOE O 414.1, 10 CFR 830.120), facility operations (DOE O 5480.19), and safety management (DOE P 450.4).

  14. Customers’ Perception regarding Assurance of Bancassurance Channel

    Directory of Open Access Journals (Sweden)

    Choudhury Mousumi

    2016-12-01

    Full Text Available Bancassurance has evolved as a strong distribution channel in India. Bancassurance means that the insurance company and the bank come together to offer insurance products from the counter of the banks to the bank’s customer. The present study attempts to analyse customers’ perception regarding assurance of bancassurance channel in providing insurance-related services. The study also tries to find out the impact of various demographic variables on customers’ perception regarding assurance of bancassurance channel. The study finds that customers consider bancassurance channel having high assurance in providing insurance services. It is also found in the study that there is no significant association between the demographic variables considered in the study and customers’ perception regarding assurance of bancassurance channel.

  15. 40 CFR 191.14 - Assurance requirements.

    Science.gov (United States)

    2010-07-01

    ..., HIGH-LEVEL AND TRANSURANIC RADIOACTIVE WASTES Environmental Standards for Disposal § 191.14 Assurance... Commission (see 10 CFR Part 60 for comparable provisions applicable to facilities regulated by the...

  16. Healthy Family 2009: Assuring Healthy Aging

    Science.gov (United States)

    ... Navigation Bar Home Current Issue Past Issues Healthy Family 2009 Assuring Healthy Aging Past Issues / Winter 2009 ... for steady, modest loss. Seek emotional support from family and friends. Expect setbacks; forgive yourself. Make physical ...

  17. Causal Models for Safety Assurance Technologies Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Fulfillment of NASA's System-Wide Safety and Assurance Technology (SSAT) project at NASA requires leveraging vast amounts of data into actionable knowledge. Models...

  18. Customers’ Perception regarding Assurance of Bancassurance Channel

    OpenAIRE

    Choudhury Mousumi; Singh Ranjit

    2016-01-01

    Bancassurance has evolved as a strong distribution channel in India. Bancassurance means that the insurance company and the bank come together to offer insurance products from the counter of the banks to the bank’s customer. The present study attempts to analyse customers’ perception regarding assurance of bancassurance channel in providing insurance-related services. The study also tries to find out the impact of various demographic variables on customers’ perception regarding assurance of b...

  19. A process for establishing a financial assurance plan for LLW disposal facilities

    Energy Technology Data Exchange (ETDEWEB)

    Smith, P. [EG and G Idaho, Inc., Idaho Falls, ID (United States). National Low-Level Waste Management Program

    1993-04-01

    This document describes a process by which an effective financial assurance program can be developed for new low-level radioactive waste (LLW) disposal facilities. The report identifies examples of activities that might cause financial losses and the types of losses they might create, discusses mechanisms that could be used to quantify and ensure against the various types of potential losses identified and describes a decision process to formulate a financial assurance program that takes into account the characteristics of both the potential losses and available mechanisms. A sample application of the concepts described in the report is provided.

  20. Quality Assurance Project Plan for waste tank vapor characterization

    Energy Technology Data Exchange (ETDEWEB)

    Suydam, C.D. Jr.

    1993-12-01

    This Quality Assurance Project Plan, WHC-SD-WM-QAPP-013, applies to four separate vapor sampling tasks associated with Phases 1 and 2 of the Tank Vapor Issue Resolution Program and support of the Rotary Mode Core Drilling Portable Exhauster Permit. These tasks focus on employee safety concerns and tank ventilation emission control design requirements. Previous characterization efforts and studies are of insufficient accuracy to adequately define the problem. It is believed that the technology and maturity of sampling and analytical methods can be sufficiently developed to allow the characterization of the constituents of the tank vapor space.

  1. Computer-assisted quality assurance for radiographic equipment.

    Science.gov (United States)

    Glaze, S; Schneiders, N; Archer, B; Bushong, S

    1980-01-01

    A quality assurance procedure which includes a computer program has been implemented to facilitate measurement of some of the parameters normally tested on diagnostic radiographic equipment. These include: reproducibility of output, linearity of mA settings, filtration, kVp calibration, timer error, SID indication, light field--x-ray field coincidence and effective focal spot size. The user may omit those sections which are not applicable to his needs. Full use is made of the data reducing the number of field measurements needed.

  2. Radiation Hardness Assurance (RHA): Challenges and New Considerations

    Science.gov (United States)

    Campola, Michael J.

    2017-01-01

    Radiation Hardness Assurance (RHA) challenges associated with the use of commercial-off-the-shelf (COTS) components and emerging technologies are cause for risk acceptance in space flight missions. The RHA flow includes environment definition, hazard evaluation, requirements definition, evaluation of design, and design trades to accommodate the risk a project or program takes. The varied missions profiles and environments don't necessarily benefit from the same risk reduction efforts or cost reduction attempts. The level of effort within the RHA flow can be tailored to minimize risk based on the environment or design criticality.

  3. Technical resource document for assured thermal processing of wastes

    Energy Technology Data Exchange (ETDEWEB)

    Farrow, R.L.; Fisk, G.A.; Hartwig, C.M.; Hurt, R.H.; Ringland, J.T.; Swansiger, W.A.

    1994-06-01

    This document is a concise compendium of resource material covering assured thermal processing of wastes (ATPW), an area in which Sandia aims to develop a large program. The ATPW program at Sandia is examining a wide variety of waste streams and thermal processes. Waste streams under consideration include municipal, chemical, medical, and mixed wastes. Thermal processes under consideration range from various incineration technologies to non-incineration processes such as supercritical water oxidation or molten metal technologies. Each of the chapters describes the element covered, discusses issues associated with its further development and/or utilization, presents Sandia capabilities that address these issues, and indicates important connections to other ATPW elements. The division of the field into elements was driven by the team`s desire to emphasize areas where Sandia`s capabilities can lead to major advances and is therefore somewhat unconventional. The report will be valuable to Sandians involved in further ATPW program development.

  4. Quality assurance in performance assessments

    Energy Technology Data Exchange (ETDEWEB)

    Maul, P.R.; Watkins, B.M.; Salter, P.; Mcleod, R [QuantiSci Ltd, Henley-on-Thames (United Kingdom)

    1999-01-01

    Following publication of the Site-94 report, SKI wishes to review how Quality Assurance (QA) issues could be treated in future work both in undertaking their own Performance Assessment (PA) calculations and in scrutinising documents supplied by SKB (on planning a repository for spent fuels in Sweden). The aim of this report is to identify the key QA issues and to outline the nature and content of a QA plan which would be suitable for SKI, bearing in mind the requirements and recommendations of relevant standards. Emphasis is on issues which are specific to Performance Assessments for deep repositories for radioactive wastes, but consideration is also given to issues which need to be addressed in all large projects. Given the long time over which the performance of a deep repository system must be evaluated, the demonstration that a repository is likely to perform satisfactorily relies on the use of computer-generated model predictions of system performance. This raises particular QA issues which are generally not encountered in other technical areas (for instance, power station operations). The traceability of the arguments used is a key QA issue, as are conceptual model uncertainty, and code verification and validation; these were all included in the consideration of overall uncertainties in the Site-94 project. Additionally, issues which are particularly relevant to SKI include: How QA in a PA fits in with the general QA procedures of the organisation undertaking the work. The relationship between QA as applied by the regulator and the implementor of a repository development programme. Section 2 introduces the discussion of these issues by reviewing the standards and guidance which are available from national and international organisations. This is followed in Section 3 by a review of specific issues which arise from the Site-94 exercise. An outline procedure for managing QA issues in SKI is put forward as a basis for discussion in Section 4. It is hoped that

  5. Isotopic power supplies for space and terrestrial systems: quality assurance by Sandia National Laboratories

    Energy Technology Data Exchange (ETDEWEB)

    Hannigan, R.L.; Harnar, R.R.

    1981-09-01

    The Sandia National Laboratories participation in Quality Assurance (QA) programs for Radioisotopic Thermoelectric Generators which have been used in space and terrestrial systems over the past 15 years is summarized. Basic elements of the program are briefly described and recognition of assistance from other Sandia organizations is included. Descriptions of the various systems for which Sandia has had the QA responsibility are also presented. In addition, the outlook for Sandia participation in RTG programs for the next several years is noted.

  6. Quality Assurance in Physical Education

    Science.gov (United States)

    Richards, K. Andrew R.; Wilson, Wesley J.

    2012-01-01

    In an economic and political climate marked by the continued reduction of physical education programs, the authors believe that advocacy is now a professional responsibility that all physical educators have a duty to perform. Despite support from the Centers for Disease Control and Prevention (2010), the National Association for Sport and Physical…

  7. 42 CFR 457.495 - State assurance of access to care and procedures to assure quality and appropriateness of care.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false State assurance of access to care and procedures to assure quality and appropriateness of care. 457.495 Section 457.495 Public Health CENTERS FOR MEDICARE... State assurance of access to care and procedures to assure quality and appropriateness of care. A...

  8. Seeking legitimacy for new assurance forms: The case of assurance on sustainability reporting

    NARCIS (Netherlands)

    O'Dwyer, B.; Owen, D.; Unerman, J.

    2011-01-01

    Based on the development of a more refined conception of legitimacy than has been used in prior audit/assurance and sustainability accounting research, this paper analyses how the legitimation processes adopted by sustainability assurance practitioners in a large professional services firm have co-e

  9. Quality-assurance plan for water-resources activities of the U.S. Geological Survey in Idaho

    Science.gov (United States)

    Packard, F.A.

    1996-01-01

    To ensure continued confidence in its products, the Water Resources Division of the U.S. Geological Survey implemented a policy that all its scientific work be performed in accordance with a centrally managed quality-assurance program. This report establishes and documents a formal policy for current (1995) quality assurance within the Idaho District of the U.S. Geological Survey. Quality assurance is formalized by describing district organization and operational responsibilities, documenting the district quality-assurance policies, and describing district functions. The districts conducts its work through offices in Boise, Idaho Falls, Twin Falls, Sandpoint, and at the Idaho National Engineering Laboratory. Data-collection programs and interpretive studies are conducted by two operating units, and operational and technical assistance is provided by three support units: (1) Administrative Services advisors provide guidance on various personnel issues and budget functions, (2) computer and reports advisors provide guidance in their fields, and (3) discipline specialists provide technical advice and assistance to the district and to chiefs of various projects. The district's quality-assurance plan is based on an overall policy that provides a framework for defining the precision and accuracy of collected data. The plan is supported by a series of quality-assurance policy statements that describe responsibilities for specific operations in the district's program. The operations are program planning; project planning; project implementation; review and remediation; data collection; equipment calibration and maintenance; data processing and storage; data analysis, synthesis, and interpretation; report preparation and processing; and training. Activities of the district are systematically conducted under a hierarchy of supervision an management that is designed to ensure conformance with Water Resources Division goals quality assurance. The district quality-assurance

  10. Quality assurance in military medical research and medical radiation accident management.

    Science.gov (United States)

    Hotz, Mark E; Meineke, Viktor

    2012-08-01

    The provision of quality radiation-related medical diagnostic and therapeutic treatments cannot occur without the presence of robust quality assurance and standardization programs. Medical laboratory services are essential in patient treatment and must be able to meet the needs of all patients and the clinical personnel responsible for the medical care of these patients. Clinical personnel involved in patient care must embody the quality assurance process in daily work to ensure program sustainability. In conformance with the German Federal Government's concept for modern departmental research, the international standard ISO 9001, one of the relevant standards of the International Organization for Standardization (ISO), is applied in quality assurance in military medical research. By its holistic approach, this internationally accepted standard provides an excellent basis for establishing a modern quality management system in line with international standards. Furthermore, this standard can serve as a sound basis for the further development of an already established quality management system when additional standards shall apply, as for instance in reference laboratories or medical laboratories. Besides quality assurance, a military medical facility must manage additional risk events in the context of early recognition/detection of health risks of military personnel on deployment in order to be able to take appropriate preventive and protective measures; for instance, with medical radiation accident management. The international standard ISO 31000:2009 can serve as a guideline for establishing risk management. Clear organizational structures and defined work processes are required when individual laboratory units seek accreditation according to specific laboratory standards. Furthermore, international efforts to develop health laboratory standards must be reinforced that support sustainable quality assurance, as in the exchange and comparison of test results within

  11. Quality assurance plan for the Objective Supply Capability Adaptive Redesign (OSCAR) project

    Energy Technology Data Exchange (ETDEWEB)

    Stewart, K.A.; Rasch, K.A.; Reid, R.W.

    1996-11-01

    This document establishes the Quality Assurance Plan (QAP) for the National Guard Bureau Objective Supply Capability Adaptive Redesign (OSCAR) project activities under the Oak Ridge National Laboratory (ORNL) management. It defines the requirements and assigns responsibilities for ensuring, with a high degree of confidence, that project objectives will be achieved as planned. The QAP outlined herein is responsive to and meets the Quality Assurance Program standards for the U.S. Department of Energy (DOE), Lockheed Martin Energy Research Corporation and ORNL and the ORNL Computing, Robotics, and Education Directorate (CRE). This document is intended to be in compliance with DOE Order 5700.6C, Quality Assurance Program, and the ORNL Standard Practice Procedure, SPP X-QA-8, Quality Assurance for ORNL Computing Software. This standard allows individual organizations to apply the stated requirements in a flexible manner suitable to the type of activity involved. Section I of this document provides an introduction to the OSCAR project QAP; Sections 2 and 3 describe the specific aspects of quality assurance as applicable to the OSCAR project. Section 4 describes the project approach to risk management. The Risk Management Matrix given in Appendix A is a tool to assess, prioritize, and prevent problems before they occur. Therefore, the matrix will be reviewed and revised on a periodic basis.

  12. Dose Assurance in Radiation Processing Plants

    DEFF Research Database (Denmark)

    Miller, Arne; Chadwick, K.H.; Nam, J.W.

    1983-01-01

    Radiation processing relies to a large extent on dosimetry as control of proper operation. This applies in particular to radiation sterilization of medical products and food treatment, but also during development of any other process. The assurance that proper dosimetry is performed at the radiat......Radiation processing relies to a large extent on dosimetry as control of proper operation. This applies in particular to radiation sterilization of medical products and food treatment, but also during development of any other process. The assurance that proper dosimetry is performed...... at the radiation processing plant can be obtained through the mediation of an international organization, and the IAEA is now implementing a dose assurance service for industrial radiation processing....

  13. Safety Assurance in NextGen

    Science.gov (United States)

    HarrisonFleming, Cody; Spencer, Melissa; Leveson, Nancy; Wilkinson, Chris

    2012-01-01

    The generation of minimum operational, safety, performance, and interoperability requirements is an important aspect of safely integrating new NextGen components into the Communication Navigation Surveillance and Air Traffic Management (CNS/ATM) system. These requirements are used as part of the implementation and approval processes. In addition, they provide guidance to determine the levels of design assurance and performance that are needed for each element of the new NextGen procedures, including aircraft, operator, and Air Navigation and Service Provider. Using the enhanced Airborne Traffic Situational Awareness for InTrail Procedure (ATSA-ITP) as an example, this report describes some limitations of the current process used for generating safety requirements and levels of required design assurance. An alternative process is described, as well as the argument for why the alternative can generate more comprehensive requirements and greater safety assurance than the current approach.

  14. The Major Field Test in Business: A Solution to the Problem of Assurance of Learning Assessment?

    Science.gov (United States)

    Green, Jeffrey J.; Stone, Courtenay Clifford; Zegeye, Abera

    2014-01-01

    Colleges and universities are being asked by numerous sources to provide assurance of learning assessments of their students and programs. Colleges of business have responded by using a plethora of assessment tools, including the Major Field Test in Business. In this article, the authors show that the use of the Major Field Test in Business for…

  15. Analytical approaches to quality assurance and quality control in rangeland monitoring data

    Science.gov (United States)

    Producing quality data to support land management decisions is the goal of every rangeland monitoring program. However, the results of quality assurance (QA) and quality control (QC) efforts to improve data quality are rarely reported. The purpose of QA and QC is to prevent and describe non-sampling...

  16. Using TQM and ISO 9000 Principles in Assuring Education Service Quality.

    Science.gov (United States)

    Kabashkin, Igor; Michnev, Boris; Utchin, Georgy

    1998-01-01

    Describes Riga Aviation University's movement from a controlled professional-education program to a system of contract relations with students as education service customers. Discusses a study of students' demands, requirements, and issues and the development of a quality assurance system based on Total Quality Management and ISO 9000 standards.…

  17. The Assessment of Business Knowledge and Integration for Assurance of Learning: An Application

    Science.gov (United States)

    Hawkins, Alfred G., Jr.

    2010-01-01

    AACSB has mandated that the documentation of student learning will become increasingly important in decisions regarding initial accreditation and reaffirmation. Assurance of learning is a major part of the accreditation and reaffirmation process. All universities will need to develop a set of learning goals for all their programs. These learning…

  18. Quality assurance in head and neck surgical oncology : EORTC 24954 trial on larynx preservation

    NARCIS (Netherlands)

    Leemans, C. R.; Tijink, B. M.; Langendijk, J. A.; Andry, G.; Hamoir, M.; Lefebvre, J. L.

    2013-01-01

    Background: The Head and Neck Cancer Group (HNCG) of the EORTC conducted a quality assurance program in the EORTC 24954 trial on larynx preservation. In this multicentre study, patients with resectable advanced squamous cell carcinoma of the larynx or hypopharynx were randomly assigned for treatment

  19. Experiencing and Measuring the Unteachable: Achieving AACSB Learning Assurance Requirements in Business Ethics

    Science.gov (United States)

    Lawrence, Katherine E.; Reed, Kendra L.; Locander, William

    2011-01-01

    The AACSB requires continuous improvement of business school outcomes through a comprehensive Assurance of Learning program. Measuring ethical decision making poses an interesting challenge for schools making it central to their mission. The authors provide an innovative and effective approach to assessing ethical decision making and closing the…

  20. Models for Information Assurance Education and Outreach: A Report on Year 2 Implementation

    Science.gov (United States)

    Wang, Jianjun

    2014-01-01

    "Models for Information Assurance Education and Outreach" (MIAEO) is an NSF-funded, three-year project to support hands-on explorations in "network security" and "cryptography" through Research Experience Vitalizing Science-University Program (REVS-UP) at California State University, Bakersfield. In addition, the…

  1. Private sector delivery of health services in developing countries: a mixed-methods study on quality assurance in social franchises

    Directory of Open Access Journals (Sweden)

    Schlein Karen

    2013-01-01

    Full Text Available Abstract Background Across the developing world health care services are most often delivered in the private sector and social franchising has emerged, over the past decade, as an increasingly popular method of private sector health care delivery. Social franchising aims to strengthen business practices through economies of scale: branding clinics and purchasing drugs in bulk at wholesale prices. While quality is one of the established goals of social franchising, there is no published documentation of how quality levels might be set in the context of franchised private providers, nor what quality assurance measures can or should exist within social franchises. The aim of this study was to better understand the quality assurance systems currently utilized in social franchises, and to determine if there are shared standards for practice or quality outcomes that exist across programs. Methods The study included three data sources and levels of investigation: 1 Self-reported program data; 2 Scoping telephone interviews; and 3 In-depth field interviews and clinic visits. Results Social Franchises conceive of quality assurance not as an independent activity, but rather as a goal that is incorporated into all areas of franchise operations, including recruitment, training, monitoring of provider performance, monitoring of client experience and the provision of feedback. Conclusions These findings are the first evidence to support the 2002 conceptual model of social franchising which proposed that the assurance of quality was one of the three core goals of all social franchises. However, while quality is important to franchise programs, quality assurance systems overall are not reflective of the evidence to-date on quality measurement or quality improvement best practices. Future research in this area is needed to better understand the details of quality assurance systems as applied in social franchise programs, the process by which quality assurance

  2. Private sector delivery of health services in developing countries: a mixed-methods study on quality assurance in social franchises

    Science.gov (United States)

    2013-01-01

    Background Across the developing world health care services are most often delivered in the private sector and social franchising has emerged, over the past decade, as an increasingly popular method of private sector health care delivery. Social franchising aims to strengthen business practices through economies of scale: branding clinics and purchasing drugs in bulk at wholesale prices. While quality is one of the established goals of social franchising, there is no published documentation of how quality levels might be set in the context of franchised private providers, nor what quality assurance measures can or should exist within social franchises. The aim of this study was to better understand the quality assurance systems currently utilized in social franchises, and to determine if there are shared standards for practice or quality outcomes that exist across programs. Methods The study included three data sources and levels of investigation: 1) Self-reported program data; 2) Scoping telephone interviews; and 3) In-depth field interviews and clinic visits. Results Social Franchises conceive of quality assurance not as an independent activity, but rather as a goal that is incorporated into all areas of franchise operations, including recruitment, training, monitoring of provider performance, monitoring of client experience and the provision of feedback. Conclusions These findings are the first evidence to support the 2002 conceptual model of social franchising which proposed that the assurance of quality was one of the three core goals of all social franchises. However, while quality is important to franchise programs, quality assurance systems overall are not reflective of the evidence to-date on quality measurement or quality improvement best practices. Future research in this area is needed to better understand the details of quality assurance systems as applied in social franchise programs, the process by which quality assurance becomes a part of the

  3. Quality assurance program of a respiratory gating irradiation system based on external and internal fiducial markers; Programa de garantia de calidad de un sistema de irradiacion con control respiratorio basado en marcadores fiduciales externos e internos

    Energy Technology Data Exchange (ETDEWEB)

    Zucca Aparicio, D.; Perez Moreno, J. M.; Fernandez Leton, P.; Garcia Ruiz-Zorrilla, J.; Minambres Moro, A.

    2011-07-01

    Respiratory Gating involves the administration of radiation during treatment delivery within a particular portion of the patients breathing cycle, so the absorbed dose administration with respiratory control techniques requires specific quality control to ensure the correctness of the delivered dose. The establishment of a Quality Control Program (QC) is proposed for the Respiratory Gating based techniques in order to have a better understanding of how this system works and to know its associated dosimetric impact. The influence of the CT acquisition under respiratory motion conditions has been analyzed for the treatment isocenter localization, using internal and external fiducial markers with IGRT techniques that allow the correlation of the isocenter positioning with the phase of the respiratory cycle. Radiation delivery in the presence of intra fraction organ motion causes an averaging or blurring of the static dose distribution over the path of motion increasing the beam penumbra of the radiation field and reducing the therapeutic region when the irradiation is not breath controlled. The feasibility of intensity modulated treatments (IMRT) for both static and dynamic techniques, managed by respiratory control has been tested, demonstrating the possibility of synchronizing the movement of the leaves in the microfluorimeter collimator (mMLC) with the gated beam irradiation. (Author) 45 refs.

  4. Issues Associated with IAEA Involvement in Assured Nuclear Fuel Supply Arrangements

    Energy Technology Data Exchange (ETDEWEB)

    Kessler, Carol E.; Mathews, Carrie E.

    2008-02-08

    Assured nuclear fuel supply has been discussed at various times as a mechanism to help limit expansion of enrichment and reprocessing (E&R) capability beyond current technology holders. Given the events in the last few years in North Korea and Iran, concern over weapons capabilities gained from acquisition of E&R capabilities has heightened and brought assured nuclear fuel supply (AFS) again to the international agenda. Successful AFS programs can be valuable contributions to strengthening the nonproliferation regime and helping to build public support for expanding nuclear energy.

  5. Strategic approach to information security and assurance in health research.

    Science.gov (United States)

    Akazawa, Shunichi; Igarashi, Manabu; Sawa, Hirofumi; Tamashiro, Hiko

    2005-09-01

    Information security and assurance are an increasingly critical issue in health research. Whether health research be in genetics, new drugs, disease outbreaks, biochemistry, or effects of radiation, it deals with information that is highly sensitive and which could be targeted by rogue individuals or groups, corporations, national intelligence agencies, or terrorists, looking for financial, social, or political gains. The advents of the Internet and advances in recent information technologies have also dramatically increased opportunities for attackers to exploit sensitive and valuable information.Government agencies have deployed legislative measures to protect the privacy of health information and developed information security guidelines for epidemiological studies. However, risks are grossly underestimated and little effort has been made to strategically and comprehensively protect health research information by institutions, governments and international communities.There is a need to enforce a set of proactive measures to protect health research information locally and globally. Such measures should be deployed at all levels but will be successful only if research communities collaborate actively, governments enforce appropriate legislative measures at national level, and the international community develops quality standards, concluding treaties if necessary, at the global level.Proactive measures for the best information security and assurance would be achieved through rigorous management process with a cycle of "plan, do, check, and act". Each health research entity, such as hospitals, universities, institutions, or laboratories, should implement this cycle and establish an authoritative security and assurance organization, program and plan coordinated by a designatedChief Security Officer who will ensure implementation of the above process, putting appropriate security controls in place, with key focus areas such aspolicies and best practices, enforcement

  6. Modifiers for quality assurance in group facilitation

    NARCIS (Netherlands)

    Kolfschoten, G.L.; Grünbacher, P.; Briggs, R.O.

    2011-01-01

    A key task of a professional facilitator is to assure the quality of the knowledge products created through collaborative effort. To manage the quality of the knowledge a group generates, facilitators attend to, judge, and question the quality of the contributions a group makes, the decisions it mak

  7. 38 CFR 18.405 - Assurances required.

    Science.gov (United States)

    2010-07-01

    ...) Extent of application to institution or facility. An assurance shall apply to the entire institution or... real property as security for financing construction of new, or improvement of existing, facilities on... information required to ascertain whether the recipient has complied or is complying with the law....

  8. 15 CFR 8b.5 - Assurances required.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Assurances required. 8b.5 Section 8b.5 Commerce and Foreign Trade Office of the Secretary of Commerce PROHIBITION OF DISCRIMINATION AGAINST THE... otherwise encumber the real property as security to finance construction of new, or improvement of...

  9. Quality Assurance in University Guidance Services

    Science.gov (United States)

    Simon, Alexandra

    2014-01-01

    In Europe there is no common quality assurance framework for the delivery of guidance in higher education. Using a case study approach in four university career guidance services in England, France and Spain, this article aims to study how quality is implemented in university career guidance services in terms of strategy, standards and models,…

  10. 42 CFR 441.352 - State assurances.

    Science.gov (United States)

    2010-10-01

    ... medical assistance with respect to NF, home health, private duty nursing, personal care services, home and... 42 Public Health 4 2010-10-01 2010-10-01 false State assurances. 441.352 Section 441.352 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES...

  11. 42 CFR 93.301 - Institutional assurances.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Institutional assurances. 93.301 Section 93.301 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES...

  12. APPROACH TO QUALITY ASSURANCE IN HIGHER EDUCATION

    Directory of Open Access Journals (Sweden)

    Zora Arsovski

    2007-03-01

    Full Text Available Quality assurance in higher education is streamed in two interconnected concepts: (1 quality management according to ISO 9000 and (2 Bologna process. In this paper both concepts are presented, with point on internal state and term plan activities for quality improvement in higher education in Serbia.

  13. Quality assurance or neo-imperialism

    DEFF Research Database (Denmark)

    Adriansen, Hanne Kirstine; Madsen, Lene Møller

    2013-01-01

    intention to do the opposite. Hence, we want to address how to make quality assurance can be made without imposing Western epistemologies. We call for an appreciation of different knowledges instead of mainstreaming in the name of internationalisation and globalisation. Capacity building of higher education...

  14. Quality Assurance in Higher Education in Zimbabwe

    Science.gov (United States)

    Garwe, Evelyn Chiyevo

    2014-01-01

    The purpose of this paper is to furnish local and global stakeholders with detailed information regarding the development and current status of quality assurance in the Zimbabwean higher education sector. The study used document analysis, observation and interviews with key informants as sources of data. This paper addresses the dearth of…

  15. From quality assurance to total quality management

    OpenAIRE

    Andreea Ionică

    2003-01-01

    Quality assurance is broadly the prevention of quality problems through planned and systematic activities. These will include the establishment of a good quality management system and the assessment of its adequacy, the audit of the operation of the system, and the review of the system itself

  16. Quality Assurance in Distance and Open Learning

    Science.gov (United States)

    Mahafzah, Mohammed Hasan

    2012-01-01

    E-learning has become an increasingly important teaching and learning mode in educational institutions and corporate training. The evaluation of E-learning, however, is essential for the quality assurance of E-learning courses. This paper constructs a three-phase evaluation model for E-learning courses, which includes development, process, and…

  17. Ensuring Quality Assurance in Vocational Education

    Science.gov (United States)

    Idialu, Ethel E.

    2013-01-01

    Vocational education emphasises skill acquisition. Quality assurance in vocational education is a concept that is concerned with high performance involving activities with vocational education such as teaching, learning, infrastructures, students' behaviour and the entire academic process. Quality vocational education refers to input and output of…

  18. Quality Assurance in the Presence of Variability

    Science.gov (United States)

    Lauenroth, Kim; Metzger, Andreas; Pohl, Klaus

    Software Product Line Engineering (SPLE) is a reuse-driven development paradigm that has been applied successfully in information system engineering and other domains. Quality assurance of the reusable artifacts of the product line (e.g. requirements, design, and code artifacts) is essential for successful product line engineering. As those artifacts are reused in several products, a defect in a reusable artifact can affect several products of the product line. A central challenge for quality assurance in product line engineering is how to consider product line variability. Since the reusable artifacts contain variability, quality assurance techniques from single-system engineering cannot directly be applied to those artifacts. Therefore, different strategies and techniques have been developed for quality assurance in the presence of variability. In this chapter, we describe those strategies and discuss in more detail one of those strategies, the so called comprehensive strategy. The comprehensive strategy aims at checking the quality of all possible products of the product line and thus offers the highest benefits, since it is able to uncover defects in all possible products of the product line. However, the central challenge for applying the comprehensive strategy is the complexity that results from the product line variability and the large number of potential products of a product line. In this chapter, we present one concrete technique that we have developed to implement the comprehensive strategy that addresses this challenge. The technique is based on model checking technology and allows for a comprehensive verification of domain artifacts against temporal logic properties.

  19. 43 CFR 17.4 - Assurances required.

    Science.gov (United States)

    2010-10-01

    ... financial assistance to an institution of higher education (including assistance for construction, for... treatment of students. (2) The assurance required with respect to an institution of higher education, or any... encumber the real property as security for financing construction of new, or improvement of...

  20. 45 CFR 1110.4 - Assurances required.

    Science.gov (United States)

    2010-10-01

    ... case of any application for Federal financial assistance to an institution of higher education... of higher education or any other institution, insofar as the assurance relates to the institution's... mortgage or otherwise encumber the real property as security for financing construction of new,...

  1. 45 CFR 80.4 - Assurances required.

    Science.gov (United States)

    2010-10-01

    ... institution of higher education (including assistance for construction, for research, for special training... assurance required with respect to an institution of higher education, hospital, or any other institution... security for financing construction of new, or improvement of existing, facilities on such property for...

  2. 13 CFR 113.4 - Assurances required.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Assurances required. 113.4 Section 113.4 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... the maturity of the recipient's financial obligations to SBA in the event of a failure to comply,...

  3. 13 CFR 112.8 - Assurances required.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Assurances required. 112.8 Section 112.8 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FEDERALLY... acceleration of the maturity of the recipient's financial obligation to the SBA in the event of a failure...

  4. [Contemporary clinical medicine--assurances and uncertainties].

    Science.gov (United States)

    Pacovský, V

    2009-01-01

    Selected topics in the contemporary clinical medicine are reflected. The main fields of interest and characteristic features unifying theory and praxis are outlined; specificities of clinical thinking and decision making, and conception of clinical medicine as a scientific discipline are presented. Author deals with assurances, various forms of irresolution in clinical medicine and with problems resulting from the scientific progress.

  5. Instructional Quality Assurance at Lansing Community College.

    Science.gov (United States)

    Herder, Dale M.; And Others

    Drawing from the experiences of Lansing Community College (LCC), this paper offers a rationale and model for measuring instructional quality. Section I offers background on LCC's efforts to assess the quality of its courses and curricula, and to introduce such quality assurance procedures as computer-based course syllabi, department and program…

  6. 30 CFR 14.8 - Quality assurance.

    Science.gov (United States)

    2010-07-01

    ... document. If a third party is assembling or manufacturing all or part of an approved belt, the approval... MINING PRODUCTS REQUIREMENTS FOR THE APPROVAL OF FLAME-RESISTANT CONVEYOR BELTS General Provisions § 14.8... order to assure that the finished conveyor belt will meet the flame-resistance test— (1) Flame test...

  7. Measurement Assurance for End-Item Users

    Science.gov (United States)

    Mimbs, Scott M.

    2008-01-01

    The goal of a Quality Management System (QMS) as specified in ISO 9001 and AS9100 is to assure the end product meets specifications and customer requirements. Measuring devices, often called measuring and test equipments (MTE), provide the evidence of product conformity to the prescribed requirements. Therefore the processes which employ MTE can become a weak link to the overall QMS if proper attention is not given to development and execution of these processes. Traditionally, calibration of MTE is given more focus in industry standards and process control efforts than the equally important proper usage of the same equipment. It is a common complaint of calibration laboratory personnel that MTE users are only interested in "a sticker." If the QMS requires the MTE "to demonstrate conformity of the product," then the quality of the measurement process must be adequate for the task. This leads to an ad hoc definition; measurement assurance is a discipline that assures that all processes, activities, environments, standards, and procedures involved in making a measurement produce a result that can be rigorously evaluated for validity and accuracy. To evaluate that the existing measurement processes are providing an adequate level of quality to support the decisions based upon this measurement data, an understanding of measurement assurance basics is essential. This topic is complimentary to the calibration standard, ANSI/NCSL Z540.3-2006, which targets the calibration of MTE at the organizational level. This paper will discuss general measurement assurance when MTE is used to provide evidence of product conformity, therefore the target audience of this paper is end item users of MTE. A central focus of the paper will be the verification of tolerances and the associated risks, so calibration professionals may find the paper useful in communication with their customers, MTE users.

  8. Software Assurance Curriculum Project Volume 1: Master of Software Assurance Reference Curriculum

    Science.gov (United States)

    2010-08-01

    credits per course has often aligned with the number of hours of lecture per week, but with online and other non-traditional formats becoming increasingly...development hires people to be developers and they are then selected to be SPOCs . Ergo, assurance is a collateral duty not their main job and we...Engineering Institute SIA survivability and information assurance SOA service-oriented architecture SPOC single point of contact SQL Structured Query

  9. 10 CFR 71.103 - Quality assurance organization.

    Science.gov (United States)

    2010-01-01

    ... management level that assures that the required authority and organizational freedom, including sufficient... location or locations where activities are performed, the organizational structure for executing the... the organizational structure, the individual(s) assigned the responsibility for assuring...

  10. Lunar RFC Reliability Testing for Assured Mission Success

    Science.gov (United States)

    Bents, David J.

    2008-01-01

    NASA's Constellation program has selected the closed cycle hydrogen oxygen Polymer Electrolyte Membrane (PEM) regenerative Fuel Cell (RFC) as its baseline solar energy storage system for the lunar outpost and manned rover vehicles. Since the outpost and manned rovers are "human-rated", these energy storage systems will have to be of proven reliability exceeding 99 percent over the length of the mission. Because of the low (TRL=5) development state of the closed cycle hydrogen oxygen PEM RFC at present, and because there is no equivalent technology base in the commercial sector from which to draw or infer reliability information from, NASA will have to spend significant resources developing this technology from TRL 5 to TRL 9, and will have to embark upon an ambitious reliability development program to make this technology ready for a manned mission. Because NASA would be the first user of this new technology, NASA will likely have to bear all the costs associated with its development. When well-known reliability estimation techniques are applied to the hydrogen oxygen RFC to determine the amount of testing that will be required to assure RFC unit reliability over life of the mission, the analysis indicates the reliability testing phase by itself will take at least 2 yr, and could take up to 6 yr depending on the number of QA units that are built and tested and the individual unit reliability that is desired. The cost and schedule impacts of reliability development need to be considered in NASA's Exploration Technology Development Program (ETDP) plans, since life cycle testing to build meaningful reliability data is the only way to assure "return to the moon, this time to stay, then on to Mars" mission success.

  11. Technical Reference Suite Addressing Challenges of Providing Assurance for Fault Management Architectural Design

    Science.gov (United States)

    Fitz, Rhonda; Whitman, Gerek

    2016-01-01

    Research into complexities of software systems Fault Management (FM) and how architectural design decisions affect safety, preservation of assets, and maintenance of desired system functionality has coalesced into a technical reference (TR) suite that advances the provision of safety and mission assurance. The NASA Independent Verification and Validation (IV&V) Program, with Software Assurance Research Program support, extracted FM architectures across the IV&V portfolio to evaluate robustness, assess visibility for validation and test, and define software assurance methods applied to the architectures and designs. This investigation spanned IV&V projects with seven different primary developers, a wide range of sizes and complexities, and encompassed Deep Space Robotic, Human Spaceflight, and Earth Orbiter mission FM architectures. The initiative continues with an expansion of the TR suite to include Launch Vehicles, adding the benefit of investigating differences intrinsic to model-based FM architectures and insight into complexities of FM within an Agile software development environment, in order to improve awareness of how nontraditional processes affect FM architectural design and system health management. The identification of particular FM architectures, visibility, and associated IV&V techniques provides a TR suite that enables greater assurance that critical software systems will adequately protect against faults and respond to adverse conditions. Additionally, the role FM has with regard to strengthened security requirements, with potential to advance overall asset protection of flight software systems, is being addressed with the development of an adverse conditions database encompassing flight software vulnerabilities. Capitalizing on the established framework, this TR suite provides assurance capability for a variety of FM architectures and varied development approaches. Research results are being disseminated across NASA, other agencies, and the

  12. Preliminary results of quality assurance implementation in interventional cardiology

    Energy Technology Data Exchange (ETDEWEB)

    Nikodemova, D. [Slovak Medical Univ., Bratislava (Slovakia)

    2006-07-01

    Full text of publication follows: The dramatic increase in the frequency of the interventional procedures reflects the significant benefit which directly affects the patient. However parallel is this benefit accompanied by some concern about the consequent increase in doses to patient and staff. The question of safety has prompted the European commission and Who to issue and advise to conduct research in the area of the intervention radiology and to prepare standard protocols for quality assurance of interventional procedures. The presentation is focused on the optimization of interventional procedures in cardiology with aim to reduce the risk level of high exposures and to elaborate national standard methods of quality assurance program, as well as, the procedures used for the case of overexposure. Study was conducted at Slovak Institute of Cardiology, as well as, at Slovak Pediatric Cardiology Center, where wide variation of specific interventional procedures are performed. Skin dose date of patient were measured by Unfors Patient Skin Dosemeter P.S.D. - 4 and the values of Dose area products followed during all examinations. All technical parameters used for examinations were identified. Simultaneously were measured the personal doses of the medical staff present by the examinations. For personal dose measurements Unfors E.D.D.30 dose meter was used, as well as, T.L.D. for measurements of doses on extremities. Preliminary results confirm wide spread of patient doses and professional doses of medical staff. The causes of this spread will by discussed. (authors)

  13. Operational excellence (six sigma) philosophy: Application to software quality assurance

    Energy Technology Data Exchange (ETDEWEB)

    Lackner, M.

    1997-11-01

    This report contains viewgraphs on operational excellence philosophy of six sigma applied to software quality assurance. This report outlines the following: goal of six sigma; six sigma tools; manufacturing vs administrative processes; Software quality assurance document inspections; map software quality assurance requirements document; failure mode effects analysis for requirements document; measuring the right response variables; and questions.

  14. Quality Assurance of Assessment and Moderation Discourses Involving Sessional Staff

    Science.gov (United States)

    Grainger, Peter; Adie, Lenore; Weir, Katie

    2016-01-01

    Quality assurance is a major agenda in tertiary education. The casualisation of academic work, especially in teaching, is also a quality assurance issue. Casual or sessional staff members teach and assess more than 50% of all university courses in Australia, and yet the research in relation to the role sessional staff play in quality assurance of…

  15. 10 CFR 61.63 - Financial assurances for institutional controls.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Financial assurances for institutional controls. 61.63 Section 61.63 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSING REQUIREMENTS FOR LAND DISPOSAL OF RADIOACTIVE WASTE Financial Assurances § 61.63 Financial assurances for institutional controls. (a) Prior...

  16. Quality Assurance in Postgraduate Education. ENQA Workshop Report 12

    Science.gov (United States)

    Bitusikova, Alexandra; Bohrer, Janet; Borosic, Ivana; Costes, Nathalie; Edinsel, Kerim; Hollander, Karoline; Jacobsson, Gunilla; Jakopovic, Ivan Filip; Kearney, Mary-Louise; Mulder, Fred; Negyesi, Judith; Pietzonka, Manuel

    2010-01-01

    The present report follows an ENQA (European Association for Quality Assurance in Higher Education) Workshop on Quality Assurance and Postgraduate Education, hosted by the Romanian Agency for Quality Assurance in Higher Education (ARACIS) in Brasov, Romania on 12-13 March 2009. The workshop was an excellent opportunity for ENQA members to exchange…

  17. Quality Assurance in Transnational Higher Education. ENQA Workshop Report 11

    Science.gov (United States)

    Bennett, Paul; Bergan, Sjur; Cassar, Daniela; Hamilton, Marlene; Soinila, Michele; Sursock, Andree; Uvalic-Trumbic, Stamenka; Williams, Peter

    2010-01-01

    The present report is the product of an ENQA (European Association for Quality Assurance in Higher Education) Bologna Seminar "Quality Assurance in Transnational Education: from words to action" hosted by the Quality Assurance Agency (QAA, UK) in London in December, 2008. The seminar discussed the current trends in Transnational…

  18. 75 FR 57956 - Draft Revision of the Federalwide Assurance

    Science.gov (United States)

    2010-09-23

    ... HUMAN SERVICES Draft Revision of the Federalwide Assurance AGENCY: Department of Health and Human... Assistant Secretary for Health, is announcing the availability of the draft revised Federalwide Assurance (FWA) form and Terms of Assurance, and is seeking comment on these draft documents. OHRP is...

  19. 42 CFR 93.303 - Assurances for small institutions.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Assurances for small institutions. 93.303 Section... POLICIES ON RESEARCH MISCONDUCT Responsibilities of Institutions Compliance and Assurances § 93.303 Assurances for small institutions. (a) If an institution is too small to handle research...

  20. Internal Quality Assurance System and Its Implementation in Kaunas College

    Science.gov (United States)

    Misiunas, Mindaugas

    2007-01-01

    The article discusses the internal system of quality assurance and its implementation methods in Kaunas College. The issues of quality assurance are reviewed in the context of the European higher education area covering the three levels: European, national and institutional. The importance of quality assurance and its links with external…

  1. [Quality assurance in occupational health services].

    Science.gov (United States)

    Michalak, J

    1996-01-01

    The general conditions influencing the quality assurance and audit in Polish occupational health services are presented. The factors promoting or hampering the implementation of quality assurance and audits are also discussed. The major influence on the transformation of Polish occupational health services in exorted by employers who are committed to cover the costs of the obligatory prophylactic examination of their employees. This is the factor which also contributes to the improvement of quality if services. The definitions of the most important terms are reviewed to highlight their accordance with the needs of occupational health services in Poland. The examples of audit are presented and the elements of selected methods of auditing are suggested to be adopted in Poland.

  2. ALMA quality assurance: concepts, procedures, and tools

    Science.gov (United States)

    Chavan, A. M.; Tanne, S. L.; Akiyama, E.; Kurowski, R.; Randall, S.; Vila Vilaro, B.; Villard, E.

    2016-07-01

    Data produced by ALMA for the community undergoes a rigorous quality assurance (QA) process, from the initial observation ("QA0") to the final science-ready data products ("QA2"), to the QA feedback given by the Principal Investigators (PIs) when they receive the data products ("QA3"). Calibration data is analyzed to measure the performance of the observatory and predict the trend of its evolution ("QA1"). The procedure develops over different steps and involves several actors across all ALMA locations; it is made possible by the support given by dedicated software tools and a complex database of science data, meta-data and operational parameters. The life-cycle of each involved entity is well-defined, and it prevents for instance that "bad" data (that is, data not meeting the minimum quality standards) is ever processed by the ALMA pipeline. This paper describes ALMA's quality assurance concepts and procedures, including the main enabling software components.

  3. A Systems Engineering Approach to Quality Assurance for Aerospace Testing

    Science.gov (United States)

    Shepherd, Christena C.

    2015-01-01

    On the surface, it appears that AS91001 has little to say about how to apply a Quality Management System (QMS) to major aerospace test programs (or even smaller ones). It also appears that there is little in the quality engineering Body of Knowledge (BOK)2 that applies to testing, unless it is nondestructive examination (NDE), or some type of lab or bench testing associated with the manufacturing process. However, if one examines: a) how the systems engineering (SE) processes are implemented throughout a test program; and b) how these SE processes can be mapped to the requirements of AS9100, a number of areas for involvement of the quality professional are revealed. What often happens is that quality assurance during a test program is limited to inspections of the test article; what could be considered a manufacturing al fresco approach. This limits the quality professional and is a disservice to the programs and projects, since there are a number of ways that quality can enhance critical processes, and support efforts to improve risk reduction, efficiency and effectiveness.

  4. Evolving Principles of Office Quality Assurance

    OpenAIRE

    Norman, Lee A.

    1988-01-01

    The application of medical quality assurance principles to ambulatory patient care using the traditional methods of medical chart audit, process review, and physician education has yielded generally disappointing results in improving patient care and physician performance. Newer methods assist physicians by providing patient and medical reference data at the time of a patient's visit. Techniques for tracking treatment outcomes and patients' test results and for providing instructions to patie...

  5. On the development of quality assurance

    DEFF Research Database (Denmark)

    Andersen, Jens

    2014-01-01

    Contemporary research in quality assurance indicates that large uncertainties observed in interlaboratory comparisons to a large extent originate from a lack of competence of laboratory staff. This explanation is challenged by the present article for which six technologies and multiple series of ...... of uncertainties of certified reference materials (CRMs) gave results that differed significantly from those in the certificates of the CRMs. (C) 2014 Elsevier B.V. All rights reserved....

  6. Safety and Mission Assurance Knowledge Management Retention

    Science.gov (United States)

    Johnson, Teresa A.

    2006-01-01

    This viewgraph presentation reviews the issues surrounding the management of knowledge in regards to safety and mission assurance. The JSC workers who were hired in the 1960's are slated to retire in the next two to three years. The experiences and knowledge of these NASA workers must be identified, and disseminated. This paper reviews some of the strategies that the S&MA is developing to capture that valuable institutional knowledge.

  7. Toward a Theory of Assurance Case Confidence

    Science.gov (United States)

    2012-09-01

    assurance case claim. The framework is based on the notion of eliminative induction—the princi- ple (first put forward by Francis Bacon ) that confidence in...eliminative induction. As first proposed by Francis Bacon [Schum 2001] and extended by L. Jonathan Cohen [Cohen 1970, 1977, 1989], eliminative induction is...eliminative in- duction—the principle (first put forward by Francis Bacon ) that confidence in the truth of a hypothesis (or claim) increases as reasons for

  8. Software Assurance Measurement -- State of the Practice

    Science.gov (United States)

    2013-11-01

    NET 39 ActionScript 39 Ada 40 C/C++ 40 Java 41 JavaScript 42 Objective-C 42 Opa 42 Packages 42 Perl 42 PHP 42 Python 42 Formal Methods... debugging of the system, which encompasses such concerns as the probable number of software errors that will be corrected at a given time in system...testing process and the economics of debugging due to error growth. Because assurance is normally judged against failure, the use of a measurement

  9. Assuring both quality and creativity in basic research

    Energy Technology Data Exchange (ETDEWEB)

    Bodnarczuk, M.

    1990-04-12

    How does one assure that both quality and creativity are obtained in basic research environments QA theoreticians have attempted to develop workable definitions of quality, but in more reflective moments, these definitions often fail to capture the deeper essence of the idea of quality.'' This paper asserts that creativity (as a product of the human mind) is a concrete interface between perfunctory definitions of quality (conformance to specifications) and more philosophical speculations about the nature of quality- related ultimates'' like elegance or beauty. In addition, we describe the distinction between creative ideas and creative acts and highlight one of the major inhibitors of creativity, fear. Finally we show that highly creative people often have an irreverent attitude toward boundaries and established authority, and discuss how one can allow for this when designing a QA program in a basic research environment.

  10. [Use of clinical databanks with special reference to gerontologic-geriatric quality assurance].

    Science.gov (United States)

    Thiesemann, R; Kruse, W H; Meier-Baumgartner, H P

    1997-01-01

    Geriatric institutions enforce clinical documentation in order to assure quality of care. Different means include basic information of the clinical course, data gathering by administration and extractions from research projects. The use of electronic data bases and common data processing shall provide a base for the development of a cooperation network, academic progress, quality assurance programs and models of utilization review. In this article, clinical data bases are defined and described with reference to their organization. Data elements collected depend on the focus and function of a data base which must be considered in developing a quality assurance program. Usually there is a focus on 1) therapy, device or procedures or 2) diseases or populations. However, the measurement of variables concerning health aspects of older patients crosses more than one dimension. Geriatric teams may have an advantage in developing a successful data base because of the fact that this requires a multidisciplinary team. It is necessary to follow principles of quality assurance and well-defined data base design in order to succeed in enforcing the objectives mentioned above.

  11. HPV testing for primary cervical screening: Laboratory issues and evolving requirements for robust quality assurance.

    Science.gov (United States)

    Carozzi, Francesca Maria; Del Mistro, Annarosa; Cuschieri, Kate; Frayle, Helena; Sani, Cristina; Burroni, Elena

    2016-03-01

    This review aims to highlight the importance of Quality Assurance for Laboratories performing HPV test for Cervical Cancer Screening. An HPV test, to be used as primary screening test, must be validated according to international criteria, based on comparison of its clinical accuracy to HC2 or GP5+/6+ PCR-EIA tests. The number of validated platforms is increasing and appropriate Quality Assurance Programs (QAPs) which can interrogate longitudinal robustness and quality are paramount. This document describes the following topics: (1) the characteristics of an HPV laboratory and the personnel training needs, to ensure an elevated quality of the entire process and the optimal use of the resources; (2) the Quality Assurance, as both internal (IQA) and external quality assessment (EQA) systems, to be implemented and performed, and the description of the existing EQAs, including limitations; (3) general considerations for an optimal EQA program for hrHPV primary screening Due to the importance of Quality Assurance for this field, international efforts are necessary to improve QA International Collaboration.

  12. Waste management and quality assurance: Reasonable co-existence?

    Energy Technology Data Exchange (ETDEWEB)

    Bresson, J.F.

    1989-11-01

    Implementing Chapter 3, Low-Level Waste Management, of DOE Order 5820-2, ``Radioactive Waste Management`` has created a major change in the operating philosophy of DOE`s prime contractors. So has the decision of May 1, 1987, when it was made clear that EPA has regulatory authority over DOE`s mixed waste. Suddenly two additional items became clear. First, DOE and its contractors were going to learn more about composition of low-level and low-level mixed waste than ever before. Second, low-level waste management was about to become a more focused, formal program, complete with needs for: (1) waste form identification, (2) program documentation; and (3) assurance that DOE`s waste does in fact comply with applicable requirements. The importance of the above items is clearly emphasized by the inclusion of Data Quality Objectives in the Waste Acceptance Criteria section of DOE 5820-2 Chapter 3 guidance called Data Quality Objectives, (DQO). Simply put, the purpose of the DQO is to identify the quality (and quantity) of information necessary to convince a regulator or decision maker that enough is known about DOE`s low-level and low-level mixed waste to allow safe disposal. The main objectives of the DOE and EPA shallow land burial requirements are to: (1) generate, with documented evidence, waste forms which are chemically inert and immobile, such that the waste will not tend to move about in the disposal medium; (2) select a disposal medium which would not let the wastes move about anyway; and (3) build some barriers around the wastes as emplaced in burial grounds, to provide additional assurance that buried wastes will stay in place. Compliance with these requirements must be demonstrated by quality data which describes the entire series of compliance activities.

  13. 75 FR 9142 - Information Assurance Scholarship Program (IASP)

    Science.gov (United States)

    2010-03-01

    ...: ``Individuals or households,'' specifically college students at institutions designated as CAE/IAEs who are...) Admits as regular students only individuals who possess a certificate of graduation from a school... recruitment students and working with students during the application process. Principal Investigators...

  14. 40 CFR 265.19 - Construction quality assurance program.

    Science.gov (United States)

    2010-07-01

    ... components, where applicable: (i) Foundations; (ii) Dikes; (iii) Low-permeability soil liners; (iv... fills for compacted soil liners, using the same compaction methods as in the full-scale unit, to ensure... requirement is waived where data are sufficient to show that a constructed soil liner meets the...

  15. Developing a Framework for Evaluating Organizational Information Assurance Metrics Programs

    Science.gov (United States)

    2007-03-01

    security effectiveness is speculative at best.”  How to Measure.    Leedy  and  Ormrod  (2005) mention several properties that measurement  must have in order...Nominal data provides the least information, while ratio  data provides the most (McClave and Benson, 2003;  Leedy  and  Ormrod , 2005).    72...attempts to draw a conclusion, which those instances would  support ( Leedy  and  Ormrod , 2005).  Soft Issues    Even though there are many things that can be

  16. Quality Assurance Assessment of the F-35 Lightning II Program

    Science.gov (United States)

    2013-09-30

    their annual Production Readiness Reviews ( PRR ). These reviews serve as a LRIP risk management tool conducted with the prime contractor and...critical suppliers during their annual Production Readiness Reviews ( PRR ). These reviews serve as a LRIP risk management tool conducted with the prime

  17. Industrial Modernization Incentives Program. Phase 2. Automated Quality Assurance System

    Science.gov (United States)

    1989-06-01

    2403 NAMNAME PERFORMING ORGANIZATION ILOFFICE SYMSOL 7&. NAME OF MONITORING ORGANIZATION4 Teledyne CAE TCAE ASD/YZD * G&. 40011114 (Cloy. staf Wi ZIP...SUBjECT TERMS IXonEnue an ?Wqvefle it metcuar and identify by black numberi3 IL AU sue. oG AQAS TCAE QuaIi ty 1MWI I Teledyne CAE I.A"TRACT (Conti an...report covers work performed under Contract F33657-86-C-2024 from September 1986 through January 1989. The contract with Teledyne CAE ( TCAE ), Toledo

  18. Emergence Of A Quality Assurance Program For Probiotic Supplemented Foods

    OpenAIRE

    Sarkar, S

    2013-01-01

    In recent year consumer’s inclination towards natural and health-promoting foods have led to projection of probiotics as a new ingredient in functional food market. In absence of any worldwide regulation, probiotic containing foods available in the market are often of poor quality and did not meet the desired level of viable microorganisms, required for exhibiting health benefits. Presently, no globally accepted regulations for probiotic containing foods have been establi...

  19. 10 CFR 72.144 - Quality assurance program.

    Science.gov (United States)

    2010-01-01

    ... NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSING REQUIREMENTS FOR THE INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE Quality... holder, and applicant for a CoC shall identify the structures, systems, and components to be covered...

  20. Quality Assurance Program Plan (QAPP) Waste Management Project

    Energy Technology Data Exchange (ETDEWEB)

    HORHOTA, M.J.

    2000-12-21

    The Waste Management Project (WMP) is committed to excellence in our work and to delivering quality products and services to our customers, protecting our employees and the public and to being good stewards of the environment. We will continually strive to understand customer requirements, perform services, and activities that meet or exceed customer expectations, and be cost-effective in our performance. The WMP maintains an environment that fosters continuous improvement in our processes, performance, safety and quality. The achievement of quality will require the total commitment of all WMP employees to our ethic that Quality, Health and Safety, and Regulatory Compliance must come before profits. The successful implementation of this policy and ethic requires a formal, documented management quality system to ensure quality standards are established and achieved in all activities. The following principles are the foundation of our quality system. Senior management will take full ownership of the quality system and will create an environment that ensures quality objectives are met, standards are clearly established, and performance is measured and evaluated. Line management will be responsible for quality system implementation. Each organization will adhere to all quality system requirements that apply to their function. Every employee will be responsible for their work quality, to work safely and for complying with the policies, procedures and instructions applicable to their activities. Quality will be addressed and verified during all phases of our work scope from proposal development through closeout including contracts or projects. Continuous quality improvement will be an ongoing process. Our quality ethic and these quality principles constantly guide our actions. We will meet our own quality expectations and exceed those of our customers with vigilance, commitment, teamwork, and persistence.

  1. Management of National Nuclear Power Programs for assured safety

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, T.J. (ed.)

    1985-01-01

    Topics discussed in this report include: nuclear utility organization; before the Florida Public Service Commission in re: St. Lucie Unit No. 2 cost recovery; nuclear reliability improvement and safety operations; nuclear utility management; training of nuclear facility personnel; US experience in key areas of nuclear safety; the US Nuclear Regulatory Commission - function and process; regulatory considerations of the risk of nuclear power plants; overview of the processes of reliability and risk management; management significance of risk analysis; international and domestic institutional issues for peaceful nuclear uses; the role of the Institute of Nuclear Power Operations (INPO); and nuclear safety activities of the International Atomic Energy Agency (IAEA).

  2. Análises de protocolos de braquiterapia, por alta taxa de dose, do controle de qualidade de alguns serviços locais, baseados no TG40, TG56 e ARCAL XXX Analysis of the high dose rate brachytherapy protocols of quality assurance programs of some local services, based on TG40, TG56 and ARCAL XXX.

    Directory of Open Access Journals (Sweden)

    Carmen S. Guzmán Calcina

    2001-08-01

    Full Text Available A braquiterapia por alta taxa de dose está recebendo atenção considerável na maioria dos países. Por isso, nos serviços que utilizam este equipamento exige-se que o desenvolvimento de um programa de controle de qualidade seja cada vez mais rigoroso, para garantir não apenas a segurança aos pacientes, mas também aos operadores e demais envolvidos. Este trabalho tem por objetivos fazer um levantamento dos tipos de testes para um equipamento de braquiterapia por alta taxa de dose, propostos pelos protocolos oficiais publicados (TG40, TG56 e ARCAL XXX e avaliar os tipos de testes que atualmente são realizados por alguns serviços de radioterapia, comparando-os com aqueles apresentados nos protocolos citados. Das análises feitas, observou-se que: a quanto aos protocolos oficiais, o TG56 é mais completo que o TG40 e o ARCAL XXX; b quanto às instituições analisadas, estas em geral se basearam no TG56 para elaborar seus próprios protocolos, os quais demonstraram ter também concordância com os outros já citados. Nestes protocolos, a inexistência dos testes anuais foi notada, o que pode ser explicado por sua aparição nas freqüências trimestral e semestral. Do produto deste estudo são apresentadas tabelas dos tipos de testes com suas respectivas freqüências de utilização, das quais um protocolo pode ser inferido para auxiliar na implementação, pelo menos, dos tipos de testes de controle de qualidade básicos e indispensáveis para o equipamento, garantindo, assim, um tratamento adequado aos pacientes e uma melhor segurança ao pessoal envolvido e, conseqüentemente, assegurando a garantia de qualidade na braquiterapia por alta taxa de dose.High dose rate brachytherapy has been increasingly recognized in most countries, and radiotherapy services using this equipment are encouraged to have a very efficient quality assurance program to ensure protection for patients, workers and other personnel involved. The objective of this

  3. QUALITY ASSURANCE COURSES IN VET (VOCATIONAL EDUCATION AND TRAINING FOR TOURISM ORGANISED BY THE CENTRE FOR TOURISM TRAINING

    Directory of Open Access Journals (Sweden)

    SILVIA IRIMIEA

    2015-10-01

    Full Text Available Quality Assurance Courses in VET (Vocational Education and Training for Tourism Organised by the Centre for Tourism Training. The article seeks to give utterance to the findings of the pilot course on quality assurance designed and organised by the Centre for Tourism Training (CTT as part of the AQUA.TS European Lifelong Learning project. The CTT has become involved in research and exchange of experience in the field of quality assurance driven by the educational policy-related background set out by the European documents and tools, including EQARF, EQAVET, the principles of lifelong learning and adult education. The main theoretic background to the present paper was assured by the European Commission documents regarding quality assurance in VET, while the experience and good practices acquired by the CTT have profoundly marked its quality assurance–oriented policy. Against this background, The Centre for Tourism Training (CTT of the Faculty of Geography, University Babes-Bolyai, Romania, delivered a pilot training course on Quality Assurance in VET during 16 March and 10 April 2015. The training consisted of a theoretical knowledge-building module (16.03. 2015 – 27.03. 2015 and a practical module (30.03.2015 -10.04.2015, the latter focused on the use of the AQUA.TS TOOLKIT, an IT device aimed at the self-evaluation of the quality of performance of trainers and training providers, whose efficiency was tested during the organised training program.

  4. Mission assurance increased with regression testing

    Science.gov (United States)

    Lang, R.; Spezio, M.

    Knowing what to test is an important attribute in any testing campaign, especially when it has to be right or the mission could be in jeopardy. The New Horizons mission, developed and operated by the John Hopkins University Applied Physics Laboratory, received a planned major upgrade to their Mission Operations and Control (MOC) ground system architecture. Early in the mission planning it was recognized that the ground system platform would require an upgrade to assure continued support of technology used for spacecraft operations. With the planned update to the six year operational ground architecture from Solaris 8 to Solaris 10, it was critical that the new architecture maintain critical operations and control functions. The New Horizons spacecraft is heading to its historic rendezvous with Pluto in July 2015 and then proceeding into the Kuiper Belt. This paper discusses the Independent Software Acceptance Testing (ISAT) Regression test campaign that played a critical role to assure the continued success of the New Horizons mission. The New Horizons ISAT process was designed to assure all the requirements were being met for the ground software functions developed to support the mission objectives. The ISAT team developed a test plan with a series of test case designs. The test objectives were to verify that the software developed from the requirements functioned as expected in the operational environment. As the test cases were developed and executed, a regression test suite was identified at the functional level. This regression test suite would serve as a crucial resource in assuring the operational system continued to function as required with such a large scale change being introduced. Some of the New Horizons ground software changes required modifications to the most critical functions of the operational software. Of particular concern was the new MOC architecture (Solaris 10) is Intel based and little endian, and the legacy architecture (Solaris 8) was SPA

  5. Assuring health coverage for all in India.

    Science.gov (United States)

    Patel, Vikram; Parikh, Rachana; Nandraj, Sunil; Balasubramaniam, Priya; Narayan, Kavita; Paul, Vinod K; Kumar, A K Shiva; Chatterjee, Mirai; Reddy, K Srinath

    2015-12-12

    Successive Governments of India have promised to transform India's unsatisfactory health-care system, culminating in the present government's promise to expand health assurance for all. Despite substantial improvements in some health indicators in the past decade, India contributes disproportionately to the global burden of disease, with health indicators that compare unfavourably with other middle-income countries and India's regional neighbours. Large health disparities between states, between rural and urban populations, and across social classes persist. A large proportion of the population is impoverished because of high out-of-pocket health-care expenditures and suffers the adverse consequences of poor quality of care. Here we make the case not only for more resources but for a radically new architecture for India's health-care system. India needs to adopt an integrated national health-care system built around a strong public primary care system with a clearly articulated supportive role for the private and indigenous sectors. This system must address acute as well as chronic health-care needs, offer choice of care that is rational, accessible, and of good quality, support cashless service at point of delivery, and ensure accountability through governance by a robust regulatory framework. In the process, several major challenges will need to be confronted, most notably the very low levels of public expenditure; the poor regulation, rapid commercialisation of and corruption in health care; and the fragmentation of governance of health care. Most importantly, assuring universal health coverage will require the explicit acknowledgment, by government and civil society, of health care as a public good on par with education. Only a radical restructuring of the health-care system that promotes health equity and eliminates impoverishment due to out-of-pocket expenditures will assure health for all Indians by 2022--a fitting way to mark the 75th year of India

  6. Quality assurance management plan special analytical support

    Energy Technology Data Exchange (ETDEWEB)

    Myers, M.L.

    1997-01-30

    It is the policy of Special Analytical Support (SAS) that the analytical aspects of all environmental data generated and processed in the laboratory, subject to the Environmental Protection Agency (EPA), U.S. Department of Energy (DOE), WDOE or other project specific requirements, be of known and acceptable quality. It is the intention of this QAPP to establish and assure that an effective quality controlled management system is maintained in order to meet the quality requirements of the intended use(s) of the data.

  7. Integrating Safety and Mission Assurance in Design

    Science.gov (United States)

    Cianciola, Chris; Crane, Kenneth

    2008-01-01

    This presentation describes how the Ares Projects are learning from the successes and failures of previous launch systems in order to maximize safety and reliability while maintaining fiscal responsibility. The Ares Projects are integrating Safety and Mission Assurance into design activities and embracing independent assessments by Quality experts in thorough reviews of designs and processes. Incorporating Lean thinking into the design process, Ares is also streamlining existing processes and future manufacturing flows which will yield savings during production. Understanding the value of early involvement of Quality experts, the Ares Projects are leading launch vehicle development into the 21st century.

  8. Applying Business Process Reengineering to the Marine Corps Information Assurance Certification and Accreditation Process

    Science.gov (United States)

    2009-09-01

    Database Management System DATO : Denial of Authority To Operate DIACAP: DoD Information Assurance Certification and Accreditation Program DII...level of risk, based on the implementation of an approved set of technical, managerial, and procedural safeguards. (CNSSI, 2006, p. 2) IA...concerned with risk elimination but rather risk minimization. The need for IA C&A in USMC Information Technology (IT) systems is based on the need to

  9. A Concept for Continuous Monitoring that Reduces Redundancy in Information Assurance Processes

    Science.gov (United States)

    2011-09-01

    Defense DAA Designated Accrediting Authority DATO Denial of Authorization to Operate DIACAP DoD Information Assurance Certification and...SFS) Program. This material is based on work supported by the National Science Foundation under Grant DUE-0414102. To Professor Cynthia Irvine, the...organization-specific registration tasks are performed. The baseline IA controls are generated from the DoDI 8500.2 based on the type and category

  10. Health information management for research and quality assurance: the Comprehensive Renal Transplant Research Information System.

    Science.gov (United States)

    Famure, Olusegun; Phan, Nicholas Anh-Tuan; Kim, Sang Joseph

    2014-01-01

    The Kidney Transplant Program at the Toronto General Hospital uses numerous electronic health record platforms housing patient health information that is often not coded in a systematic manner to facilitate quality assurance and research. To address this, the comprehensive renal transplant research information system was conceived by a multidisciplinary healthcare team. Data analysis from comprehensive renal transplant research information system presented at programmatic retreats, scientific meetings, and peer-reviewed manuscripts contributes to quality improvement and knowledge in kidney transplantation.

  11. Quality Assurance in Nuclear Power Plants; La garantia de calidad en la Centrales Nucleares

    Energy Technology Data Exchange (ETDEWEB)

    Zamarron Casinello, J. M. (CC.AA. Almaraz-Trillo); Gasca Pinilla, R. (Asociacion Nuclear Asco-Vandellos II); Sala Candela, A. (IBERDROLA); Valle Pena (NUCLENOR); Ruiz Rodriguez, C. (UNION FENOSA)

    2000-07-01

    In 1970, 10CFR50 Appendix B. Quality Assurance Criteria for Nuclear Power Plants & Fuel Reprocessing Plants, was approved in USA. This is based on 18 criteria and requires American nuclear power plants to establish as quickly as possible a Quality Assurance Program (QAP) specifying how to comply with the criteria contained in this Appendix. The Ministry of Industry required that this standard be observed in Spanish plants. In The first-generation plants (Jose Cabrera, Santa Maria de Garona and Vandellos 1), which were built before this new standard was developed, the concept of Quality Assurance has only been applied to the operating phase, whereas in second-generation plants (Almaraz, Asco3 and Cofrentes) and third-generation plants (Vandellos 2 and Trillo), the concept was applied from the very beginning of the project: design phases, construction and finally plant operation. In 1979, the IAEA publihed practical code 50-C-QA as an international reference document. It contains 13 criteria that coincide with and complement those established in Appendex B of 10CFR50. As a result, the nuclear power plants in all neighboring countries will be enforcing similar Quality Assurance criteria. (Author)

  12. Quality assurance for nonradiographic radiotherapy localization and positioning systems: report of Task Group 147.

    Science.gov (United States)

    Willoughby, Twyla; Lehmann, Joerg; Bencomo, Jose A; Jani, Shirish K; Santanam, Lakshmi; Sethi, Anil; Solberg, Timothy D; Tome, Wolfgang A; Waldron, Timothy J

    2012-04-01

    New technologies continue to be developed to improve the practice of radiation therapy. As several of these technologies have been implemented clinically, the Therapy Committee and the Quality Assurance and Outcomes Improvement Subcommittee of the American Association of Physicists in Medicine commissioned Task Group 147 to review the current nonradiographic technologies used for localization and tracking in radiotherapy. The specific charge of this task group was to make recommendations about the use of nonradiographic methods of localization, specifically; radiofrequency, infrared, laser, and video based patient localization and monitoring systems. The charge of this task group was to review the current use of these technologies and to write quality assurance guidelines for the use of these technologies in the clinical setting. Recommendations include testing of equipment for initial installation as well as ongoing quality assurance. As the equipment included in this task group continues to evolve, both in the type and sophistication of technology and in level of integration with treatment devices, some of the details of how one would conduct such testing will also continue to evolve. This task group, therefore, is focused on providing recommendations on the use of this equipment rather than on the equipment itself, and should be adaptable to each user's situation in helping develop a comprehensive quality assurance program.

  13. Quality Assurance of Quality Assurance Agencies from an Asian Perspective: Regulation, Autonomy and Accountability

    Science.gov (United States)

    Hou, Angela Yung-Chi; Ince, Martin; Tsai, Sandy; Chiang, Chung Lin

    2015-01-01

    As quality guardians of higher education, quality assurance agencies are required to guarantee the credibility of the review process and to ensure the objectivity and transparency of their decisions and recommendations. These agencies are therefore expected to use a range of internal and external approaches to prove the quality of their review…

  14. Model Based Mission Assurance: Emerging Opportunities for Robotic Systems

    Science.gov (United States)

    Evans, John W.; DiVenti, Tony

    2016-01-01

    The emergence of Model Based Systems Engineering (MBSE) in a Model Based Engineering framework has created new opportunities to improve effectiveness and efficiencies across the assurance functions. The MBSE environment supports not only system architecture development, but provides for support of Systems Safety, Reliability and Risk Analysis concurrently in the same framework. Linking to detailed design will further improve assurance capabilities to support failures avoidance and mitigation in flight systems. This also is leading new assurance functions including model assurance and management of uncertainty in the modeling environment. Further, the assurance cases, a structured hierarchal argument or model, are emerging as a basis for supporting a comprehensive viewpoint in which to support Model Based Mission Assurance (MBMA).

  15. Assessment Report Sandia National Laboratories Fuel Cycle Technologies Quality Assurance Evaluation of FY15 SNL FCT M2 Milestone Deliverables

    Energy Technology Data Exchange (ETDEWEB)

    Appel, Gordon John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2016-05-01

    Sandia National Laboratories (SNL) Fuel Cycle Technologies (FCT) program activities are conducted in accordance with FCT Quality Assurance Program Document (FCT-QAPD) requirements. The FCT-QAPD interfaces with SNL approved Quality Assurance Program Description (SNL-QAPD) as explained in the Sandia National Laboratories QA Program Interface Document for FCT Activities (Interface Document). This plan describes SNL's FY16 assessment of SNL's FY15 FCT M2 milestone deliverable's compliance with program QA requirements, including SNL R&A requirements. The assessment is intended to confirm that SNL's FY15 milestone deliverables contain the appropriate authenticated review documentation and that there is a copy marked with SNL R&A numbers.

  16. Comparative analysis of structural concrete quality assurance practices on nine nuclear power plant construction projects. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Willenbrock, J.H.; Thomas, H.R. Jr.; Burati, J.L. Jr.

    1978-06-01

    The basic objective of this research effort was to perform a comparative analysis of the Quality Assurance practices related to the structural concrete phase on nine nuclear power plant projects which are (or have been) under construction in the United States in the past ten years. This analysis identified the response of each Quality Assurance program to the applicable criteria of 10 CFR Part 50, Appendix B as well as to the pertinent regulatory requirements and industry standards. The major emphasis was placed on the construction aspects of the structural concrete phase of each project. The engineering and design aspects were examined whenever they interfaced with the construction aspects. For those aspects of the Quality Assurance system which can be considered managerial in nature (i.e., organizational relationships, types of Quality Assurance programs, corrective action procedures, etc.) an attempt has been made to present the alternative approaches that were identified. For those aspects of the Quality Assurance system which are technical in nature (i.e., the frequency of testing for slump, compressive strength, etc.) an attempt has been made to present a comparative analysis between projects and in relation to the recommended or mandated practices presented in the appropriate industry codes and standards.

  17. Quality-assurance plan for water-resources activities of the U. S. Geological Survey in Montana--1991

    Science.gov (United States)

    Moreland, Joe A.

    1991-01-01

    As the Nation's principal earth-science information agency, the U.S. Geological Survey has developed a worldwide reputation for collecting accurate data and producing factual, impartial interpretive reports. To ensure continued confidence in the pro- ducts, the Water Resources Division of the U.S. Geological Survey has implemented a policy that all scientific work will be performed in accordance with a centrally managed quality-assurance program. The formal policy for quality assurance within the Montana District was established and documented in USGS Open-File Report 91-194. This report has been revised to reflect changes in personnel and organi- zational structure that have occurred since 1991. Quality assurance is formalized by describing organization and operational responsibilities, the quality-assurance policy, and the quality- assurance responsibilities for performing District functions. The District conducts its work through offices in Helena, Billings, Kalispell, and Fort Peck. Data-collection programs and interpretive studies are conducted by three operating sections and four support units. Discipline specialists provide technical advice and assistance. Management advisors provide guidance on various personnel issues and support functions.

  18. Quality-assurance plan for water-resources activities of the U.S. Geological Survey in Montana--1995

    Science.gov (United States)

    Moreland, Joe A.

    1995-01-01

    As the Nation's principal earth-science information agency, the U.S. Geological Survey has developed a worldwide reputation for collecting accurate data and producing factual, impartial interpretive reports. To ensure continued confidence in the pro- ducts, the Water Resources Division of the U.S. Geological Survey has implemented a policy that all scientific work will be performed in accordance with a centrally managed quality-assurance program. The formal policy for quality assurance within the Montana District was established and documented in USGS Open-File Report 91-194. This report has been revised to reflect changes in personnel and organi- zational structure that have occurred since 1991. Quality assurance is formalized by describing organization and operational responsibilities, the quality-assurance policy, and the quality- assurance responsibilities for performing District functions. The District conducts its work through offices in Helena, Billings, Kalispell, and Fort Peck. Data-collection programs and interpretive studies are conducted by three operating sections and four support units. Discipline specialists provide technical advice and assistance. Management advisors provide guidance on various personnel issues and support functions.

  19. Comparative analysis of structural concrete quality assurance practices on three fossil fuel power plant construction projects. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Willenbrock, J.H.; Thomas, H.R. Jr.; Burati, J.L. Jr.

    1978-06-01

    The basic objective of this research effort was to perform a comparative analysis of the Quality Assurance practices related to the structural concrete phase on three fossil fuel power plant projects which are (or have been) under construction in the United States in the past ten years. This analysis identified the response of each Quality Assurance program to criteria similar to those which apply on nuclear power plant projects. The major emphasis was placed on the construction aspects of the structural concrete phase of each project. The engineering and design aspects were examined whenever they interfaced with the construction aspects. For those aspects of the Quality Assurance system which can be considered managerial in nature (i.e., organizational relationships, types of Quality Assurance programs, corrective action procedures, etc.) an attempt has been made to present the alternative approaches that were identified. For those aspects of the Quality Assurance system which are technical in nature (i.e., the frequency of testing for slump, compressive strength, etc.) an attempt has been made to present a comparative analysis between projects and in relation to the recommended or mandated practices presented in the appropriate industry codes and standards.

  20. Towards Run-time Assurance of Advanced Propulsion Algorithms

    Science.gov (United States)

    Wong, Edmond; Schierman, John D.; Schlapkohl, Thomas; Chicatelli, Amy

    2014-01-01

    This paper covers the motivation and rationale for investigating the application of run-time assurance methods as a potential means of providing safety assurance for advanced propulsion control systems. Certification is becoming increasingly infeasible for such systems using current verification practices. Run-time assurance systems hold the promise of certifying these advanced systems by continuously monitoring the state of the feedback system during operation and reverting to a simpler, certified system if anomalous behavior is detected. The discussion will also cover initial efforts underway to apply a run-time assurance framework to NASA's model-based engine control approach. Preliminary experimental results are presented and discussed.

  1. Quality Assurance: Strategic Choices for Higher Education in Turkey

    Directory of Open Access Journals (Sweden)

    Mahmut ÖZER

    2011-01-01

    Full Text Available As the number of students and higher education institutions in the world increases and there is a growing difficulty in financing the higher education systems, decision-makers have begun to show more interest in quality assurance. As quality assurance is given special attention in European countries, developing countries such as Turkey are interested in importing quality assurance systems. It is not possible to set quality assurance without sensitivity toward quality and without having quality as a cultural practice. The most likely encountered quality assurance approach in the world is that the higher education institution itself is responsible for its quality. In addition, external quality assurance procedures used are based on (academic peer review rather than on bureaucratic evaluations. Moreover, there is a lively debate across the world regarding the bureaucratic regulations of the quality assurance agencies and institutions that restrict the autonomy of higher education institutions. Without taking into consideration of the existing centralized structure of the higher education system in Turkey, of meeting social demands for the higher education, and of current higher education enrollment rates, the possible establishment of a quality assurance mechanism that may have sanctions on universities in Turkey is a threat to already limited autonomy of universities and is having a risk of additional bureaucratic burden. By laying out the roles and responsibilities of Turkish Council of Higher Education, the government and universities, this article discusses policies that should be adopted regarding the quality assurance.

  2. NARAC SOFTWARE QUALITY ASSURANCE: ADAPTING FORMALISM TO MEET VARYING NEEDS

    Energy Technology Data Exchange (ETDEWEB)

    Walker, H; Nasstrom, J S; Homann, S G

    2007-11-20

    The National Atmospheric Release Advisory Center (NARAC) provides tools and services that predict and map the spread of hazardous material accidentally or intentionally released into the atmosphere. NARAC is a full function system that can meet a wide range of needs with a particular focus on emergency response. The NARAC system relies on computer software in the form of models of the atmosphere and related physical processes supported by a framework for data acquisition and management, user interface, visualization, communications and security. All aspects of the program's operations and research efforts are predicated to varying degrees on the reliable and correct performance of this software. Consequently, software quality assurance (SQA) is an essential component of the NARAC program. The NARAC models and system span different levels of sophistication, fidelity and complexity. These different levels require related but different approaches to SQA. To illustrate this, two different levels of software complexity are considered in this paper. As a relatively simple example, the SQA procedures that are being used for HotSpot, a straight-line Gaussian model focused on radiological releases, are described. At the other extreme, the SQA issues that must be considered and balanced for the more complex NARAC system are reviewed.

  3. Inquiry, Evidence, and Excellence: The Promise and Practice of Quality Assurance. A Festschrift in Honor of Frank B. Murray

    Science.gov (United States)

    LaCelle-Peterson, Mark, Ed.; Rigden, Diana, Ed.

    2012-01-01

    The overall aim of this volume of essays is to honor Frank B. Murray's commitments to empirically-based quality assurance and to the development of increasingly effective systems of quality control in educator preparation programs. As the editors approached the authors with the invitation to contribute an essay, two characteristic aspects of…

  4. Duke University's Quality Appearance Program

    Science.gov (United States)

    Jackson, Joe

    2008-01-01

    The Grounds Services Unit at Duke University has implemented a new program that involves a process of self evaluation, which embraces the concept of perpetual and continuous improvement. The Quality Appearance Program (QAP) embellishes and expands upon the Quality Assurance Program concept, but with a twist to grounds management improvement…

  5. Requirements of a Better Secure Program Coding

    Directory of Open Access Journals (Sweden)

    Marius POPA

    2012-01-01

    Full Text Available Secure program coding refers to how manage the risks determined by the security breaches because of the program source code. The papers reviews the best practices must be doing during the software development life cycle for secure software assurance, the methods and techniques used for a secure coding assurance, the most known and common vulnerabilities determined by a bad coding process and how the security risks are managed and mitigated. As a tool of the better secure program coding, the code review process is presented, together with objective measures for code review assurance and estimation of the effort for the code improvement.

  6. ATLAS Pixel IBL: Stave Quality Assurance

    CERN Document Server

    The ATLAS collaboration

    2014-01-01

    For Run 2 of the LHC a fourth innermost Pixel Detector layer on a smaller radius beam pipe has been installed in the ATLAS Detector to add redundancy against radiation damage of the current Pixel Detector and to ensure a high quality tracking and b-tagging performance of the Inner Detector over the coming years until the High Luminosity Upgrade. State of the art components have been produced and assembled onto support structures known as staves over the last two years. In total, 20 staves have been built and qualified in a designated Quality Assurance setup at CERN of which 14 have been integrated onto the beam pipe. Results from the testing are presented.

  7. Assured Mission Support Space Architecture (AMSSA) study

    Science.gov (United States)

    Hamon, Rob

    1993-01-01

    The assured mission support space architecture (AMSSA) study was conducted with the overall goal of developing a long-term requirements-driven integrated space architecture to provide responsive and sustained space support to the combatant commands. Although derivation of an architecture was the focus of the study, there are three significant products from the effort. The first is a philosophy that defines the necessary attributes for the development and operation of space systems to ensure an integrated, interoperable architecture that, by design, provides a high degree of combat utility. The second is the architecture itself; based on an interoperable system-of-systems strategy, it reflects a long-range goal for space that will evolve as user requirements adapt to a changing world environment. The third product is the framework of a process that, when fully developed, will provide essential information to key decision makers for space systems acquisition in order to achieve the AMSSA goal. It is a categorical imperative that military space planners develop space systems that will act as true force multipliers. AMSSA provides the philosophy, process, and architecture that, when integrated with the DOD requirements and acquisition procedures, can yield an assured mission support capability from space to the combatant commanders. An important feature of the AMSSA initiative is the participation by every organization that has a role or interest in space systems development and operation. With continued community involvement, the concept of the AMSSA will become a reality. In summary, AMSSA offers a better way to think about space (philosophy) that can lead to the effective utilization of limited resources (process) with an infrastructure designed to meet the future space needs (architecture) of our combat forces.

  8. Lexique risque sécurité, financement, assurance, réassurance

    CERN Document Server

    Lesobre, Jacques; Cave, Frances J.

    2008-01-01

    La mondialisation fait de la maîtrise du risque un enjeu majeur pour la pérennité et le développement de l'activité économique à l'échelle planétaire. Le lexique risque - français, anglais et américain, s'inscrit pleinement dans cette perspective. Avec plus de 12 000 termes et locutions et 3 000 abréviations et sigles, il répond aux incertitudes et incompréhensions terminologiques en matière de sécurité, de prévention, d'analyse et de contrôle des risques (y compris financiers), d'assurance et de réassurance. Les termes, même les plus ésotériques, sont désormais à votre portée.

  9. 42 CFR 440.390 - Assurance of transportation.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Assurance of transportation. 440.390 Section 440...-Equivalent Coverage § 440.390 Assurance of transportation. If a benchmark or benchmark-equivalent plan does not include transportation to and from medically necessary covered Medicaid services, the State...

  10. 42 CFR 431.53 - Assurance of transportation.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Assurance of transportation. 431.53 Section 431.53... Requirements § 431.53 Assurance of transportation. A State plan must— (a) Specify that the Medicaid agency will ensure necessary transportation for recipients to and from providers; and (b) Describe the methods...

  11. Study on Integrated Quality Assurance System in CIMS

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Integrated Quality Assurance System (IQAS) is an important part of CIMS.This paper introduces the architecture of IQAS,elaborates the philosophy of quality assurance and quality control in CIMS.A type of function model is proposed.Meanwhile, details of the model are described.

  12. Regulating and Quality-Assuring VET: International Developments. Research Report

    Science.gov (United States)

    Misko, Josie

    2015-01-01

    The opening-up of the market for education and training, including vocational education and training (VET), has increased the importance of regulation and quality assurance mechanisms in ensuring the integrity of qualifications. This report investigates approaches to the regulation and quality assurance of vocational education and training in a…

  13. Product assurance policies and procedures for flight dynamics software development

    Science.gov (United States)

    Perry, Sandra; Jordan, Leon; Decker, William; Page, Gerald; Mcgarry, Frank E.; Valett, Jon

    1987-01-01

    The product assurance policies and procedures necessary to support flight dynamics software development projects for Goddard Space Flight Center are presented. The quality assurance and configuration management methods and tools for each phase of the software development life cycles are described, from requirements analysis through acceptance testing; maintenance and operation are not addressed.

  14. 75 FR 57274 - Financial Management and Assurance; Government Auditing Standards

    Science.gov (United States)

    2010-09-20

    ... OFFICE Financial Management and Assurance; Government Auditing Standards AGENCY: Government...Jlowbookgao.gov . Public Law 67-13, 42 Stat. 20. James R. Dalkin, Director, Financial Management and Assurance... necessary changes. The Advisory Council includes experts in financial and performance auditing drawn...

  15. Quality Assurance of E-learning. ENQA Workshop Report 14

    Science.gov (United States)

    Grifoll, Josep; Huertas, Esther; Prades, Anna; Rodriguez, Sebastian; Rubin, Yuri; Mulder, Fred; Ossiannilsson, Ebba

    2010-01-01

    E-learning in the European Higher Education Area has stampeded its way to the foreground of the Quality Assurance (QA) forum, and has become a key issue among quality assurance agencies and institutions in the European Higher Education Area (EHEA). Because internet-based learning is currently such a relevant topic, there is a dire need for the…

  16. Internal Quality Assurance Benchmarking. ENQA Workshop Report 20

    Science.gov (United States)

    Blackstock, Douglas; Burquel, Nadine; Comet, Nuria; Kajaste, Matti; dos Santos, Sergio Machado; Marcos, Sandra; Moser, Marion; Ponds, Henri; Scheuthle, Harald; Sixto, Luis Carlos Velon

    2012-01-01

    The Internal Quality Assurance group of ENQA (IQA Group) has been organising a yearly seminar for its members since 2007. The main objective is to share experiences concerning the internal quality assurance of work processes in the participating agencies. The overarching theme of the 2011 seminar was how to use benchmarking as a tool for…

  17. Quality Assurance in South Africa: A Reply to John Mammen

    Science.gov (United States)

    le Grange, L.

    2006-01-01

    In this article I point out that prominence given to higher education quality assurance by contemporary states might be viewed in the context of the ascendance of neoliberalism over the past few decades and a concomitant culture of performativity. However, I argue for a shift in the angle of vision on performativity and quality assurance through a…

  18. Quality Assurance and Accreditation of Engineering Education in Jordan

    Science.gov (United States)

    Aqlan, Faisal; Al-Araidah, Omar; Al-Hawari, Tarek

    2010-01-01

    This paper provides a study of the quality assurance and accreditation in the Jordanian higher education sector and focuses mainly on engineering education. It presents engineering education, accreditation and quality assurance in Jordan and considers the Jordan University of Science and Technology (JUST) for a case study. The study highlights the…

  19. Cui Bono? The Relevance and Impact of Quality Assurance

    Science.gov (United States)

    Massaro, Vin

    2010-01-01

    External quality assurance of universities exists to assure society that higher education standards are adequate and, in an increasingly global market, that they are comparable internationally. Although society has accepted an implicit compact in giving autonomy to universities in return for their dispassionate service to it, there has been an…

  20. Quality assurance of absorbed energy in Charpy impact test

    Science.gov (United States)

    Rocha, C. L. F.; Fabricio, D. A. K.; Costa, V. M.; Reguly, A.

    2016-07-01

    In order to ensure the quality assurance and comply with standard requirements, an intralaboratory study has been performed for impact Charpy tests, involving two operators. The results based on ANOVA (Analysis of Variance) and Normalized Error statistical techniques pointed out that the execution of the tests is appropriate, because the implementation of quality assurance methods showed acceptable results.

  1. The Landscape of Quality Assurance in Distance Education

    Science.gov (United States)

    Scull, W. Reed; Kendrick, David; Shearer, Rick; Offerman, Dana

    2011-01-01

    Distance education permeates the field of professional and continuing education to such an extent that quality assurance (QA) is a topic no distance educator or administrator should avoid. Quality assurance is an issue not just for continuing education but also for higher education generally. Given the disruptive impact of distance education and…

  2. 10 CFR 4.24 - Assurances from institutions.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Assurances from institutions. 4.24 Section 4.24 Energy... from institutions. (a) In the case of a grant, loan or contract involving Federal financial assistance to an institution of higher education, the assurance required by § 4.21 shall extend to...

  3. A Rotational Blended Learning Model: Enhancement and Quality Assurance

    Science.gov (United States)

    Ghoul, Said

    2013-01-01

    Research on blended learning theory and practice is growing nowadays with a focus on the development, evaluation, and quality assurance of case studies. However, the enhancement of blended learning existing models, the specification of their online parts, and the quality assurance related specifically to them have not received enough attention.…

  4. Quality Management, Quality Assurance and Quality Control in Blood Establishments

    OpenAIRE

    Bolbate, N

    2008-01-01

    Quality terms and the roots of the matter are analyzed according to European Committee’s recommendations. Essence of process and product quality control as well as essence of quality assurance is described. Quality system’s structure including quality control, quality assurance and management is justified in the article.

  5. Quality Assurance of Joint Programmes. ENQA Workshop Report 19

    Science.gov (United States)

    Frederiks, Mark; Grifoll, Josep; Hiltunen, Kirsi; Hopbach, Achim

    2012-01-01

    In view of the Bologna ministerial conference to be held in April 2012 in Bucharest, ENQA organised a seminar in September 2011 on Quality Assurance of Joint Programmes in collaboration with the Austrian Accreditation Council (OAR). The purpose of this seminar was twofold: first, to analyse the experience already gained in quality assurance of…

  6. Quality assurance and evidence in career guidance in Europe

    DEFF Research Database (Denmark)

    Plant, Peter

    2011-01-01

    Quality assurance and evidence in career guidance in Europe is based on a particular, positivtic model. Other approaches are largely neglected.......Quality assurance and evidence in career guidance in Europe is based on a particular, positivtic model. Other approaches are largely neglected....

  7. Colonoscopy Quality Assurance in Ontario: Systematic Review and Clinical Practice Guideline

    Directory of Open Access Journals (Sweden)

    Jill Tinmouth

    2014-01-01

    Full Text Available Colonoscopy is fundamental to the diagnosis and management of digestive diseases and plays a key role in colorectal cancer (CRC screening and diagnosis. Therefore, it is important to ensure that colonoscopy is of high quality. The present guidance document updates the evidence and recommendations in Cancer Care Ontario’s 2007 Colonoscopy Standards, and was conducted under the aegis of the Program in Evidence-Based Care. It is intended to support quality improvement for colonoscopies for all indications, including follow-up to a positive fecal occult blood test, screening for individuals who have a family history of CRC and those at average risk, investigation for symptomatic patients, and surveillance of those with a history of adenomatous polyps or CRC. A systematic review was performed to evaluate the existing evidence concerning the following three key aspects of colonoscopy: physician endoscopist training and maintenance of competency; institutional quality assurance parameters; and colonoscopy quality indicators and auditable outcomes. Where appropriate, indicators were designated quality indicators (where there was sufficient evidence to recommend a specific target and auditable outcomes (insufficient evidence to recommend a specific target, but which should be monitored for quality assurance purposes. The guidance document may be used to support colonoscopy quality assurance programs to improve the quality of colonoscopy regardless of indication. Improvements in colonoscopy quality are anticipated to improve important outcomes in digestive diseases, such as reduction of the incidence of and mortality from CRC.

  8. Building Congruence Between Internal Quality Assurance and External Quality Assessment: The Algerian Experience

    Directory of Open Access Journals (Sweden)

    Mohamed MILIANI

    2013-12-01

    Full Text Available The Algerian higher education system has been undergoing a strong change that can be compared to a revolution to its structures, schemes, procedures ever since 2004: a date that corresponds to the launching of the ‘Licence-Master-Doctorate’ or ‘LMD’ reform. Not least of these procedures is the erection of a Quality system that started in 2010. Yet, one of the difficulties the implementation of the LMD system experienced, was due to the policy of slow and progressive setting up of new LMD learning schemes by universities from 2004 up to 2010 (date of last issued LMD training programs. The fact that universities were not forced to enter the new scheme was somehow detrimental to the overall policy’s coherence and advancement. Indeed, it took time for universities to switch from a dual system of university programs (old and LMD systems offered to freshmen to a single frame, namely that of the LMD. The concern for Quality was then on the Ministry’s agenda from 2008 first through an international conference on Quality Assurance that was held in Algiers under the aegis of the Ministry of Higher Education and Scientific Research. Part of the ministry’s strategic plan scheduled to go until 2030, is the procedure aiming at a quality system that consists of the following components: the LMD training package, the national qualifications framework, the quality assurance system, the quality assurance frame of reference, the national standards, and the key performance indicators.

  9. Formal Assurance Arguments: A Solution In Search of a Problem?

    Science.gov (United States)

    Graydon, Patrick J.

    2015-01-01

    An assurance case comprises evidence and argument showing how that evidence supports assurance claims (e.g., about safety or security). It is unsurprising that some computer scientists have proposed formalizing assurance arguments: most associate formality with rigor. But while engineers can sometimes prove that source code refines a formal specification, it is not clear that formalization will improve assurance arguments or that this benefit is worth its cost. For example, formalization might reduce the benefits of argumentation by limiting the audience to people who can read formal logic. In this paper, we present (1) a systematic survey of the literature surrounding formal assurance arguments, (2) an analysis of errors that formalism can help to eliminate, (3) a discussion of existing evidence, and (4) suggestions for experimental work to definitively answer the question.

  10. Assessment and Assurance of Microelectronics Packaging Technology of Microelectromechanical Systems (MEMS)

    Science.gov (United States)

    Ramesham, Rajeshuni

    2000-01-01

    technology and challenging issues in the packaging of hermetically sealed and non-hermetically sealed MEMS sensor devices based on silicon, poly-silicon, and other materials for microspacecraft applications considering the space environment and reliability assurance qualification guidelines in perspective. Acknowledgments: The above research work is supported by the NASA Electronics Parts and Packaging Program (NEPP) and performed by the Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA under a contract with the NASA - Code Q for the Office of Safety and Mission Assurance Program 323-79.

  11. Software quality assurance plan for the National Ignition Facility integrated computer control system

    Energy Technology Data Exchange (ETDEWEB)

    Woodruff, J.

    1996-11-01

    Quality achievement is the responsibility of the line organizations of the National Ignition Facility (NIF) Project. This Software Quality Assurance Plan (SQAP) applies to the activities of the Integrated Computer Control System (ICCS) organization and its subcontractors. The Plan describes the activities implemented by the ICCS section to achieve quality in the NIF Project`s controls software and implements the NIF Quality Assurance Program Plan (QAPP, NIF-95-499, L-15958-2) and the Department of Energy`s (DOE`s) Order 5700.6C. This SQAP governs the quality affecting activities associated with developing and deploying all control system software during the life cycle of the NIF Project.

  12. Product Quality Assurance for Off-Grid Lighting in Africa

    Energy Technology Data Exchange (ETDEWEB)

    World Bank; Mills, Evan; Mills, Evan

    2008-07-13

    Although the emergence of markets for high efficiency off-grid lighting technologies holds promise, realizing the potential of this opportunity on a long-term, sustainable basis requires careful attention to issues of product quality, consumer protection, and the potential for significant 'market spoiling', in anticipation of increases of sales of low cost, low performance off-grid lighting products. The goal of the Lighting Africa quality assurance workshop was to articulate strategies to mitigate the dangers of market spoiling and to explore ways to protect consumers from misleading advertising for sales of inferior, off-grid lighting products in the context of Lighting Africa's overarching objective to support the industry in developing a robust off-grid lighting market in Africa. The workshop resulted in the identification of two strategic approaches for meeting Lighting Africa quality assurance programmatic needs. The first strategy is intended to meet a short-term programmatic need for quality associated with requests for lighting products by bulk procurement agents, such as in a World Bank-financed project. The development of procurement specifications and test procedures that could be used in a quality/usability screening method in order to provide guidance for forthcoming large volume purchases emerged as the best solution to meet this need. Such approaches are used in World Bank-financed solar home systems (SHSs) projects in Bangladesh, Sri Lanka, and China, among others. However, unlike the SHSs which have multiple balance-of-system (BOS) components warranting the need for an array of specifications for individual components, stand alone lighting systems require specifications that are amenable to individual light points. To test this approach, Lighting Africa elected to use the technical specifications issued by the Photovoltaic Global Approval Program for solar lanterns that use CFL bulbs (PVRS11A) as the basis of qualifying such

  13. Quality Assurance in the European Higher Education Area: The Emergence of a German Market for Quality Assurance Agencies

    Science.gov (United States)

    Serrano-Velarde, Kathia E.

    2008-01-01

    Most European countries have introduced systematic quality assurance as part of an overall governance reform aimed at enhancing universities' autonomy. Researchers and economic entrepreneurs tend, however, to underestimate the political dimension of accreditation and evaluation when they consider the contribution of quality assurance to the…

  14. Dicty_cDB: FC-AP15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA sequence. 60 3e-05 1 BQ476680 |BQ476680.1 curculio4h01.g Curculio glandium ...cDNA Curculio glandium cDNA clone curculio4h01 3', mRNA sequence. 54 4e-05 2 CA845440 |CA845440.1 hab99h11.y

  15. Dicty_cDB: FC-AP24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hik*spnslslsksdvllsstmvntstklpsslmswiktel*llvhtvasnvtsltsng sillh*kltskevpeltpsslpsklltskpkllpslplrkstqeppnq...KKKKKKKKKKKKKKKKKKKKKKKKK Translated Amino Acid sequence (All Frames) Frame A: khik*spnslslsksdvllsstmvntstklpsslmswi

  16. Data Quality Assurance Techniques for a Monitoring and Diagnosis System

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    By researching the data quality problem in the monitoring and diagnosis system (MDS),the method of detecting non-condition data based on the development trend of equipment condition is proposed, and three requirements of criteria for detecting non-condition data: dynamic, syntheses and simplicity are discussed. According to the general mode of data management in MDS, a data quality assurance system (DQAS) comprising data quality monitoring, data quality diagnosis, detection criteria adjusting and artificial confirmation is set up. A route inspection system called MTREE realizes the DQAS. Aiming at vibration data of route inspection, two detecting criteria are made. One is the quality monitoring parameter, which is found through combining and optimizing some fundamental parameters by genetic programming (GP). The other is the quality diagnosis criterion, i. e. pseudo distance of Spectral-Energy-Vector (SEV) named Adjacent J-divergence, which indicates the variation degree of adjacent data's spectral energy distribution. Results show that DQAS, including these two criteria, is effective to improve the data quality of MDS.

  17. 6 CFR 21.7 - Assurances required.

    Science.gov (United States)

    2010-01-01

    ..., COLOR, OR NATIONAL ORIGIN IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE FROM THE... give reasonable guarantee that the applicant and all recipients of Federal financial assistance...

  18. The role of gap analyses in energy assurance planning.

    Science.gov (United States)

    Shea, Katherine

    2013-01-01

    Energy-related emergencies, such as power outages or interruptions to other energy supplies, can arise from a number of factors. Common causes include severe weather events--such as snowstorms, hurricanes, or summer storms with strong winds--as well as energy infrastructure that is overburdened, aging, or in need of repair. As past experience indicates, jurisdictions will continue to experience severe weather events, as well as confront infrastructure issues that make future power outages likely. As a result, state and local governments have turned to energy assurance planning, an energy-specific form of planning that helps jurisdictions prepare for and recover from energy emergencies. Energy assurance recognizes that power loss/disruption cannot be eradicated completely, but jurisdictions can mitigate the impact of power loss through effective planning. This article discusses the role of energy assurance planning and provides a description of what energy assurance means and why developing such plans at the state and local levels is important. In addition, this article discusses the role of statutory gap analyses in energy assurance planning and discusses how a gap analysis can be used by planners to identify trends and gaps in energy assurance. To provide context, a recently conducted statutory gap analysis analyzing national emergency backup power trends is provided as a case study. A summary of this project and key findings is included. Finally, this article briefly touches on legislation as an alternative to energy assurance planning, and provides summaries of recent legislative proposals introduced in the aftermath of Hurricane Sandy.

  19. The Columbia River Protection Supplemental Technologies Quality Assurance Project Plan

    Energy Technology Data Exchange (ETDEWEB)

    Fix, N. J.

    2007-01-10

    The U.S. Department of Energy (DOE) has conducted interim groundwater remedial activities on the Hanford Site since the mid-1990s for several groundwater contamination plumes. DOE established the Columbia River Protection Supplemental Technologies Project (Technologies Project) in 2006 to evaluate alternative treatment technologies. The objectives for the technology project are as follows: develop a 300 Area polyphosphate treatability test to immobilize uranium, design and test infiltration of a phosphate/apatite technology for Sr-90 at 100-N, perform carbon tetrachloride and chloroform attenuation parameter studies, perform vadose zone chromium characterization and geochemistry studies, perform in situ biostimulation of chromium studies for a reducing barrier at 100-D, and perform a treatability test for phytoremediation for Sr-90 at 100-N. This document provides the quality assurance guidelines that will be followed by the Technologies Project. This Quality Assurance Project Plan is based on the quality assurance requirements of DOE Order 414.1C, Quality Assurance, and 10 CFR 830, Subpart A--Quality Assurance Requirements as delineated in Pacific Northwest National Laboratory’s Standards-Based Management System. In addition, the technology project is subject to the Environmental Protection Agency (EPA) Requirements for Quality Assurance Project Plans (EPA/240/B-01/003, QA/R-5). The Hanford Analytical Services Quality Assurance Requirements Documents (HASQARD, DOE/RL-96-68) apply to portions of this project and to the subcontractors. HASQARD requirements are discussed within applicable sections of this plan.

  20. Study on the Operating Mechanism and Practice concerning Undergraduate Teaching Quality Assurance in the Chinese Agriculture-related Colleges and Universities

    Institute of Scientific and Technical Information of China (English)

    Zhongming; SHEN

    2015-01-01

    This paper analyzes the connotation of the undergraduate teaching quality assurance system in agriculture-related colleges and universities,and takes Southwest University Rongchang Campus for example to probe into the long-term operating mechanism of multidimensional integrated quality assurance system as well as the sound teaching quality monitoring and management system building assurance system and operational practice effect involving personnel training programs,teaching element control,supervision and control of the teaching process,supervision and control of teaching effectiveness,teaching assurance policy and system,teaching funding system,teaching technical support guarantee,and teaching environment building guarantee,with the purpose of providing a reference for the Chinese universities and colleges to improve the teaching quality.

  1. QAM: PROPOSED MODEL FOR QUALITY ASSURANCE IN CBSS

    Directory of Open Access Journals (Sweden)

    Latika Kharb

    2015-08-01

    Full Text Available Component-based software engineering (CBSE / Component-Based Development (CBD lays emphasis on decomposition of the engineered systems into functional or logical components with well-defined interfaces used for communication across the components. Component-based software development approach is based on the idea to develop software systems by selecting appropriate off-the-shelf components and then to assemble them with a well-defined software architecture. Because the new software development paradigm is much different from the traditional approach, quality assurance for component-based software development is a new topic in the software engineering research community. Because component-based software systems are developed on an underlying process different from that of the traditional software, their quality assurance model should address both the process of components and the process of the overall system. Quality assurance for component-based software systems during the life cycle is used to analyze the components for achievement of high quality component-based software systems. Although some Quality assurance techniques and component based approach to software engineering have been studied, there is still no clear and well-defined standard or guidelines for component-based software systems. Therefore, identification of the quality assurance characteristics, quality assurance models, quality assurance tools and quality assurance metrics, are under urgent need. As a major contribution in this paper, I have proposed QAM: Quality Assurance Model for component-based software development, which covers component requirement analysis, component development, component certification, component architecture design, integration, testing, and maintenance.

  2. Safety and Mission Assurance Knowledge Management Retention: Managing Knowledge for Successful Mission Operations

    Science.gov (United States)

    Johnson, Teresa A.

    2006-01-01

    Knowledge Management is a proactive pursuit for the future success of any large organization faced with the imminent possibility that their senior managers/engineers with gained experiences and lessons learned plan to retire in the near term. Safety and Mission Assurance (S&MA) is proactively pursuing unique mechanism to ensure knowledge learned is retained and lessons learned captured and documented. Knowledge Capture Event/Activities/Management helps to provide a gateway between future retirees and our next generation of managers/engineers. S&MA hosted two Knowledge Capture Events during 2005 featuring three of its retiring fellows (Axel Larsen, Dave Whittle and Gary Johnson). The first Knowledge Capture Event February 24, 2005 focused on two Safety and Mission Assurance Safety Panels (Space Shuttle System Safety Review Panel (SSRP); Payload Safety Review Panel (PSRP) and the latter event December 15, 2005 featured lessons learned during Apollo, Skylab, and Space Shuttle which could be applicable in the newly created Crew Exploration Vehicle (CEV)/Constellation development program. Gemini, Apollo, Skylab and the Space Shuttle promised and delivered exciting human advances in space and benefits of space in people s everyday lives on earth. Johnson Space Center's Safety & Mission Assurance team work over the last 20 years has been mostly focused on operations we are now beginning the Exploration development program. S&MA will promote an atmosphere of knowledge sharing in its formal and informal cultures and work processes, and reward the open dissemination and sharing of information; we are asking "Why embrace relearning the "lessons learned" in the past?" On the Exploration program the focus will be on Design, Development, Test, & Evaluation (DDT&E); therefore, it is critical to understand the lessons from these past programs during the DDT&E phase.

  3. 75 FR 5154 - Assurant, Inc., et al.; Notice of Application and Temporary Order

    Science.gov (United States)

    2010-02-01

    ... reinsurance contract. The Complaint alleged that Assurant violated the corporate reporting, recordkeeping, and... public reporting practices. The Complaint related to Assurant's inaccurate recording of income for...

  4. Assurance Technology Challenges of Advanced Space Systems

    Science.gov (United States)

    Chern, E. James

    2004-01-01

    The initiative to explore space and extend a human presence across our solar system to revisit the moon and Mars post enormous technological challenges to the nation's space agency and aerospace industry. Key areas of technology development needs to enable the endeavor include advanced materials, structures and mechanisms; micro/nano sensors and detectors; power generation, storage and management; advanced thermal and cryogenic control; guidance, navigation and control; command and data handling; advanced propulsion; advanced communication; on-board processing; advanced information technology systems; modular and reconfigurable systems; precision formation flying; solar sails; distributed observing systems; space robotics; and etc. Quality assurance concerns such as functional performance, structural integrity, radiation tolerance, health monitoring, diagnosis, maintenance, calibration, and initialization can affect the performance of systems and subsystems. It is thus imperative to employ innovative nondestructive evaluation methodologies to ensure quality and integrity of advanced space systems. Advancements in integrated multi-functional sensor systems, autonomous inspection approaches, distributed embedded sensors, roaming inspectors, and shape adaptive sensors are sought. Concepts in computational models for signal processing and data interpretation to establish quantitative characterization and event determination are also of interest. Prospective evaluation technologies include ultrasonics, laser ultrasonics, optics and fiber optics, shearography, video optics and metrology, thermography, electromagnetics, acoustic emission, x-ray, data management, biomimetics, and nano-scale sensing approaches for structural health monitoring.

  5. QART - the CERN facility for quality assurance

    CERN Multimedia

    Katarina Anthony

    2011-01-01

    How would your detector perform in a very high magnetic field? Or at 60°C and high humidity? Will it work for 10 or more years? Answering these questions requires specialised and thorough testing. This can be done at the Quality Assurance and Reliability Testing Laboratory (QART) - a top-notch testing facility based at CERN, providing invaluable support for CERN projects. The QART lab has become a service in 2011, and invites all projects to use its equipment and expertise.   A portable high-sensitivity infra-red thermal imaging video camera (top left) is used to observe the thermal profile of a silicon strip sensor (top right). The thermal images taken before (bottom left) and after (bottom right) applying voltage to the device clearly show a hot spot developing on the sensor, indicating a serious defect. The infra-red camera is an example of the variety of sophisticated equipment in the QART lab available to CERN projects for the analysis of problems and enviro...

  6. Idaho National Laboratory Emergency Readiness Assurance Plan - Fiscal Year 2015

    Energy Technology Data Exchange (ETDEWEB)

    Farmer, Carl J. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-01

    Department of Energy Order 151.1C, Comprehensive Emergency Management System requires that each Department of Energy field element documents readiness assurance activities, addressing emergency response planning and preparedness. Battelle Energy Alliance, LLC, as prime contractor at the Idaho National Laboratory (INL), has compiled this Emergency Readiness Assurance Plan to provide this assurance to the Department of Energy Idaho Operations Office. Stated emergency capabilities at the INL are sufficient to implement emergency plans. Summary tables augment descriptive paragraphs to provide easy access to data. Additionally, the plan furnishes budgeting, personnel, and planning forecasts for the next 5 years.

  7. Quality Assurance Tests of the CMS Endcap RPCs

    CERN Document Server

    Ahmed, Ijaz; Hamid Ansari, M; Irfan Asghar, M; Asghar, Sajjad; Awan, Irfan Ullah; Butt, Jamila; Hoorani, Hafeez R; Hussain, Ishtiaq; Khurshid, Taimoor; Muhammad, Saleh; Shahzad, Hassan; Aftab, Zia; Iftikhar, Mian; Khan, Mohammad Khalid; Saleh, M

    2008-01-01

    In this note, we have described the quality assurance tests performed for endcap Resistive Plate Chambers (RPCs) at two different sites, Pakistan Atomic Energy Commission (PAEC) and National Centre for Physics (NCP), in Pakistan. This paper describes various quality assurance tests both at the level of gas gaps and the chambers. The data has been obtained at different time windows during the large scale production of CMS RPCs of RE2/2 and RE2/3 type. In the quality assurance tests, we have investigated parameters like dark current, strip occupancy, cluster size and efficiency of RPCs.

  8. Quality assurance aspects of geotechnical practices for underground radioactive waste repositories

    Energy Technology Data Exchange (ETDEWEB)

    1989-01-01

    In August 1988, the National Research Council, through the Geotechnical Board and the Board on Radioactive Waste Management, held a colloquium to discuss the practice of quality assurance that is being implemented in the high-level radioactive waste storage program. The intent of the colloquium was to bring together program managers of the Department of Energy and Nuclear Regulatory Commission, to discuss with the technical community both the advantages and problems associated with applying current quality assurance practices to underground science and engineering. The colloquium program included talks from 14 individuals that provided a variety of perspectives on both programmatic and technical issues. The talks initiated extended discussions from the 71 participants representing 7 government agencies, 8 academic institutions, and 22 private companies. The competencies of the participants were many and varied including, among others, geochemistry, hydrology, geotechnical engineering, computer programming, engineering and structural geology, underground design and construction, rock mechanics, laboratory testing, systems engineering, nuclear engineering, law, and environmental science. Based on a transcript of the meeting, this report summarizes the talks and discussions which took place. 2 figs.

  9. Quality assurance plan for the High Level Controller for the CBMS Block II

    Energy Technology Data Exchange (ETDEWEB)

    Reid, R.W.; Robbins, I.F.; Stewart, K.A.; Terry, C.L.; Whitaker, R.A.; Wolf, D.A.; Zager, J.C.

    1997-09-01

    This document establishes the software Quality Assurance Plan (QAP) for the High Level Controller for the Chemical and Biological Mass Spectrometer Block II (HLC/CBMS-II) project activities under the Computing, Robotics, and Education (CRE) Directorate management. It defines the requirements and assigns responsibilities for ensuring, with a high degree of confidence, that project objectives will be achieved as planned. The CBMS Program was awarded to ORNL by the US Army Chemical and Biological Defense command, Aberdeen Proving Ground, Maryland, to design the next version (Block II) mass spectrometer for the detection and identification of chemical and biological warfare agents, to fabricate four engineering prototypes, and to construct eight preproduction units. Section 1 of this document provides an introduction to the HLC/CBMS-II project QAP. Sections 2 and 3 describe the specific aspects of quality assurance as applicable to the project. Section 4 reviews the project approach to risk management. The Risk Management Matrix given in Appendix A is a tool to assess, prioritize, and prevent problems before they occur; therefore, the matrix will be reviewed and revised on a periodic basis. Appendix B shows the quality assurance criteria of the DOE Order 5700.6C and their applicability to this project.

  10. Reform of Teacher Education and the Problem of Quality Assurance.

    Science.gov (United States)

    Barr, Robert D.

    1987-01-01

    Educational reform developments focusing on academic issues are contrasted with those emphasizing teacher performance. The concept of quality assurance in teacher education is considered, as is using student achievement as an indicator of teacher effectiveness. (Author/MT)

  11. PROCESS AND PRODUCT QUALITY ASSURANCE MEASURES IN CMMI

    Directory of Open Access Journals (Sweden)

    Mahmoud Khraiwesh

    2014-10-01

    Full Text Available Process and product quality assurance are very important aspects in development of software. Process and product quality assurance monitor the software engineering processes and methods to ensure quality. It is the process of confirming and verifying that whether services and products meet the customer expectation or not. This research will identify general measures for the specific goals and its specific practices of Process and Product Quality Assurance Process Area in Capability Maturity Model Integration (CMMI. CMMI is developed by Software Engineering Institute (SEI in Carnegie Mellon University in USA. CMMI is a framework for assessment and improvement of computer information systems. The procedure we used to determine the measures is to apply the Goal Questions Metrics (GQM approach to the two specific goals and its four specific practices of Process and Product Quality Assurance Process Area in CMMI.

  12. [Quality assurance in oncology: experiences of an ISO certification].

    Science.gov (United States)

    Szentirmay, Zoltán; Cseh, Lujza; Ottó, Szabolcs; Kásler, Miklós

    2002-01-01

    The ISO 9001 quality assurance of the National Institute of Oncology has been achieved successfully. We give an account of the brief history and the structure of the assurance system of the Institute, the process of setting our goals, and also the experience gained from drafting ISO 9001 handbook and flowcharts. Apart from the bureaucratic nature of quality assurance, it is a good opportunity for us to investigate our everyday work, put it into orderly manner and work more reliably. Experience has shown that the introduction of a quality assurance system increases the level of patient care, the documentation helps the Institute or some of its departments, or even individuals prevent law suits, and serves as a sound basis for proposing promotion, salary increases and bonuses, or even honors.

  13. Master Pump Shutdown MPS Software Quality Assurance Plan (SQAP)

    Energy Technology Data Exchange (ETDEWEB)

    BEVINS, R.R.

    2000-09-20

    The MPSS Software Quality Assurance (SQAP) describes the tools and strategy used in the development of the MPSS software. The document also describes the methodology for controlling and managing changes to the software.

  14. Quality assurance: Importance of systems and standard operating procedures.

    Science.gov (United States)

    Manghani, Kishu

    2011-01-01

    It is mandatory for sponsors of clinical trials and contract research organizations alike to establish, manage and monitor their quality control and quality assurance systems and their integral standard operating procedures and other quality documents to provide high-quality products and services to fully satisfy customer needs and expectations. Quality control and quality assurance systems together constitute the key quality systems. Quality control and quality assurance are parts of quality management. Quality control is focused on fulfilling quality requirements, whereas quality assurance is focused on providing confidence that quality requirements are fulfilled. The quality systems must be commensurate with the Company business objectives and business model. Top management commitment and its active involvement are critical in order to ensure at all times the adequacy, suitability, effectiveness and efficiency of the quality systems. Effective and efficient quality systems can promote timely registration of drugs by eliminating waste and the need for rework with overall financial and social benefits to the Company.

  15. Role and Position of the Modern Quality Assurance Manager

    OpenAIRE

    Velthuis, Annet G.J.; Beek, Cees Van De; Vriend, Hanneke; Bombeeck, Frank; Luning, Pieternel A.; Damman, Hans

    2012-01-01

    Quality assurance management in the food industry is complex, as it is the total of activities and decisions performed in an organisation to produce and maintain a safe product with the desired quality level against minimal costs (Luning, 2006). It includes: i) quality design, ii) quality control, iii) quality improvement, iv) quality assurance, and v) quality policy and strategy (Luning, 2007, 2009). Hence, it deals not only with all physical aspects of food products and their technological ...

  16. The Columbia River Protection Supplemental Technologies Quality Assurance Project Plan

    Energy Technology Data Exchange (ETDEWEB)

    Fix, N. J.

    2008-03-12

    Pacific Northwest National Laboratory researchers are working on the Columbia River Protection Supplemental Technologies Project. This project is a U. S. Department of Energy, Office of Environmental Management-funded initiative designed to develop new methods, strategies, and technologies for characterizing, modeling, remediating, and monitoring soils and groundwater contaminated with metals, radionuclides, and chlorinated organics. This Quality Assurance Project Plan provides the quality assurance requirements and processes that will be followed by the Technologies Project staff.

  17. Quality Assurance in the Endoscopy Suite: Sedation and Monitoring.

    Science.gov (United States)

    Harris, Zachary P; Liu, Julia; Saltzman, John R

    2016-07-01

    Recent development and expansion of endoscopy units has necessitated similar progress in the quality assurance of procedure sedation and monitoring. The large number of endoscopic procedures performed annually underlies the need for standardized quality initiatives focused on mitigating patient risk before, during, and immediately after endoscopic sedation, as well as improving procedure outcomes and patient satisfaction. Specific standards are needed for newer sedation modalities, including propofol administration. This article reviews the current guidelines and literature concerning quality assurance and endoscopic procedure sedation.

  18. Quality Assurance Standards for Symptomatic Breast Disease Services

    OpenAIRE

    Department of Health

    2007-01-01

    Quality Assurance Standards for Symptomatic Breast Disease Services People in Ireland have a right to expect that medical care be of good quality. They expect that standards of care are consistently high. They expect that access to care is easy, speedy, effective and efficient. Society expects quality of care to measure up to international norms of good practice. Such assurance can be given by auditing the quality of activity. Click here to download PDF 606kb

  19. Quality Assurance Project Plan for Facility Effluent Monitoring Plan activities

    Energy Technology Data Exchange (ETDEWEB)

    Frazier, T.P.

    1994-10-20

    This Quality Assurance Project Plan addresses the quality assurance requirements for the activities associated with the Facility Effluent Monitoring Plans, which are part of the overall Hanford Site Environmental Protection Plan. This plan specifically applies to the sampling and analysis activities and continuous monitoring performed for all Facility Effluent Monitoring Plan activities conducted by Westinghouse Hanford Company. It is generic in approach and will be implemented in conjunction with the specific requirements of the individual Facility Effluent Monitoring Plans.

  20. It Is Not Too Late for Software Assurance!

    Science.gov (United States)

    2013-12-01

    aided by Software Assurance practices regardless of where an application is in its lifecycle. In 2012, Yahoo suffered from an attack on an...application initially developed by another company and had Yahoo executed Software Assurance techniques on the mature application, they could have prevented...houses the vast majority of our critical informa- tion; thereby hardening the current infrastructure. Case Study: Yahoo Voices In July of 2012, a

  1. Product Quality Assurance for Off-Grid Lighting in Africa

    Energy Technology Data Exchange (ETDEWEB)

    World Bank; Mills, Evan; Mills, Evan

    2008-07-13

    Although the emergence of markets for high efficiency off-grid lighting technologies holds promise, realizing the potential of this opportunity on a long-term, sustainable basis requires careful attention to issues of product quality, consumer protection, and the potential for significant 'market spoiling', in anticipation of increases of sales of low cost, low performance off-grid lighting products. The goal of the Lighting Africa quality assurance workshop was to articulate strategies to mitigate the dangers of market spoiling and to explore ways to protect consumers from misleading advertising for sales of inferior, off-grid lighting products in the context of Lighting Africa's overarching objective to support the industry in developing a robust off-grid lighting market in Africa. The workshop resulted in the identification of two strategic approaches for meeting Lighting Africa quality assurance programmatic needs. The first strategy is intended to meet a short-term programmatic need for quality associated with requests for lighting products by bulk procurement agents, such as in a World Bank-financed project. The development of procurement specifications and test procedures that could be used in a quality/usability screening method in order to provide guidance for forthcoming large volume purchases emerged as the best solution to meet this need. Such approaches are used in World Bank-financed solar home systems (SHSs) projects in Bangladesh, Sri Lanka, and China, among others. However, unlike the SHSs which have multiple balance-of-system (BOS) components warranting the need for an array of specifications for individual components, stand alone lighting systems require specifications that are amenable to individual light points. To test this approach, Lighting Africa elected to use the technical specifications issued by the Photovoltaic Global Approval Program for solar lanterns that use CFL bulbs (PVRS11A) as the basis of qualifying such

  2. Kilowatt isotope power system. Phase II plan. Volume V. Safety, quality assurance and reliability

    Energy Technology Data Exchange (ETDEWEB)

    1978-03-15

    The development of a Kilowatt Isotope Power System (KIPS) was begun in 1975 for the purpose of satisfying the power requirements of satellites in the 1980's. The KIPS is a /sup 238/PuO/sub 2/-fueled organic Rankine cycle turbine power system to provide a design output of 500 to 2000 W. Included in this volume are: launch and flight safety considerations; quality assurance techniques and procedures to be followed through system fabrication, assembly and inspection; and the reliability program made up of reliability prediction analysis, failure mode analysis and criticality analysis. (LCL)

  3. Quality assurance in non-interventional studies

    Directory of Open Access Journals (Sweden)

    Capan, Müge

    2009-11-01

    Full Text Available Nowadays, drug research and surveillance after authorisation becomes more and more important for several reasons. Non-interventional studies (NIS investigate various aspects of drug use including efficacy and safety under real life conditions. Such kind of health services research should be on a high scientific, methodological and organisational level. Therefore accompanying measures to improve or to keep the quality are highly recommended. The aim of quality management is: first to avoid bias of results by using an appropriate study design and an adequate data analysis, second to assure authenticity, completeness and validity of the data and third to identify and resolve deficiencies at an early stage. Basic principles are laid down in corresponding guidelines and recommendations of authorities, institutes and societies. Various guidelines for good epidemiological practice (GEP were published by the U.S. Food and Drug Administration (FDA and international and regional societies for epidemiology. In addition in Germany the Federal Institute for Drugs and Medical Devices (BfArM together with the Paul Ehrlich Institute (PEI and the German Association of Research-Based Pharmaceutical Companies (VFA have published respectively recommendations dealing with quality aspects of non-interventional observational studies. Key points are the advanced publishing of information about the project, developing of a study plan/protocol containing the scientific objectives, a sample size justification and a description of the planned analyses and the publishing of a summary of the results timely after completion of the study. The quality of the data can be improved by using standardized case report forms (CRF and the CRF should be reviewed and tested before start of study by some participants. A source data verification (SDV should be performed in randomly selected centres – in between 2% and 5% of the centres depending on the number of participating centres

  4. Quality Assurance Framework for Mini-Grids

    Energy Technology Data Exchange (ETDEWEB)

    Baring-Gould, Ian [National Renewable Energy Lab. (NREL), Golden, CO (United States); Burman, Kari [National Renewable Energy Lab. (NREL), Golden, CO (United States); Singh, Mohit [National Renewable Energy Lab. (NREL), Golden, CO (United States); Esterly, Sean [National Renewable Energy Lab. (NREL), Golden, CO (United States); Mutiso, Rose [US Department of Energy, Washington, DC (United States); McGregor, Caroline [US Department of Energy, Washington, DC (United States)

    2016-11-01

    Providing clean and affordable energy services to the more than 1 billion people globally who lack access to electricity is a critical driver for poverty reduction, economic development, improved health, and social outcomes. More than 84% of populations without electricity are located in rural areas where traditional grid extension may not be cost-effective; therefore, distributed energy solutions such as mini-grids are critical. To address some of the root challenges of providing safe, quality, and financially viable mini-grid power systems to remote customers, the U.S. Department of Energy (DOE) teamed with the National Renewable Energy Laboratory (NREL) to develop a Quality Assurance Framework (QAF) for isolated mini-grids. The QAF for mini-grids aims to address some root challenges of providing safe, quality, and affordable power to remote customers via financially viable mini-grids through two key components: (1) Levels of service: Defines a standard set of tiers of end-user service and links them to technical parameters of power quality, power availability, and power reliability. These levels of service span the entire energy ladder, from basic energy service to high-quality, high-reliability, and high-availability service (often considered 'grid parity'); (2) Accountability and performance reporting framework: Provides a clear process of validating power delivery by providing trusted information to customers, funders, and/or regulators. The performance reporting protocol can also serve as a robust monitoring and evaluation tool for mini-grid operators and funding organizations. The QAF will provide a flexible alternative to rigid top-down standards for mini-grids in energy access contexts, outlining tiers of end-user service and linking them to relevant technical parameters. In addition, data generated through implementation of the QAF will provide the foundation for comparisons across projects, assessment of impacts, and greater confidence that

  5. Respiratory gated radiotherapy-pretreatment patient specific quality assurance

    Directory of Open Access Journals (Sweden)

    Rajesh Thiyagarajan

    2016-01-01

    Full Text Available Organ motions during inter-fraction and intra-fraction radiotherapy introduce errors in dose delivery, irradiating excess of normal tissue, and missing target volume. Lung and heart involuntary motions cause above inaccuracies and gated dose delivery try to overcome above effects. Present work attempts a novel method to verify dynamic dose delivery using a four-dimensional (4D phantom. Three patients with mobile target are coached to maintain regular and reproducible breathing pattern. Appropriate intensity projection image set generated from 4D-computed tomography (4D-CT is used for target delineation. Intensity modulated radiotherapy plans were generated on selected phase using CT simulator (Siemens AG, Germany in conjunction with "Real-time position management" (Varian, USA to acquire 4D-CT images. Verification plans were generated for both ion chamber and Gafchromic (EBT film image sets. Gated verification plans were delivered on the phantom moving with patient respiratory pattern. We developed a MATLAB-based software to generate maximum intensity projection, minimum intensity projections, and average intensity projections, also a program to convert patient breathing pattern to phantom compatible format. Dynamic thorax quality assurance (QA phantom (Computerized Imaging Reference Systems type is used to perform the patient specific QA, which holds an ion chamber and film to measure delivered radiation intensity. Exposed EBT films are analyzed and compared with treatment planning system calculated dose. The ion chamber measured dose shows good agreement with planned dose within ± 0.5% (0.203 ± 0.57%. Gamma value evaluated from EBT film shows passing rates 92–99% (96.63 ± 3.84% for 3% dose and 3 mm distance criteria. Respiratory gated treatment delivery accuracy is found to be within clinically acceptable level.

  6. Simultaneous analysis and quality assurance for diffusion tensor imaging.

    Directory of Open Access Journals (Sweden)

    Carolyn B Lauzon

    Full Text Available Diffusion tensor imaging (DTI enables non-invasive, cyto-architectural mapping of in vivo tissue microarchitecture through voxel-wise mathematical modeling of multiple magnetic resonance imaging (MRI acquisitions, each differently sensitized to water diffusion. DTI computations are fundamentally estimation processes and are sensitive to noise and artifacts. Despite widespread adoption in the neuroimaging community, maintaining consistent DTI data quality remains challenging given the propensity for patient motion, artifacts associated with fast imaging techniques, and the possibility of hardware changes/failures. Furthermore, the quantity of data acquired per voxel, the non-linear estimation process, and numerous potential use cases complicate traditional visual data inspection approaches. Currently, quality inspection of DTI data has relied on visual inspection and individual processing in DTI analysis software programs (e.g. DTIPrep, DTI-studio. However, recent advances in applied statistical methods have yielded several different metrics to assess noise level, artifact propensity, quality of tensor fit, variance of estimated measures, and bias in estimated measures. To date, these metrics have been largely studied in isolation. Herein, we select complementary metrics for integration into an automatic DTI analysis and quality assurance pipeline. The pipeline completes in 24 hours, stores statistical outputs, and produces a graphical summary quality analysis (QA report. We assess the utility of this streamlined approach for empirical quality assessment on 608 DTI datasets from pediatric neuroimaging studies. The efficiency and accuracy of quality analysis using the proposed pipeline is compared with quality analysis based on visual inspection. The unified pipeline is found to save a statistically significant amount of time (over 70% while improving the consistency of QA between a DTI expert and a pool of research associates. Projection of QA

  7. Composite Solid Propellant Predictability and Quality Assurance

    Science.gov (United States)

    Ramohalli, Kumar

    1989-01-01

    Reports are presented at the meeting at the University of Arizona on the study of predictable and reliable solid rocket motors. The following subject areas were covered: present state and trends in the research of solid propellants; the University of Arizona program in solid propellants, particularly in mixing (experimental and analytical results are presented).

  8. Assurance Policy Evaluation - Spacecraft and Strategic Systems

    Science.gov (United States)

    2014-09-17

    electromechanical ( EEE ) parts, software, design and workmanship, work instructions, manufacturing and tooling, cleanrooms, electrostatic discharge...strategies and processes of MDA suppliers. MDA’s audit program has uncovered several significant findings. For example, an MDA contractor purchased EEE ...parts for a rocket motor controller from an unauthorized supplier, increasing the risk that counterfeit parts were used. The purchased EEE parts were

  9. Quality Assurance of Peer Health Education Training.

    Science.gov (United States)

    Lindsey, Billie J.; Saunders, Cynthia M.

    1999-01-01

    Investigated whether college level peer educators were adequately prepared to teach peers about sexual health, sexual assault, and substance abuse. They completed 20 hours of training on the issues and on public speaking, leadership, and presentation skills. Pretesting and posttesting indicated that the program increased students' factual…

  10. AFRL/Cornell Information Assurance Institute

    Science.gov (United States)

    2007-03-01

    placement problems, using a complete system imple- 13 mentation on 46 Tmote Sky motes, demonstrating significant advantages over existing methods...Program Construction (MPC 2004) ( Stirling , Scotland, July 2004), vol. 3125 of Lecture Notes in Computer Science, Springer- Verlag, 400 pages. (202

  11. 76 FR 19757 - The Federal Student Aid Programs Under Title IV of the Higher Education Act of 1965, as Amended

    Science.gov (United States)

    2011-04-08

    ... Federal Student Aid Programs Under Title IV of the Higher Education Act of 1965, as Amended AGENCY... Assurance Program. SUMMARY: The Secretary of Education invites institutions of higher education that may wish to participate in the Quality Assurance Program, under section 487A(a) of the Higher Education...

  12. Quality Assurance Plan for Field Activities at the Natural and Accelerated Bioremediation Research (NABIR) Field Research Center (FRC), Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Brandt, C.C.

    2002-02-28

    The Environmental Sciences Division (ESD) at Oak Ridge National Laboratory (ORNL) has established a Natural and Accelerated Bioremediation Research (NABIR) program Field Research Center (FRC) for the U.S. Department of Energy (DOE) Office of Biological and Environmental Research. The FRC is located in Bear Creek Valley within the Y-12 Plant area of responsibility on DOE's Oak Ridge Reservation in Tennessee. The NABIR program is a long-term effort designed to increase the understanding of fundamental biogeochemical processes that would allow the use of bioremediation approaches for cleaning up DOE's contaminated legacy waste sites. The FRC provides a site for investigators in the NABIR program to conduct research and obtain samples related to in situ bioremediation. The FRC is integrated with existing and future laboratory and field research and provides a means of examining the biogeochemical processes that influence bioremediation under controlled small-scale field conditions. This Quality Assurance Plan (QAP) documents the quality assurance protocols for field and laboratory activities performed by the FRC staff. It supplements the requirements in the ORNL Nuclear Quality Assurance Program and the ESD Quality Assurance Program. The QAP addresses the requirements in Title 10 CFR, Part 830 Subpart A, ''Quality Assurance Requirements'', using a graded approach appropriate for Research and Development projects based on guidance from ''Implementation Guide for Quality Assurance Programs for Basic and Applied Research'' (DOE-ER-STD-6001-92). It also supports the NABIR FRC Management Plan (Watson and Quarles 2000a) which outlines the overall procedures, roles and responsibilities for conducting research at the FRC. The QAP summarizes the organization, work activities, and qualify assurance and quality control protocols that will be used to generate scientifically defensible data at the FRC. The QAP pertains to field

  13. Quality-assurance and data management plan for groundwater activities by the U.S. Geological Survey in Kansas, 2014

    Science.gov (United States)

    Putnam, James E.; Hansen, Cristi V.

    2014-01-01

    As the Nation’s principle earth-science information agency, the U.S. Geological Survey (USGS) is depended on to collect data of the highest quality. This document is a quality-assurance plan for groundwater activities (GWQAP) of the Kansas Water Science Center. The purpose of this GWQAP is to establish a minimum set of guidelines and practices to be used by the Kansas Water Science Center to ensure quality in groundwater activities. Included within these practices are the assignment of responsibilities for implementing quality-assurance activities in the Kansas Water Science Center and establishment of review procedures needed to ensure the technical quality and reliability of the groundwater products. In addition, this GWQAP is intended to complement quality-assurance plans for surface-water and water-quality activities and similar plans for the Kansas Water Science Center and general project activities throughout the USGS. This document provides the framework for collecting, analyzing, and reporting groundwater data that are quality assured and quality controlled. This GWQAP presents policies directing the collection, processing, analysis, storage, review, and publication of groundwater data. In addition, policies related to organizational responsibilities, training, project planning, and safety are presented. These policies and practices pertain to all groundwater activities conducted by the Kansas Water Science Center, including data-collection programs, interpretive and research projects. This report also includes the data management plan that describes the progression of data management from data collection to archiving and publication.

  14. Quality assurance in health care: past, present and future.

    Science.gov (United States)

    Bilawka, E; Craig, B J

    2003-08-01

    Quality of health care delivery is a growing concern globally given current budget restraints and increasing demands on health care providers. The variety of quality assurance and quality management activities equals the numerous ways health care practitioners of all genres provide health care. Dental hygienists around the world must be knowledgeable about quality assurance and management in health care as it is a significant factor in the evolution of the dental hygiene profession and the quality of oral health care provided by dental hygienists. The objective of this research was to conduct a literature review on quality assurance and quality management. A MEDLINE search from 1966 to 2002 was conducted. The search resulted in approximately 145 articles. Additional references from works generated by the search were also obtained. The literature revealed information on the background and history of quality assurance and quality management. Much of the literature was devoted to discussions of the validity, reliability and effectiveness of most prominent quality management activities being utilised in health care today. The investigation revealed numerous issues and barriers surrounding quality management. This article concludes with suggestions for future directions of quality assurance and quality management.

  15. [Quality assurance in head and neck medical oncology].

    Science.gov (United States)

    Digue, Laurence; Pedeboscq, Stéphane

    2014-05-01

    In medical oncology, how can we be sure that the right drug is being administered to the right patient at the right time? The implementation of quality assurance criteria is important in medical oncology, in order to ensure that the patient receives the best treatment safely. There is very little literature about quality assurance in medical oncology, as opposed to radiotherapy or cancer surgery. Quality assurance must cover the entire patient care process, from the diagnosis, to the therapeutic decision and drug distribution, including its selection, its preparation and its delivery to the patient (administration and dosage), and finally the potential side effects and their management. The dose-intensity respect is crucial, and its reduction can negatively affect overall survival rates, as shown in breast and testis cancers for example. In head and neck medical oncology, it is essential to respect the few well-standardized recommendations and the dose-intensity, in a population with numerous comorbidities. We will first review quality assurance criteria for the general medical oncology organization and then focus on head and neck medical oncology. We will then describe administration specificities of head and neck treatments (chemoradiation, radiation plus cetuximab, postoperative chemoradiation, induction and palliative chemotherapy) as well as their follow-up. Lastly, we will offer some recommendations to improve quality assurance in head and neck medical oncology.

  16. Quality assurance for image-guided radiation therapy utilizing CT-based technologies: A report of the AAPM TG-179

    Energy Technology Data Exchange (ETDEWEB)

    Bissonnette, Jean-Pierre; Balter, Peter A.; Dong Lei; Langen, Katja M.; Lovelock, D. Michael; Miften, Moyed; Moseley, Douglas J.; Pouliot, Jean; Sonke, Jan-Jakob; Yoo, Sua [Task Group 179, Department of Radiation Physics, Princess Margaret Hospital, University of Toronto, Toronto, Ontario, M5G 2M9 (Canada); Department of Radiation Physics, University of Texas M.D. Anderson Cancer Center, Houston, Texas 77030 (United States); Department of Radiation Oncology, M. D. Anderson Cancer Center Orlando, Orlando, Florida 32806 (United States); Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, New York, New York 10021 (United States); Department of Radiation Oncology, University of Colorado School of Medicine, Aurora, Colorado 80045 (United States); Department of Radiation Physics, Princess Margaret Hospital, University of Toronto, Toronto, Ontario, M5G 2M9 (Canada); Department of Radiation Oncology, UCSF Comprehensive Cancer Center, 1600 Divisadero St., Suite H 1031, San Francisco, California 94143-1708 (United States); Department of Radiation Oncology, Netherlands Cancer Institute-Antoni van Leeuwenhoek Hospital, Plesmanlaan 121, 1066 CX Amsterdam (Netherlands); Department of Radiation Oncology, Duke University, Durham, North Carolina 27710 (United States)

    2012-04-15

    Purpose: Commercial CT-based image-guided radiotherapy (IGRT) systems allow widespread management of geometric variations in patient setup and internal organ motion. This document provides consensus recommendations for quality assurance protocols that ensure patient safety and patient treatment fidelity for such systems. Methods: The AAPM TG-179 reviews clinical implementation and quality assurance aspects for commercially available CT-based IGRT, each with their unique capabilities and underlying physics. The systems described are kilovolt and megavolt cone-beam CT, fan-beam MVCT, and CT-on-rails. A summary of the literature describing current clinical usage is also provided. Results: This report proposes a generic quality assurance program for CT-based IGRT systems in an effort to provide a vendor-independent program for clinical users. Published data from long-term, repeated quality control tests form the basis of the proposed test frequencies and tolerances.Conclusion: A program for quality control of CT-based image-guidance systems has been produced, with focus on geometry, image quality, image dose, system operation, and safety. Agreement and clarification with respect to reports from the AAPM TG-101, TG-104, TG-142, and TG-148 has been addressed.

  17. Lawrence Livermore National Laboratory Quality Assurance Project Plan for National Emission Standards for Hazardous Air Pollutants (NESHAPs), Subpart H

    Energy Technology Data Exchange (ETDEWEB)

    Hall, L.; Biermann, A

    2000-06-27

    As a Department of Energy (DOE) Facility whose operations involve the use of radionuclides, Lawrence Livermore National Laboratory (LLNL) is subject to the requirements of 40 CFR 61, the National Emission Standards for Hazardous Air Pollutants (NESHAPs). Subpart H of this Regulation establishes standards for exposure of the public to radionuclides (other than radon) released from DOE Facilities (Federal Register, 1989). These regulations limit the emission of radionuclides to ambient air from DOE facilities (see Section 2.0). Under the NESHAPs Subpart H Regulation (hereafter referred to as NESHAPs), DOE facilities are also required to establish a quality assurance program for radionuclide emission measurements; specific requirements for preparation of a Quality Assurance Program Plan (QAPP) are given in Appendix B, Method 114 of 40 CFR 61. Throughout this QAPP, the specific Quality Assurance Method elements of 40 CFR 61 Subpart H addressed by a given section are identified. In addition, the US Environmental Protection Agency (US EPA) (US EPA, 1994a) published draft requirements for QAPP's prepared in support of programs that develop environmental data. We have incorporated many of the technical elements specified in that document into this QAPP, specifically those identified as relating to measurement and data acquisition; assessment and oversight; and data validation and usability. This QAPP will be evaluated on an annual basis, and updated as appropriate.

  18. New Directions in Software Quality Assurance Automation

    Science.gov (United States)

    2009-06-01

    behavior specification based on UML statecharts, message sequence diagrams , or other types of extended finite state machines, like timing automata [27] or...debugging queries, intrusion detection Program monitoring can be specified in terms of computations over event traces We introduce a specific language...Machine monitors) Dynamic QoS metrics, UniFrame project (via glue and wrapper instrumentation), funded by ONR Intrusion detection and countermeasures

  19. Quality assurance for radon exposure chambers at the National Air and Radiation Environmental Laboratory, Montgomery, Alabama

    Energy Technology Data Exchange (ETDEWEB)

    Semler, M.O.; Sensintaffar, E.L. [National Air and Radiation Environmental Laboratory, Montgomery, AL (United States)

    1993-12-31

    The Office of Radiation and Indoor Air, U.S. Environmental Protection Agency (EPA), operates six radon exposure chambers in its two laboratories, the National Air and Radiation Environmental Laboratory (NAREL) in Montgomery, Alabama, and the Las Vegas Facility, Las Vegas, Nevada. These radon exposure chambers are used to calibrate and test portable radon measuring instruments, test commercial suppliers of radon measurement services through the Radon Measurement Proficiency Program, and expose passive measurement devices to known radon concentrations as part of a quality assurance plan for federal and state studies measuring indoor radon concentrations. Both laboratories participate in national and international intercomparisons for the measurement of radon and are presently working with the National Institute of Standards and Technology (NIST) to receive a certificate of traceability for radon measurements. NAREL has developed an estimate of the total error in its calibration of each chamber`s continuous monitors as part of an internal quality assurance program. This paper discusses the continuous monitors and their calibration for the three chambers located in Montgomery, Alabama, as well as the results of the authors intercomparisons and total error analysis.

  20. Concrete and steel construction quality control and assurance

    CERN Document Server

    El-Reedy, Mohamed A

    2014-01-01

    Starting with the receipt of materials and continuing all the way through to the final completion of the construction phase, Concrete and Steel Construction: Quality Control and Assurance examines all the quality control and assurance methods involving reinforced concrete and steel structures. This book explores the proper ways to achieve high-quality construction projects, and also provides a strong theoretical and practical background. It introduces information on quality techniques and quality management, and covers the principles of quality control. The book presents all of the quality control and assurance protocols and non-destructive test methods necessary for concrete and steel construction projects, including steel materials, welding and mixing, and testing. It covers welding terminology and procedures, and discusses welding standards and procedures during the fabrication process, as well as the welding codes. It also considers the total quality management system based on ISO 9001, and utilizes numer...

  1. Cyber-assurance for the Internet of Things

    CERN Document Server

    2017-01-01

    This book discusses the cyber-assurance needs of the IoT environment, highlighting key information assurance (IA) IoT issues and identifying the associated security implications. Through contributions from cyber-assurance, IA, information security and IoT industry practitioners and experts, the text covers fundamental and advanced concepts necessary to grasp current IA issues, challenges, and solutions for the IoT. The future trends in IoT infrastructures, architectures and applications are also examined. Other topics discussed include the IA protection of IoT systems and information being stored, processed or transmitted from unauthorized access or modification of machine-2-machine (M2M) devices, radio-frequency identification (RFID) networks, wireless sensor networks, smart grids, and supervisory control and data acquisition (SCADA) systems. The book also discusses IA measures necessary to detect, rotect, and defend IoT information and networks/systems to ensure their availability, integrity, authentication...

  2. Quality assurance and accreditation of engineering education in Jordan

    Science.gov (United States)

    Aqlan, Faisal; Al-Araidah, Omar; Al-Hawari, Tarek

    2010-06-01

    This paper provides a study of the quality assurance and accreditation in the Jordanian higher education sector and focuses mainly on engineering education. It presents engineering education, accreditation and quality assurance in Jordan and considers the Jordan University of Science and Technology (JUST) for a case study. The study highlights the efforts undertaken by the faculty of engineering at JUST concerning quality assurance and accreditation. Three engineering departments were accorded substantial equivalency status by the Accreditation Board of Engineering and Technology in 2009. Various measures of quality improvement, including curricula development, laboratories improvement, computer facilities, e-learning, and other supporting services are also discussed. Further assessment of the current situation is made through two surveys, targeting engineering instructors and students. Finally, the paper draws conclusions and proposes recommendations to enhance the quality of engineering education at JUST and other Jordanian educational institutions.

  3. Nuclear Safety and the Role of Quality Assurance

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Hyuk-il; Park, Chan-Gook; Nam, Ji-Hee; Kim, Kwan-Hyun; Lee, Young-Gun; Lim, Nam-Jin [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    2006-07-01

    At the early stage of industrialization, quality of a product is determined and achieved by the skill and know-how of a craftsman who made his product. With the development of industry, however, products were diversified and became increasingly complicated. And, the necessity of quality verification by an independent expert, i.e. inspector, became imperative as a means of quality control and quality assurance. Quality should not be a hostage of a consequent tremendous disaster by an accident or malfunction of a product, but should be achieved by pre-planned and systematic control and management actions to assure safe operations. Quality assurance in the nuclear industry is most important because the failure of a safe operation of nuclear power plants or nuclear facilities would cause tremendous disaster to public safety.

  4. Mechanisms for Quality Assurance of Universities in Cameroon

    Directory of Open Access Journals (Sweden)

    Joseph BESONG BESONG

    2016-06-01

    Full Text Available This paper takes a perspective look at the evolution of universities in Cameroon and the recent orientation of deregulation as it affects quality assurance in Cameroonian universities. The paper having identified these flaws attempted to elucidate the meaning of mechanism for Quality assurance in the face of deregulation. The regulatory mechanisms identified by this paper include inter- alia, appropriate scrutiny of new programmes, relying on impartial advise of examiners. Using the state law NO.98/004 of 1998 to compliment the efforts of internal school administration and above all opening linkages between universities and relating universities education in the World of science and technology. This paper does not only enhance quality assurance but also builds the idea of economic growth and development.

  5. INFORMATION ASSURANCE - INTELLIGENCE - INFORMATION SUPERIORITY RELATIONSHIP WITHIN NATO OPERATIONS

    Directory of Open Access Journals (Sweden)

    Gheorghe BOARU, Ioan-Mihai ILIEŞ

    2011-01-01

    Full Text Available There is a tight relationship between information assurance, the intelligence cycle and information superiority within NATO operations. The intelligence cycle has a discrete architecture and provides on-time and relevant intelligence products to the joint force commanders and to other authorized users in a specifi c joint area of operations. The intelligence cycle must follow the evolution of the operation. A permanent intelligence estimate will be performed during the military decision making process and operations execution. Information superiority is one of the most powerful intelligence cycle achievements. and decisively infuences the success of NATO joint operations. Information superiority must be preserved and enhanced through information assurance. Information assurance is an information operation that must be planned by the military in charge of operation security or by non-military experts, executed by all personnel during the entire intelligence cycle life time and employed during the planning and execution of NATO joint operations.

  6. Pacific Northwest Laboratory annual report for 1988 to the Assistant Secretary for Environment, Safety, and Health: Part 5, Environment, safety, health, and quality assurance

    Energy Technology Data Exchange (ETDEWEB)

    Faust, L.G.; Pennell, W.T.; Selby, J.M.

    1989-02-01

    This document summarizes the research programs now underway at Battelle's Pacific Northwest Laboratory in the areas of environmental safety, health, and quality assurance. Topics include internal irradiation, emergency plans, dose equivalents, risk assessment, dose equivalents, surveys, neutron dosimetry, and radiation accidents. (TEM)

  7. Quality assurance of qualitative research: a review of the discourse

    Directory of Open Access Journals (Sweden)

    Reynolds Joanna

    2011-12-01

    Full Text Available Abstract Background Increasing demand for qualitative research within global health has emerged alongside increasing demand for demonstration of quality of research, in line with the evidence-based model of medicine. In quantitative health sciences research, in particular clinical trials, there exist clear and widely-recognised guidelines for conducting quality assurance of research. However, no comparable guidelines exist for qualitative research and although there are long-standing debates on what constitutes 'quality' in qualitative research, the concept of 'quality assurance' has not been explored widely. In acknowledgement of this gap, we sought to review discourses around quality assurance of qualitative research, as a first step towards developing guidance. Methods A range of databases, journals and grey literature sources were searched, and papers were included if they explicitly addressed quality assurance within a qualitative paradigm. A meta-narrative approach was used to review and synthesise the literature. Results Among the 37 papers included in the review, two dominant narratives were interpreted from the literature, reflecting contrasting approaches to quality assurance. The first focuses on demonstrating quality within research outputs; the second focuses on principles for quality practice throughout the research process. The second narrative appears to offer an approach to quality assurance that befits the values of qualitative research, emphasising the need to consider quality throughout the research process. Conclusions The paper identifies the strengths of the approaches represented in each narrative and recommend these are brought together in the development of a flexible framework to help qualitative researchers to define, apply and demonstrate principles of quality in their research.

  8. Quality assurance practices in university libraries in South Africa

    Directory of Open Access Journals (Sweden)

    Luyanda Dube

    2011-01-01

    Full Text Available Key to the transformation of the South African higher education landscape has been the introduction and enhancement of quality assurance practices. The implementation of quality assurance mechanisms in the sector has also affected academic libraries, as they are not static, free-standing entities but are part of universities and their academic culture. Evidently, quality assurance is no longer an option, but a critical reality as libraries in general are under immense pressure to prove their worth in competition with other information enterprises, and are also facing budget cuts (Kinnell, Usherwood, & Jones 1999; Tam 2000. Academic libraries, in particular, are facing the extra challenge of striving to align quality initiatives and practices not only with the overall mission and goals of the university, but also with the “fitness for purpose” quality principle by which universities are judged by the Higher Education Quality Committee (HEQC. The study utilised questionnaires and document analysis to collect data and targeted officers in academic libraries who deal with quality assurance matters or issues as well as policy or other related documents. The results showed that quality assurance practices in academic libraries vary. They range from active and integrative processes for maintaining and improving quality to those that are feeble and not well developed. However, there is general commitment towards instilling a quality culture, encouraging a best practice, participative approach, continuous improvement and satisfying the needs of the customer. As one of its recommendations, the study highlights the need to enhance the depth and breadth of quality assurance initiatives and to create more avenues for sharing best practices.

  9. A Study on the Software Quality Assurance Plan

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyun Tae [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    2006-07-01

    On 25 August 2006, the CMMI V1.2 (Capability Maturity Model Integration Version 1.2) was released with the new title CMMI-DEV (CMMI for Development) which supersedes the CMMI-SE/SW (CMMI for systems engineering and software engineering) V1.1. This study discusses the application of IEEE Std 730-2002, IEEE Standard for Software Quality Assurance Plans, for the implementation of the Process and Product Quality Assurance (PPQA) process area (PA) of the CMMI-DEV.

  10. Coalmine Safety Assurance Information System Based on GIS

    Institute of Scientific and Technical Information of China (English)

    LIU Qiao-xi; MAO Shan-jun; MA Ai-nai; MAO Yun-de; BAO Qing-guo

    2003-01-01

    The mine ventilation and safety is one of the most important factors to influence on the coal production.More attention has been paid to manage safety information in scientific, efficient, and real-time way. Therefore, it is important to develop a practical mine safety assurance information system (CSAIS). Based on analyzing the actual management mode for ventilation and safety on mine, the paper studies the structure and function of the mine safety assurance information system based on GIS in detail. Moreover, it also suggests some applications and solutions. By combining with the practical situation, the paper realizes the whole function of the present system.

  11. Study on Evaluation of Supplier s Quality Assurance System

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    To be a worldwide competitor, enterprise needs to e va luate and select its supplier carefully. Generally, to evaluate a supplier, the evaluating effort is focused on the purchase price, delivery time, product quali ty, etc. The vendors' quality assurance is seldom considered. However, it reflec ts the ability that a vendor can provide high quality but low cost products cont inuously and stably. In this paper, with the study on evaluation of supplier's q uality assurance system, a set of methods and indice...

  12. Diplomatic assurances - a permissible tool in the struggle against terrorism?

    DEFF Research Database (Denmark)

    Mouyal, Lone Wandahl

    2011-01-01

    that States well-known for gross human rights violations will ensure that the person concerned is not exposed to torture or ill-treatment. Reliance on these assurances has been questioned by many; scholars, UN bodies and NGO’s, and practice shows that there is reason for concern. Th is paper examines...... such reliance on diplomatic assurances by scrutinizing the practice and the case-law of the UN treaty bodies, the European Court of Human Rights (ECtHR) and the offi cial statements and reports of UN institutions such as the Human Rights Council, Th e Offi cer of the High Commissioner for Human Rights as well...

  13. Plan Assurance Qualité for an Installation Contract

    CERN Document Server

    Gascon, C

    2001-01-01

    The current ST/EL group's installation and maintenance contract expires on June 2001. Official procedures for a new contract began a few months ago. Once the new contract has been adjudicated, contractor firm should establish a Quality Assurance Plan (PAQ) within 6 months to be approved. This PAQ is the essential main instrument which ST/EL group has in order to assure a perfect achievement of signed contract. PAQ efficiency depends on its good knowledge and its permanent application on the part of the contractor firm and especially on the part of ST/EL group. The acquired experience during last PAQ should be reflected in the future contract.

  14. Using Make for Reproducible and Parallel Neuroimaging Workflow and Quality Assurance

    Directory of Open Access Journals (Sweden)

    Mary K. Askren

    2016-02-01

    Full Text Available The contribution of this paper is to describe how we can program neuroimaging workflow using Make, a software development tool designed for describing how to build executables from source files. We show that we can achieve many of the features of more sophisticated neuroimaging pipeline systems, including reproducibility, parallelization, fault tolerance, and quality assurance reports. We suggest that Make represents a large step towards these features with only a modest increase in programming demands over shell scripts. This approach reduces the technical skill and time required to write, debug, and maintain neuroimaging workflows in a dynamic environment, where pipelines are often modified to accommodate new best practices or to study the effect of alternative preprocessing steps, and where the underlying packages change frequently. This paper has a comprehensive accompanying manual with lab practicals and examples (see Supplemental Materials and all data, scripts and makefiles necessary to run the practicals and examples are available in the makepipelines project at NITRC.

  15. Web Implementation of Quality Assurance (QA) for X-ray Units in Balkanic Medical Institutions.

    Science.gov (United States)

    Urošević, Vlade; Ristić, Olga; Milošević, Danijela; Košutić, Duško

    2015-08-01

    Diagnostic radiology is the major contributor to the total dose of the population from all artificial sources. In order to reduce radiation exposure and optimize diagnostic x-ray image quality, it is necessary to increase the quality and efficiency of quality assurance (QA) and audit programs. This work presents a web application providing completely new QA solutions for x-ray modalities and facilities. The software gives complete online information (using European standards) with which the corresponding institutions and individuals can evaluate and control a facility's Radiation Safety and QA program. The software enables storage of all data in one place and sharing the same information (data), regardless of whether the measured data is used by an individual user or by an authorized institution. The software overcomes the distance and time separation of institutions and individuals who take part in QA. Upgrading the software will enable assessment of the medical exposure level to ionizing radiation.

  16. Quality Assurance (QA) plan for the Airlift Deployment Analysis System (ADANS)

    Energy Technology Data Exchange (ETDEWEB)

    Loffman, R.S.; Truett, L.F.

    1990-09-01

    Development of the Airlift Deployment Analysis System (ADANS) at Oak Ridge National Laboratory (ORNL) began in 1986. When fully implemented in 1992, ADANS will provide Headquarters, Military Airlift Command with an automated airlift planning and scheduling system. ADANS will be operational through at least the year 2000. This Quality Assurance (QA) Plan will be used by the ADANS team at ORNL as a guide to ensure that the ADANS software development project results in a high-quality product completed on time and within budget. The Plan defines the program elements to be considered under QA management, the responsibilities of each individual concerned, the acceptance criteria, and a schedule for QA program element reviews. Forms for maintaining appropriate QA records are also included.

  17. eLearning-radiology.com. Sustainability for quality assurance; eLearning-radiology.com. Nachhaltigkeit im Sinne der Qualitaetssicherung

    Energy Technology Data Exchange (ETDEWEB)

    Ketelsen, D. [Tuebingen Univ. (Germany). Abt. fuer Diagnostische und Interventionelle Radiologie; Talanow, R. [Cleveland Clinic, Cleveland, OH (United States). Abt. fuer Nuklearmedizin; Uder, M. [Erlangen-Nuernberg Univ. (Germany). Inst. fuer Diagnostische Radiologie; Grunewald, M. [Erlangen-Nuernberg Univ. (Germany). Nuklearmedizinische Klinik

    2009-04-15

    Purpose: The aim of the study was to analyze the availability of published radiological e-learning tools and to establish a solution for quality assurance. Materials and Methods: Substantial pubmed research was performed to identify radiological e-learning tools. 181 e-learning programs were selected. As examples two databases expanding their programs with external links, Compare (n = 435 external links) and TNT-Radiology (n = 1078 external links), were evaluated. A concept for quality assurance was developed by an international taskforce. Results: At the time of assessment, 56.4 % (102/181) of the investigated e-learning tools were accessible at their original URL. A subgroup analysis of programs published 5 to 8 years ago showed significantly inferior availability to programs published 3 to 5 years ago (p < 0.01). The analysis of external links showed 49.2 % and 61.0 % accessible links for the programs Compare (published 2003) and TNT-Radiology (published 2006), respectively. As a consequence, the domain www.eLearning-radiology.com was developed by the taskforce and published online. This tool allows authors to present their programs and users to evaluate the e-learning tools depending on several criteria in order to remove inoperable links and to obtain information about the complexity and quality of the e-learning tools. (orig.)

  18. Hybrid Vehicle Program. Final report

    Energy Technology Data Exchange (ETDEWEB)

    None

    1984-06-01

    This report summarizes the activities on the Hybrid Vehicle Program. The program objectives and the vehicle specifications are reviewed. The Hybrid Vehicle has been designed so that maximum use can be made of existing production components with a minimum compromise to program goals. The program status as of the February 9-10 Hardware Test Review is presented, and discussions of the vehicle subsystem, the hybrid propulsion subsystem, the battery subsystem, and the test mule programs are included. Other program aspects included are quality assurance and support equipment. 16 references, 132 figures, 47 tables.

  19. QUALITY ASSURANCE SYSTEMS IN POLISH AND UKRAINIAN HIGHER EDUCATION. A COMPARATIVE ANALYSIS

    Directory of Open Access Journals (Sweden)

    Marta Tutko

    2015-02-01

    Full Text Available The article deals with the progress made to develop external and internal quality assurance systems in Polish and Ukrainian higher education in the European Higher Education Area background. The focus of the paper is on the extent to which quality assurance systems in these countries are following the Standards and Guidelines for Quality Assurance in the European Higher Education Area. Furthermore, internal and external quality assur-ance in the European context is presented in the article. The authors of the article also conducted a comparative analysis of quality assurance systems in Polish and Ukrainian higher education.

  20. Meeting the flow assurance challenges of deep water developments - from CAPEX development to field start up

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, M.M.; Feasey, N.D. [National Aluminium Company Ltd. (Nalco), Cheshire (United Kingdom); Afonso, M.; Silva, D. [NALCO Brasil Ltda., Sao Paulo, SP (Brazil)

    2008-07-01

    As oil accumulations in easily accessible locations around the world become less available developments in deeper water become a more common target for field development. Deep water projects, particularly sub sea development, present a host of challenges in terms of flow assurance and integrity. In this paper the focus will be on the chemical control of flow assurance challenges in hydrate control, scale control and wax/asphaltene control within deep water (>750 meter) developments. The opportunities for kinetic hydrate control vs. conventional thermodynamic hydrate control will be outlined with examples of where these technologies have been applied and the limitations that still exist. The development of scale control chemical formulations specifically for sub sea application and the challenges of monitoring such control programs will be highlighted with developments in real time and near real time monitoring. Organic deposit control (wax/asphaltene) will focus on the development of new chemicals that have higher activity but lower viscosity than currently used chemicals hence allowing deployment at colder temperatures and over longer distances. The factors that need to be taken into account when selecting chemicals for deep water application will be highlighted. Fluid viscosity, impact of hydrostatic head on injectivity, product stability at low temperature and interaction with other production chemicals will be reviewed as they pertain to effective flow assurance. This paper brings learning from other deep water basins with examples from the Gulf of Mexico, West Africa and Brazil, which will be used to highlight these challenges and some of the solutions currently available along with the technology gaps that exist. (author)

  1. A routine quality assurance test for CT automatic exposure control systems.

    Science.gov (United States)

    Iball, Gareth R; Moore, Alexis C; Crawford, Elizabeth J

    2016-07-08

    The study purpose was to develop and validate a quality assurance test for CT automatic exposure control (AEC) systems based on a set of nested polymethylmethacrylate CTDI phantoms. The test phantom was created by offsetting the 16 cm head phantom within the 32 cm body annulus, thus creating a three part phantom. This was scanned at all acceptance, routine, and some nonroutine quality assurance visits over a period of 45 months, resulting in 115 separate AEC tests on scanners from four manufacturers. For each scan the longitudinal mA modulation pattern was generated and measurements of image noise were made in two annular regions of interest. The scanner displayed CTDIvol and DLP were also recorded. The impact of a range of AEC configurations on dose and image quality were assessed at acceptance testing. For systems that were tested more than once, the percentage of CTDIvol values exceeding 5%, 10%, and 15% deviation from baseline was 23.4%, 12.6%, and 8.1% respectively. Similarly, for the image noise data, deviations greater than 2%, 5%, and 10% from baseline were 26.5%, 5.9%, and 2%, respectively. The majority of CTDIvol and noise deviations greater than 15% and 5%, respectively, could be explained by incorrect phantom setup or protocol selection. Barring these results, CTDIvol deviations of greater than 15% from baseline were found in 0.9% of tests and noise deviations greater than 5% from baseline were found in 1% of tests. The phantom was shown to be sensitive to changes in AEC setup, including the use of 3D, longitudinal or rotational tube current modulation. This test methodology allows for continuing performance assessment of CT AEC systems, and we recommend that this test should become part of routine CT quality assurance programs. Tolerances of ± 15% for CTDIvol and ± 5% for image noise relative to baseline values should be used.

  2. In Vivo Monitoring Program Manual, PNL-MA-574, Rev 5.1

    Energy Technology Data Exchange (ETDEWEB)

    Lynch, Timothy P.

    2011-09-12

    The following sections provide an overview of the administration for the In Vivo Monitoring Program (IVMP) for Hanford. This includes the organizational structure and program responsibilities; coordination of in vivo measurements; scheduling measurements; performing measurements; reporting results; and quality assurance.

  3. 10 CFR 74.59 - Quality assurance and accounting requirements.

    Science.gov (United States)

    2010-01-01

    ... measurement system in question must not be used for material control and accounting purposes until it has been... 10 Energy 2 2010-01-01 2010-01-01 false Quality assurance and accounting requirements. 74.59 Section 74.59 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) MATERIAL CONTROL AND ACCOUNTING OF...

  4. Quality of Information Assurance - Assessment, Management and Use (QIAAMU)

    Science.gov (United States)

    2013-04-01

    QUALITY OF INFORMATION ASSURANCE – ASSESSMENT, MANAGEMENT AND USE (QIAAMU) RAYTHEON BBN TECHNOLGIES APRIL 2013 FINAL TECHNICAL...unit uses a mobile platform (laptop plus radio and SATCOM gear) for information operations such as calling in air support or feeding air operation

  5. Assuring dairy cattle welfare : towards efficient assessment and improvement

    NARCIS (Netherlands)

    Vries, de M.

    2013-01-01

      In many countries, there is an increasing interest to assure the welfare of production animals. On-farm assessment of dairy cattle welfare, however, is time-consuming and, therefore, expensive. Besides this, effects of housing and management interventions that are aimed at improving welfare

  6. Managing transitions: assuring the adoption and impact of TQM.

    Science.gov (United States)

    Kaluzny, A D; McLaughlin, C P

    1992-11-01

    Assuring the full adoption and impact of total quality management (TQM) requires the understanding that TQM involves transitional challenges to managers, individuals, work groups, and the organization as a whole. This article presents some of these challenges and describes how they might be met over time to determine the ultimate success of TQM adoption in an organization.

  7. Hardness Assurance Techniques for New Generation COTS Devices

    Science.gov (United States)

    Lee, C. I.; Rax, B. G.; Johnston, A. H.

    1996-01-01

    Hardness Assurance (HA) techniques and total dose radiation characterization data for new generation linear and COTS devices from various manufacturers are presented. A bipolar op amp showed significant degradation at HDR, not at low dose rate environment. New generation low-power op amps showed more degradation at low voltage applications. HA test techniques for COTS devices are presented in this paper.

  8. Statistical Modeling for Radiation Hardness Assurance: Toward Bigger Data

    Science.gov (United States)

    Ladbury, R.; Campola, M. J.

    2015-01-01

    New approaches to statistical modeling in radiation hardness assurance are discussed. These approaches yield quantitative bounds on flight-part radiation performance even in the absence of conventional data sources. This allows the analyst to bound radiation risk at all stages and for all decisions in the RHA process. It also allows optimization of RHA procedures for the project's risk tolerance.

  9. Reconciling Organisational Culture and External Quality Assurance in Higher Education

    Science.gov (United States)

    Naidoo, Dhaya

    2013-01-01

    Organisational culture and external quality assurance have both been presented as significant drivers of effectiveness, efficiency and excellence in higher education institutions. However, these assumptions have not been critically examined given the philosophical, conceptual and methodological contestations surrounding both constructs. A…

  10. Safety Assurance Process for FRMS: eJcase Implementation

    NARCIS (Netherlands)

    Stewart, S.; Koornneef, F.; Akselsson, R.; Barton, P.

    2009-01-01

    Chapter 6: Safety Assurance Process for FRMS - eJcase Implementation The European Commission HILAS project (Human Integration into the Lifecycle of Aviation Systems - a project supported by the European Commission’s 6th Framework between 2005-2009) was focused on using human factors knowledge and m

  11. 75 FR 61143 - Financial Management and Assurance; Government Auditing Standards

    Science.gov (United States)

    2010-10-04

    ... From the Federal Register Online via the Government Publishing Office GOVERNMENT ACCOUNTABILITY OFFICE Financial Management and Assurance; Government Auditing Standards Correction In notice document 2010-23374 beginning on page 57274 in the issue of Monday, September 20, 2010 make the...

  12. Quality Assurance in Post-Secondary Education: Some Common Approaches

    Science.gov (United States)

    Law, Dennis Chung Sea

    2010-01-01

    Purpose: The common approaches to quality assurance (QA), as practiced by most post-secondary education institutions for internal quality monitoring and most QA authorities for external quality monitoring (EQM), have been considered by many researchers as having largely failed to address the essence of educational quality. The purpose of this…

  13. Assured Resource Sharing in Ad-Hoc Collaboration

    Energy Technology Data Exchange (ETDEWEB)

    Ahn, Gail-Joon [Arizona State Univ., Tempe, AZ (United States)

    2015-12-19

    The project seeks an innovative framework to enable users to access and selectively share resources in distributed environments, enhancing the scalability of information sharing. We have investigated secure sharing & assurance approaches for ad-hoc collaboration, focused on Grids, Clouds, and ad-hoc network environments.

  14. 40 CFR 280.112 - Drawing on financial assurance mechanisms.

    Science.gov (United States)

    2010-07-01

    ... mechanisms. 280.112 Section 280.112 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... mechanisms. (a) Except as specified in paragraph (d) of this section, the Director of the implementing agency... funds stipulated by the Director, up to the limit of funds provided by the financial assurance...

  15. Gastric cancer : staging, treatment, and surgical quality assurance

    NARCIS (Netherlands)

    Dikken, Johannes Leen

    2012-01-01

    Research described in this thesis focuses on several aspects of gastric cancer care: staging and prognostication, multimodality treatment, and surgical quality assurance. PART I - STAGING AND PROGNOSTICATION Cancer staging is one of the fundamental activities in oncology.6,7 For over 50 years, the

  16. 21 CFR 892.1940 - Radiologic quality assurance instrument.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Radiologic quality assurance instrument. 892.1940 Section 892.1940 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES RADIOLOGY DEVICES Diagnostic Devices § 892.1940 Radiologic quality...

  17. Assuring long-term reliability of concentrator PV systems

    Science.gov (United States)

    McConnell, R.; Garboushian, V.; Brown, J.; Crawford, C.; Darban, K.; Dutra, D.; Geer, S.; Ghassemian, V.; Gordon, R.; Kinsey, G.; Stone, K.; Turner, G.

    2009-08-01

    Concentrator PV (CPV) systems have attracted significant interest because these systems incorporate the world's highest efficiency solar cells and they are targeting the lowest cost production of solar electricity for the world's utility markets. Because these systems are just entering solar markets, manufacturers and customers need to assure their reliability for many years of operation. There are three general approaches for assuring CPV reliability: 1) field testing and development over many years leading to improved product designs, 2) testing to internationally accepted qualification standards (especially for new products) and 3) extended reliability tests to identify critical weaknesses in a new component or design. Amonix has been a pioneer in all three of these approaches. Amonix has an internal library of field failure data spanning over 15 years that serves as the basis for its seven generations of CPV systems. An Amonix product served as the test CPV module for the development of the world's first qualification standard completed in March 2001. Amonix staff has served on international standards development committees, such as the International Electrotechnical Commission (IEC), in support of developing CPV standards needed in today's rapidly expanding solar markets. Recently Amonix employed extended reliability test procedures to assure reliability of multijunction solar cell operation in its seventh generation high concentration PV system. This paper will discuss how these three approaches have all contributed to assuring reliability of the Amonix systems.

  18. Authentication Assurance Level Application to the Inventory Sampling Measurement System

    Energy Technology Data Exchange (ETDEWEB)

    Devaney, Mike M.; Kouzes, Richard T.; Hansen, Randy R.; Geelhood, Bruce D.

    2001-09-06

    This document concentrates on the identification of a standardized assessment approach for the verification of security functionality in specific equipment, the Inspection Sampling Measurement System (ISMS) being developed for MAYAK. Specifically, an Authentication Assurance Level 3 is proposed to be reached in authenticating the ISMS.

  19. Faculty Development and Quality Assurance in the EU ERAMIS Project

    Directory of Open Access Journals (Sweden)

    Agathe Merceron

    2012-07-01

    Full Text Available The aim of the ERAMIS project is to create a
    network of Masters degrees “Informatics as a Second
    Competence” in nine beneficiary universities of Kazakhstan,
    Kyrgyzstan and Russia. This contribution presents how
    faculty development is organized and quality assurance
    implemented inside this project.

  20. An Alternative View of Quality Assurance and Enhancement

    Science.gov (United States)

    Wong, Viola Yuk-Yue

    2012-01-01

    This paper attempts to deal with the elusive nature of quality in quality management, using a case study to examine quality control measures implemented in an academic context and to show an emergent framework for quality enhancement. This paper introduces the concept of the ecology of quality assurance and examines efforts to maintain and advance…

  1. Russian Higher Education and European Standards of Quality Assurance

    Science.gov (United States)

    Motova, Galina; Pykko, Ritta

    2012-01-01

    This article considers the relevance and implementation of European approaches to quality assurance in the context of the Russian educational system. It covers the issues of transformation of the higher education system during the post-Soviet period, specific features of the state accreditation system, the impact of the European Standards and…

  2. 41 CFR 105-60.305-7 - Assurance of payment.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Assurance of payment. 105-60.305-7 Section 105-60.305-7 Public Contracts and Property Management Federal Property Management... Administration 60-PUBLIC AVAILABILITY OF AGENCY RECORDS AND INFORMATIONAL MATERIALS 60.3-Availability of...

  3. Online Course Quality Assurance: Development of a Quality Checklist

    Science.gov (United States)

    McGahan, Steven J.; Jackson, Christina M.; Premer, Karen

    2015-01-01

    The University of Nebraska at Kearney's Online Course Checklist is the main instrument for assessing the quality of online courses at UNK. A number of issues were faced when developing and deploying this quality assurance checklist at a small four-year university. The process including development, implementation, and revision is discussed along…

  4. Quality assurance for CMS Tracker LV and HV Power Supplies

    CERN Document Server

    Costa, Marco; Sertoli, M; Trapani, P; Periale, L; Isabella, L; Landi, C; Lucchesi, A

    2007-01-01

    This work describes the quality assurance measurements that have been carried out on about 2000 Power Supply Units produced in CAEN technology for the CMS Silicon Tracker Detector. The automate procedure and the characteristics of the dedicated Test Fixture developed for this activity are described in details. Magnetic field tolerance and radiation hardness of Tracker power supply units is also discussed at length.

  5. Evaluating Software Assurance Knowledge and Competency of Acquisition Professionals

    Science.gov (United States)

    2014-10-01

    Software Assurance Knowledge and Competency of Acquisition Professionals The Benefit of Standardized Acquisition Gartner forecasts that the...mathematics from New York University. Phone: 412-818-3454 E-mail: nrm@sei.cmu.edu REFERENCES 1. Gartner Worldwide IT Spending Forecast <http://www.gartner.com

  6. Dynamic Safety Cases for Through-Life Safety Assurance

    Science.gov (United States)

    Denney, Ewen; Pai, Ganesh; Habli, Ibrahim

    2015-01-01

    We describe dynamic safety cases, a novel operationalization of the concept of through-life safety assurance, whose goal is to enable proactive safety management. Using an example from the aviation systems domain, we motivate our approach, its underlying principles, and a lifecycle. We then identify the key elements required to move towards a formalization of the associated framework.

  7. Quality assurance of weather data for agricultural system model input

    Science.gov (United States)

    It is well known that crop production and hydrologic variation on watersheds is weather related. Rarely, however, is meteorological data quality checks reported for agricultural systems model research. We present quality assurance procedures for agricultural system model weather data input. Problems...

  8. Information Assurance Alignment: A Study of Performance Impacts

    Science.gov (United States)

    Ghezal, Said

    2011-01-01

    The positive effect on performance of the alignment between a business strategy and its different functional strategies has a wide support in the literature. As an emerging functional area, information assurance has come to play a strategic role by providing all departments and functions across an organization with a reliable, safe, and efficient…

  9. Quality Assurance Systems, TQM, and the New Collegialism.

    Science.gov (United States)

    Harvey, Lee

    This report discusses the application of the International Organization for Standards's ISO9000 quality assurance standard and Total Quality Management (TQM) to higher education in light of the "new collegialism." It defines the basic elements of ISO9000 and TQM, reviews the strengths and weaknesses of both approaches, and notes efforts…

  10. Quality Assurance Based on Descriptive and Parsimonious Appearance Models

    DEFF Research Database (Denmark)

    Nielsen, Jannik Boll; Eiríksson, Eyþór Rúnar; Kristensen, Rasmus Lyngby

    2015-01-01

    In this positional paper, we discuss the potential benefits of using appearance models in additive manufacturing, metal casting, wind turbine blade production, and 3D content acquisition. Current state of the art in acquisition and rendering of appearance cannot easily be used for quality assurance...

  11. 7 CFR 550.18 - Assurances/certifications.

    Science.gov (United States)

    2010-01-01

    ...)—7 CFR 3017; (b) Governmentwide requirements for Drug-Free Workplace—7 CFR 3021; (c) Non-discrimination. The Cooperator assures compliance with the following requirement: No person in the United States... discrimination under any project or activity under a non-assistance cooperative agreement. (d) Protection...

  12. Quality Assurance in Higher Education: Reflection, Criticism, and Change

    Science.gov (United States)

    Yingqiang, Zhang; Yongjian, Su

    2016-01-01

    Quality assurance in modern higher education is both an accountability-oriented ideology and a technological method. It has also evolved into a increasingly rationalist and professionalized power mechanism. Its advocacy of compliance, technological mythology, and imbalance between power and responsibility are inherent disadvantages of higher…

  13. Quality assurance and benchmarking : An approach for European dental schools

    NARCIS (Netherlands)

    Jones, M. L.; Hobson, R. S.; Plasschaert, A. J. M.; Gundersen, S.; Dummer, P.; Roger-Leroi, V.; Sidlauskas, A.; Hamlin, J.

    2007-01-01

    This document was written by Task Force 3 of DentEd III, which is a European Union funded Thematic Network working under the auspices of the Association for Dental Education in Europe (ADEE). It provides a guide to assist in the harmonisation of Dental Education Quality Assurance (QA) systems across

  14. Quality assurance and benchmarking: an approach for European dental schools.

    NARCIS (Netherlands)

    Jones, M.L.; Hobson, R.S.; Plasschaert, A.J.M.; Gundersen, S.; Dummer, P.; Roger-Leroi, V.; Sidlauskas, A.; Hamlin, J.

    2007-01-01

    This document was written by Task Force 3 of DentEd III, which is a European Union funded Thematic Network working under the auspices of the Association for Dental Education in Europe (ADEE). It provides a guide to assist in the harmonisation of Dental Education Quality Assurance (QA) systems across

  15. Quality Assurance in Psychology Programmes across Europe: Survey and Reflections

    Science.gov (United States)

    Marques, J. Frederico

    2013-01-01

    The present article examines how different institutions that offer psychology study cycles across Europe have adopted quality principles and have taken up particular quality assurance initiatives to raise standards and enhance quality. Thirty-eight different institutions from 32 countries who were members of a European psychology network responded…

  16. Assuring Quality in E-Learning Course Design: The Roadmap

    Science.gov (United States)

    Vlachopoulos, Dimitrios

    2016-01-01

    Quality Assurance (QA) concepts and applications in Higher Education (HE) emerge from evolving meanings related to HE's dynamic relationship with social, economic, cultural, and technological developments. The latter has been redefined by the growth spurred by the forms distance and online education acquired during the last decades. Creating a…

  17. Student Involvement in the Egyptian Quality Assurance System

    Science.gov (United States)

    Elassy, Noha

    2015-01-01

    Purpose: The purpose of this paper is to study the extent and the quality of student involvement in the quality assurance process (QAP) in Egyptian higher education institutions (HEIs). Design/methodology/approach: In this study, two qualitative methods were used to explore the extent and the quality of student involvement; these were focus groups…

  18. Strategic Planning and Quality Assurance in the Bologna Process

    Science.gov (United States)

    Kettunen, Juha; Kantola, Mauri

    2007-01-01

    Strategic planning and quality management have been developed independently of each other, but they meet in practice in many kinds of organisations. Strategic planning and quality assurance integrate different aspects of higher education institutions (HEIs) to ensure high-quality educational outcomes. This paper investigates the role of these two…

  19. Runtime Assurance Framework Development for Highly Adaptive Flight Control Systems

    Science.gov (United States)

    2015-12-01

    Porter , J., Sokolsky, O., “A Study on Run Time Assurance for Complex Cyber Physical Systems,” AFRL Final Report, April, 2013. Cofer, D...degrees-of- freedom (sweep and chi). Each diamond represents a single wing configuration. Inspecting this plot, as sweep increases, the trim angle-of

  20. Quality assurance: Importance of systems and standard operating procedures

    Directory of Open Access Journals (Sweden)

    Kishu Manghani

    2011-01-01

    Full Text Available It is mandatory for sponsors of clinical trials and contract research organizations alike to establish, manage and monitor their quality control and quality assurance systems and their integral standard operating procedures and other quality documents to provide high-quality products and services to fully satisfy customer needs and expectations. Quality control and quality assurance systems together constitute the key quality systems. Quality control and quality assurance are parts of quality management. Quality control is focused on fulfilling quality requirements, whereas quality assurance is focused on providing confidence that quality requirements are fulfilled. The quality systems must be commensurate with the Company business objectives and business model. Top management commitment and its active involvement are critical in order to ensure at all times the adequacy, suitability, effectiveness and efficiency of the quality systems. Effective and efficient quality systems can promote timely registration of drugs by eliminating waste and the need for rework with overall financial and social benefits to the Company.

  1. Quality Assurance Model for Digital Adult Education Materials

    Science.gov (United States)

    Dimou, Helen; Kameas, Achilles

    2016-01-01

    Purpose: This paper aims to present a model for the quality assurance of digital educational material that is appropriate for adult education. The proposed model adopts the software quality standard ISO/IEC 9126 and takes into account adult learning theories, Bloom's taxonomy of learning objectives and two instructional design models: Kolb's model…

  2. Transforming Fleet Network Operations with Collaborative Decision Support and Augmented Reality Technologies

    Science.gov (United States)

    2004-03-01

    transit between areas of responsibility. There is also the challenge of communicating with ships in other areas depending on operational requirements...within fault management are quality assurance for RAS (reliability, availability, and survivability), alarm surveillance, localization, correction...Accounting management includes usage measurement, tariffing and pricing, collection and finance, and enterprise control. This part of the FCAPS model

  3. Quality assurance measurement for emergency management

    Energy Technology Data Exchange (ETDEWEB)

    Pawlowski, M.S. [SL-OE-SD-IN Federal Emergency Management Agency, Washington, DC (United States)

    1993-12-31

    Under the Federal Civil Defense Act of 1950, as amended, the Federal Emergency Management Agency (FEMA) is charged with maintenance of a nationwide inventory of 4.3 million radiological instruments procured and granted by the federal government to state and local governments. These instruments are used by trained state Radiological Response Team Members, first responders, and critical workers to support the population from a national security or large-scale peacetime radiological disaster, e.g., Chernobyl, Three Mile Island, Satellite Reentry, etc. The inventory is maintained through a network of 100% federally funded state maintenance and calibration facilities, with overall technical guidance and standardization provided by the FEMA Radiological Instrumentation Test Facility. The system used to support maintenance and standardized calibration of the inventory consists of CDV-794 Radiation Calibrator (High Range), CDV-765 Model 2 Gamma Transfer Standard, CDV-790 Model 1 Calibrator (Low Range), and Dosimeter Transfer Standards. Past studies have indicated the {open_quotes}Readiness{close_quotes} and {open_quotes}Reliability{close_quotes} of the inventory to meet mission requirements based upon a standardized system of maintenance and calibration. FEMA has just initiated a new instrument Readiness and Reliability study with the State of Ohio Radiological Instrument Maintenance and Calibration Program to provide data to reassess the capability of the current inventory to support all types of peacetime and national security missions.

  4. 76 FR 48152 - Commercial Building Asset Rating Program

    Science.gov (United States)

    2011-08-08

    ... Improvements. (8) National Commercial Building Energy Database. (9) Quality Assurance. (10) Potential for... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Office of Energy Efficiency and Renewable Energy Commercial Building Asset Rating Program AGENCY: Office...

  5. NIST commitment to national MQA programs

    Energy Technology Data Exchange (ETDEWEB)

    Caswell, R.S. [National Institute of Standards and Technology, Gaithersburg, MD (United States)

    1993-12-31

    The program of the Ionizing Radiation Division, Physics Laboratory is discussed, especially relating to standards, calibrations, and measurement quality assurance (MQA). The NIST program is {open_quotes}vertically integrated,{close_quotes} meaning that activities extend from fundamental research to measurement research to supplying services and data. Typical methods NIST uses to assure the quality of the national standards are presented. Some of the programs in x-ray, gamma-ray, electron, neutron, and radioactivity research which support MQA are presented. Examples are given of MQA activities.

  6. Environmental radioactive intercomparison program and radioactive standards program

    Energy Technology Data Exchange (ETDEWEB)

    Dilbeck, G. [Environmental Monitoring Systems Laboratory, Las Vegas, NV (United States)

    1993-12-31

    The Environmental Radioactivity Intercomparison Program described herein provides quality assurance support for laboratories involved in analyzing public drinking water under the Safe Drinking Water Act (SDWA) Regulations, and to the environmental radiation monitoring activities of various agencies. More than 300 federal and state nuclear facilities and private laboratories participate in some phase of the program. This presentation describes the Intercomparison Program studies and matrices involved, summarizes the precision and accuracy requirements of various radioactive analytes, and describes the traceability determinations involved with radioactive calibration standards distributed to the participants. A summary of program participants, sample and report distributions, and additional responsibilities of this program are discussed.

  7. Meeting the Demand for Accountability: Case Study of a Teacher Education Program in China

    Directory of Open Access Journals (Sweden)

    Tak Cheung CHAN

    2009-02-01

    Full Text Available To meet the demand for accountability, a teacher education program in a university located in South China has established processes at the college, the program, and the faculty levels to assure its program quality. Highlights of the processes are: involvement of stakeholders and the examination of program effectiveness. Although much has been done to help program candidates succeed, more effort is needed in the areas of program assessment and continuous improvement to assure program quality. An accountability implementation plan, a beginning teacher mentoring program, and a comparative study of beginning teacher performance were recommended to further enforce its strategies toward program accountability.

  8. 76 FR 60848 - National Mammography Quality Assurance Advisory Committee; Notice of Meeting

    Science.gov (United States)

    2011-09-30

    ... HUMAN SERVICES Food and Drug Administration National Mammography Quality Assurance Advisory Committee... be open to the public. Name of Committee: National Mammography Quality Assurance Advisory Committee...) Proposed changes to the Mammography Quality Standard Act (MQSA) policies and inspection procedures;...

  9. Lunar Regenerative Fuel Cell (RFC) Reliability Testing for Assured Mission Success

    Science.gov (United States)

    Bents, David J.

    2009-01-01

    NASA's Constellation program has selected the closed cycle hydrogen oxygen Polymer Electrolyte Membrane (PEM) Regenerative Fuel Cell (RFC) as its baseline solar energy storage system for the lunar outpost and manned rover vehicles. Since the outpost and manned rovers are "human-rated," these energy storage systems will have to be of proven reliability exceeding 99 percent over the length of the mission. Because of the low (TRL=5) development state of the closed cycle hydrogen oxygen PEM RFC at present, and because there is no equivalent technology base in the commercial sector from which to draw or infer reliability information from, NASA will have to spend significant resources developing this technology from TRL 5 to TRL 9, and will have to embark upon an ambitious reliability development program to make this technology ready for a manned mission. Because NASA would be the first user of this new technology, NASA will likely have to bear all the costs associated with its development.When well-known reliability estimation techniques are applied to the hydrogen oxygen RFC to determine the amount of testing that will be required to assure RFC unit reliability over life of the mission, the analysis indicates the reliability testing phase by itself will take at least 2 yr, and could take up to 6 yr depending on the number of QA units that are built and tested and the individual unit reliability that is desired. The cost and schedule impacts of reliability development need to be considered in NASA's Exploration Technology Development Program (ETDP) plans, since life cycle testing to build meaningful reliability data is the only way to assure "return to the moon, this time to stay, then on to Mars" mission success.

  10. Development and Challenge of HIV/AIDS Testing Laboratory Network and Quality Assurance System in China

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    This paper describes the development and challenge of HIV/AIDS testing laboratory network and quality assurance system in China. At present, the HIV/AIDS testing laboratories includes three classes, the National AIDS Reference Laboratory, HIV/AIDS confirmatory laboratories and HIV/AIDS screening laboratories. All of them are accredited by the health authorities, and each class of laboratories take charge of their function strictly according to the "National Management of HIV/AIDS Detection (2006)". A complete quality assurance and quality control system for HIV/AIDS testing has been developed, which includes technical training, strict laboratory monitoring and approval,examination or proficiency testing on HIV/AIDS detection, and quality evaluation and supervision of HIV/AIDS diagnostic kits. Besides conduct the routine anti-HIV antibody test, more and more laboratories began to conduct other tests, such as CD4+ T lymphocyte cell counting, HIV viral load, HIV DNA PCR, genotyping, drug resistance, and HIV-1 recent infection test. The primary challenges faced by the HIV/AIDS testing laboratory network are in the areas of laboratory management and quality control. For example, the provincial PT program is inefficient, the internal quality control is conducted perfunctorily, personnel training can not met the needs of the workplace, which need to be improved.

  11. Design, building, and testing of the postlanding systems for the assured crew return vehicle

    Science.gov (United States)

    Hosterman, Kenneth C.; Anderson, Loren A.

    1991-01-01

    The design, building, and testing of the postlanding support systems for a water-landing Assured Crew Return Vehicle (ACRV) are presented. One ACRV will be permanently docked to Space Station Freedom, fulfilling NASA's commitment to Assured Crew Return Capability in the event of an accident or illness. The configuration of the ACRV is based on an Apollo Command Module (ACM) derivative. The 1990-1991 effort concentrated on the design, building, and testing of a one-fifth scale model of the egress and stabilization systems. The objective was to determine the feasibility of (1) stabilizing the ACM out of the range of motions that cause seasickness and (2) the safe and rapid removal of a sick or injured crew member from the ACRV. The development of the ACRV postlanding systems model was performed at the University of Central Florida with guidance from the Kennedy Space Center ACRV program managers. Emphasis was placed on four major areas. First was design and construction of a one-fifth scale model of the ACM derivative to accommodate the egress and stabilization systems for testing. Second was the identification of a water test facility suitable for testing the model in all possible configurations. Third was the construction of the rapid egress mechanism designed in the previous academic year for incorporation into the ACRV model. The fourth area was construction and motion response testing of the attitude ring and underwater parachute systems.

  12. Current Practices in Constructing and Evaluating Assurance Cases With Applications to Aviation

    Science.gov (United States)

    Rinehart, David J.; Knight, John C.; Rowanhill, Jonathan

    2015-01-01

    This report introduces and provides an overview of assurance cases including theory, practice, and evaluation. This report includes a section that introduces the principles, terminology, and history of assurance cases. The core of the report presents twelve example uses of assurance cases from a range of domains, using a novel classification scheme. The report also reviews the state of the art in assurance case evaluation methods.

  13. Evaluation of a Standardized Method of Quality Assurance in Mental Health Records: A Pilot Study

    Science.gov (United States)

    Bradshaw, Kelsey M.; Donohue, Bradley; Fayeghi, Jasmine; Lee, Tiffany; Wilks, Chelsey R.; Ross, Brendon

    2016-01-01

    The widespread adoption of research-supported treatments by mental health providers has facilitated empirical development of quality assurance (QA) methods. Research in this area has focused on QA systems aimed at assuring the integrity of research-supported treatment implementation, while examination of QA systems to assure appropriate…

  14. 40 CFR 75.21 - Quality assurance and quality control requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Quality assurance and quality control... assurance and quality control requirements. (a) Continuous emission monitoring systems. The owner or... system according to the quality assurance and quality control procedures in appendix B of this part....

  15. Evaluating Outsourcing Information Technology and Assurance Expertise by Small Non-Profit Organizations

    Science.gov (United States)

    Guinn, Fillmore

    2013-01-01

    Small non-profit organizations outsource at least one information technology or information assurance process. Outsourcing information technology and information assurance processes has increased every year. The study was to determine the key reasons behind the choice to outsource information technology and information assurance processes. Using…

  16. Quality assurance and benchmarking: an approach for European dental schools.

    Science.gov (United States)

    Jones, M L; Hobson, R S; Plasschaert, A J M; Gundersen, S; Dummer, P; Roger-Leroi, V; Sidlauskas, A; Hamlin, J

    2007-08-01

    This document was written by Task Force 3 of DentEd III, which is a European Union funded Thematic Network working under the auspices of the Association for Dental Education in Europe (ADEE). It provides a guide to assist in the harmonisation of Dental Education Quality Assurance (QA) systems across the European Higher Education Area (EHEA). There is reference to the work, thus far, of DentEd, DentEd Evolves, DentEd III and the ADEE as they strive to assist the convergence of standards in dental education; obviously QA and benchmarking has an important part to play in the European HE response to the Bologna Process. Definitions of Quality, Quality Assurance, Quality Management and Quality Improvement are given and put into the context of dental education. The possible process and framework for Quality Assurance are outlined and some basic guidelines/recommendations suggested. It is recognised that Quality Assurance in Dental Schools has to co-exist as part of established Quality Assurance systems within faculties and universities, and that Schools also may have to comply with existing local or national systems. Perhaps of greatest importance are the 14 'requirements' for the Quality Assurance of Dental Education in Europe. These, together with the document and its appendices, were unanimously supported by the ADEE at its General Assembly in 2006. As there must be more than one road to achieve a convergence or harmonisation standard, a number of appendices are made available on the ADEE website. These provide a series of 'toolkits' from which schools can 'pick and choose' to assist them in developing QA systems appropriate to their own environment. Validated contributions and examples continue to be most welcome from all members of the European dental community for inclusion at this website. It is realised that not all schools will be able to achieve all of these requirements immediately, by definition, successful harmonisation is a process that will take time. At

  17. Mission operations and command assurance: Instilling quality into flight operations

    Science.gov (United States)

    Welz, Linda L.; Witkowski, Mona M.; Bruno, Kristin J.; Potts, Sherrill S.

    1993-03-01

    Mission Operations and Command Assurance (MO&CA) is a Total Quality Management (TQM) task on JPL projects to instill quality in flight mission operations. From a system engineering view, MO&CA facilitates communication and problem-solving among flight teams and provides continuous process improvement to reduce the probability of radiating incorrect commands to a spacecraft. The MO&CA task has evolved from participating as a member of the spacecraft team to an independent team reporting directly to flight project management and providing system level assurance. JPL flight projects have benefited significantly from MO&CA's effort to contain risk and prevent rather than rework errors. MO&CA's ability to provide direct transfer of knowledge allows new projects to benefit from previous and ongoing flight experience.

  18. Implementing a High-Assurance Smart-Card OS

    Science.gov (United States)

    Karger, Paul A.; Toll, David C.; Palmer, Elaine R.; McIntosh, Suzanne K.; Weber, Samuel; Edwards, Jonathan W.

    Building a high-assurance, secure operating system for memory constrained systems, such as smart cards, introduces many challenges. The increasing power of smart cards has made their use feasible in applications such as electronic passports, military and public sector identification cards, and cell-phone based financial and entertainment applications. Such applications require a secure environment, which can only be provided with sufficient hardware and a secure operating system. We argue that smart cards pose additional security challenges when compared to traditional computer platforms. We discuss our design for a secure smart card operating system, named Caernarvon, and show that it addresses these challenges, which include secure application download, protection of cryptographic functions from malicious applications, resolution of covert channels, and assurance of both security and data integrity in the face of arbitrary power losses.

  19. Software Quality Assurance in Software Projects: A Study of Pakistan

    Directory of Open Access Journals (Sweden)

    Faisal Shafique Butt

    2013-05-01

    Full Text Available Software quality is specific property which tells what kind of standard software should have. In a software project, quality is the key factor of success and decline of software related organization. Many researches have been done regarding software quality. Software related organization follows standards introduced by Capability Maturity Model Integration (CMMI to achieve good quality software. Quality is divided into three main layers which are Software Quality Assurance (SQA, Software Quality Plan (SQP and Software Quality Control (SQC. So In this study, we are discussing the quality standards and principles of software projects in Pakistan software Industry and how these implemented quality standards are measured and managed. In this study, we will see how many software firms are following the rules of CMMI to create software. How many are reaching international standards and how many firms are measuring the quality of their projects. The results show some of the companies are using software quality assurance techniques in Pakstan.

  20. Quality Interaction Between Mission Assurance and Project Team Members

    Science.gov (United States)

    Kwong-Fu, Helenann H.; Wilson, Robert K.

    2006-01-01

    Mission Assurance independent assessments started during the development cycle and continued through post launch operations. In operations, Health and Safety of the Observatory is of utmost importance. Therefore, Mission Assurance must ensure requirements compliance and focus on process improvements required across the operational systems including new/modified products, tools, and procedures. The deployment of the interactive model involves three objectives: Team member Interaction, Good Root Cause Analysis Practices, and Risk Assessment to avoid reoccurrences. In applying this model, we use a metric based measurement process and was found to have the most significant effect, which points to the importance of focuses on a combination of root cause analysis and risk approaches allowing the engineers the ability to prioritize and quantify their corrective actions based on a well-defined set of root cause definitions (i.e. closure criteria for problem reports), success criteria and risk rating definitions.