WorldWideScience

Sample records for arthrobacter sp bp

  1. Uptake of Glyphosate by an Arthrobacter sp

    OpenAIRE

    Pipke, Rüdiger; Schulz, Arno; Amrhein, Nikolaus

    1987-01-01

    The uptake of glyphosate (N-[phosphonomethyl]glycine) by an Arthrobacter sp. which can utilize this herbicide as its sole source of phosphorus was investigated. Orthophosphate suppressed the expression of the uptake system for glyphosate and also competed with glyphosate for uptake. The Km for glyphosate uptake was 125 μM, and the Ki for orthophosphate was 24 μM. Organophosphonates as well as organophosphates inhibited glyphosate uptake, but only organophosphates and orthophosphate suppressed...

  2. Complete genome sequence and metabolic potential of the quinaldine-degrading bacterium Arthrobacter sp. Rue61a

    Directory of Open Access Journals (Sweden)

    Niewerth Heiko

    2012-10-01

    Full Text Available Abstract Background Bacteria of the genus Arthrobacter are ubiquitous in soil environments and can be considered as true survivalists. Arthrobacter sp. strain Rue61a is an isolate from sewage sludge able to utilize quinaldine (2-methylquinoline as sole carbon and energy source. The genome provides insight into the molecular basis of the versatility and robustness of this environmental Arthrobacter strain. Results The genome of Arthrobacter sp. Rue61a consists of a single circular chromosome of 4,736,495 bp with an average G + C content of 62.32%, the circular 231,551-bp plasmid pARUE232, and the linear 112,992-bp plasmid pARUE113 that was already published. Plasmid pARUE232 is proposed to contribute to the resistance of Arthrobacter sp. Rue61a to arsenate and Pb2+, whereas the linear plasmid confers the ability to convert quinaldine to anthranilate. Remarkably, degradation of anthranilate exclusively proceeds via a CoA-thioester pathway. Apart from quinaldine utilization, strain Rue61a has a limited set of aromatic degradation pathways, enabling the utilization of 4-hydroxy-substituted aromatic carboxylic acids, which are characteristic products of lignin depolymerization, via ortho cleavage of protocatechuate. However, 4-hydroxyphenylacetate degradation likely proceeds via meta cleavage of homoprotocatechuate. The genome of strain Rue61a contains numerous genes associated with osmoprotection, and a high number of genes coding for transporters. It encodes a broad spectrum of enzymes for the uptake and utilization of various sugars and organic nitrogen compounds. A. aurescens TC-1 is the closest sequenced relative of strain Rue61a. Conclusions The genome of Arthrobacter sp. Rue61a reflects the saprophytic lifestyle and nutritional versatility of the organism and a strong adaptive potential to environmental stress. The circular plasmid pARUE232 and the linear plasmid pARUE113 contribute to heavy metal resistance and to the ability to degrade

  3. Arthrobacter deserti sp. nov., isolated from a desert soil sample.

    Science.gov (United States)

    Hu, Qing-Wen; Chu, Xiao; Xiao, Min; Li, Chang-Tian; Yan, Zheng-Fei; Hozzein, Wael N; Kim, Chang-Jin; Zhi, Xiao-Yang; Li, Wen-Jun

    2016-05-01

    A Gram-stain-positive, non-motile, rod-shaped, catalase-positive and oxidase-negative bacterium, designated YIM CS25T, was isolated from a soil sample collected from Turpan desert in Xinjiang Uyghur Autonomous Region, north-western China. The isolate grew at 15-40 °C, at pH 6.0-8.0 and with 0-6 % (w/v) NaCl. The phylogenetic trees based on 16S rRNA gene sequences revealed that strain YIM CS25T belonged to the genus Arthrobacter and was closely related to Arthrobacter halodurans JSM 078085T (95.89 % similarity). The peptidoglycan type contained lysine, alanine and glutamic acid. The major whole-cell sugars were galactose, glucose and ribose. The isolate contained diphosphatidylglycerol, phosphatidylglycerol and phosphatidylinositol as the major polar lipids and MK-9 (H2) as the predominant menaquinone. The major cellular fatty acids were anteiso-C15 : 0, iso-C15 : 0, anteiso-C17 : 0, iso-C16 : 0 and anteiso-C17 : 1ω9c. The genomic DNA G+C content was 68.3 mol%. On the basis of phylogenetic, phenotypic and chemotaxonomic analysis, strain YIM CS25T is considered to represent a novel species of the genus Arthrobacter, for which the name Arthrobacter deserti sp. nov. is proposed. The type strain is YIM CS25T ( = KCTC 39544T = CGMCC 1.15091T). PMID:26908080

  4. 2,3-Dihydroxybiphenyl dioxygenase gene was first discovered in Arthrobacter sp. strain P J3

    Institute of Scientific and Technical Information of China (English)

    YANG MeiYing; MA PengDa; LI WenMing; LIU JinYing; LI Liang; ZHU XiaoJuan; WANG XingZhi

    2007-01-01

    Bacterium strain PJ3, isolated from wastewater and identified as Arthrobacter sp. bacterium based on its 16S rDNA gene, could use carbazole as the sole carbon, nitrogen and energy source. The genomic libraryof strain PJ3 was constructed and a positive clone JM109 (pUCW402) was screened out for the expression of dioxygenase by the ability to form yellow ring-fission product. A 2,3-dihydroxybiphenyl dioxygenase (23DHBD) gene of 933 bp was found in the 3360 bp exogenous fragment of pUCW402 by GenSCAN software and BLAST analysis. The phylogenetic analysis showed that 23DHBD from strain PJ3 formed a deep branch separate from a cluster containing most known 23DHBD in GenBank.Southern hybridization confirmed for the first time that the 23DHBD gene was from the genomic DNA of Arthrobacter sp. PJ3. In order to test the gene function, recombinant bacterium BL21 (pETW-8) was constructed to express 23DHBD. The expression level in BL21 (pETW-8) was highest compared with the recombinant bacteria JM109 (pUCW402) and strain PJ3. We observed that 23DHBD was not absolute specific. The enzyme activity was higher with 2,3-dihydroxybiphenyl as a substrate than with catechol.The substrate specificity assay suggested that 23DHBD was essential for cleavage of bi-cyclic aromatic compounds during the course of aromatic compound biodegradation in Arthrobacter sp. strain PJ3.

  5. Adhesion of an Amylolytic Arthrobacter sp. to Starch-Containing Plastic Films

    OpenAIRE

    Imam, Syed H.; Gould, J. Michael

    1990-01-01

    Cells of the amylolytic bacterium KB-1 (thought to be an Arthrobacter sp.) adhered (∼70%) to the surface of plastic films composed of starch-poly (methylacrylate) graft copolymer (starch-PMA), but did not adhere (

  6. Plant compounds that induce polychlorinated biphenyl biodegradation by Arthrobacter sp. strain B1B.

    OpenAIRE

    Gilbert, E S; Crowley, D. E.

    1997-01-01

    Plant compounds that induced Arthrobacter sp. strain B1B to cometabolize polychlorinated biphenyls (PCBs) were identified by a screening assay based on the formation of a 4,4'-dichlorobiphenyl ring fission product. A chemical component of spearmint (Mentha spicata), l-carvone, induced Arthrobacter sp. strain B1B to cometabolize Aroclor 1242, resulting in significant degradation of 26 peaks in the mixture, including selected tetra- and pentachlorobiphenyls. Evidence for PCB biodegradation incl...

  7. Isolation and Characterization of IS1409, an Insertion Element of 4-Chlorobenzoate-Degrading Arthrobacter sp. Strain TM1, and Development of a System for Transposon Mutagenesis

    OpenAIRE

    Gartemann, Karl-Heinz; Eichenlaub, Rudolf

    2001-01-01

    A new insertion element of 1,449 bp with 25-bp perfect terminal repeats, designated IS1409, was identified in the chromosome of 4-chlorobenzoate-degrading Arthrobacter sp. strain TM1 NCIB12013. Upon insertion, IS1409 causes a target duplication of 8 bp. IS1409 carries only a single open reading frame of 435 codons encoding the transposase TnpA. Both TnpA and the overall organization of IS1409 are highly similar to those of some related insertion elements of the ISL3 group (J. Mahillon and M. ...

  8. Isolation of Indole Utilizing Bacteria Arthrobacter sp. and Alcaligenes sp. From Livestock Waste.

    Science.gov (United States)

    Kim, Minsu; Lee, Jin-Hyung; Kim, Eonmi; Choi, Hyukjae; Kim, Younghoon; Lee, Jintae

    2016-06-01

    Indole is an interspecies and interkingdom signaling molecule widespread in different environmental compartment. Although multifaceted roles of indole in different biological systems have been established, little information is available on the microbial utilization of indole in the context of combating odor emissions from different types of waste. The present study was aimed at identifying novel bacteria capable of utilizing indole as the sole carbon and energy source. From the selective enrichment of swine waste and cattle feces, we identified Gram-positive and Gram-negative bacteria belonging to the genera Arthrobacter and Alcaligenes. Bacteria belonging to the genus Alcaligenes showed higher rates of indole utilization than Arthrobacter. Indole at 1.0 mM for growth was completely utilized by Alcaligenes sp. in 16 h. Both strains produced two intermediates, anthranilic acid and isatin, during aerobic indole metabolism. These isolates were also able to grow on several indole derivatives. Interestingly, an adaptive response in terms of a decrease in cell size was observed in both strains in the presence of indole. The present study will help to explain the degradation of indole by different bacteria and also the pathways through which it is catabolized. Furthermore, these novel bacterial isolates could be potentially useful for the in situ attenuation of odorant indole and its derivatives emitted from different types of livestock waste. PMID:27570307

  9. Characterization and molecular cloning of a novel enzyme, inorganic polyphosphate/ATP-glucomannokinase, of Arthrobacter sp. strain KM.

    Science.gov (United States)

    Mukai, Takako; Kawai, Shigeyuki; Matsukawa, Hirokazu; Matuo, Yuhsi; Murata, Kousaku

    2003-07-01

    A bacterium exhibiting activities of several inorganic polyphosphate [poly(P)]- and ATP-dependent kinases, including glucokinase, NAD kinase, mannokinase, and fructokinase, was isolated, determined to belong to the genus Arthrobacter, and designated Arthrobacter sp. strain KM. Among the kinases, a novel enzyme responsible for the poly(P)- and ATP-dependent mannokinase activities was purified 2,200-fold to homogeneity from a cell extract of the bacterium. The purified enzyme was a monomer with a molecular mass of 30 kDa. This enzyme phosphorylated glucose and mannose with a high affinity for glucose, utilizing poly(P) as well as ATP, and was designated poly(P)/ATP-glucomannokinase. The K(m) values of the enzyme for glucose, mannose, ATP, and hexametaphosphate were determined to be 0.50, 15, 0.20, and 0.02 mM, respectively. The catalytic sites for poly(P)-dependent phosphorylation and ATP-dependent phosphorylation of the enzyme were found to be shared, and the poly(P)-utilizing mechanism of the enzyme was shown to be nonprocessive. The gene encoding the poly(P)/ATP-glucomannokinase was cloned from Arthrobacter sp. strain KM, and its nucleotide sequence was determined. This gene contained an open reading frame consisting of 804 bp coding for a putative polypeptide with a calculated molecular mass of 29,480 Da. The deduced amino acid sequence of the polypeptide exhibited homology to the amino acid sequences of the poly(P)/ATP-glucokinase of Mycobacterium tuberculosis H37Rv (level of homology, 45%), ATP-dependent glucokinases of Corynebacterium glutamicum (45%), Renibacterium salmoninarum (45%), and Bacillus subtilis (35%), and proteins of bacteria belonging to the order Actinomyces whose functions are not known. Alignment of these homologous proteins revealed seven conserved regions. The mannose and poly(P) binding sites of poly(P)/ATP-glucomannokinase are discussed. PMID:12839753

  10. Improving the Survival of Arthrobacter sp., CW9 during Spray Drying Monitored by Scan Electric Microscope

    OpenAIRE

    Zhenqiang Xia; Ming Zhu; Yanqiu Zhang

    2014-01-01

    The culture of an aquaculture probiotic, i.e., Arthrobacter sp., CW9, was spray dried with different carriers/protectants, in which Scan Electric Microscope (SEM) was used to analyze the surface of micro-paticles produced by spray-drying. Matrix of protectants, inlet temperature and feed rate were optimized according to the survival rate after spray drying. Scanning electron micrographs showed that cracks formed on the particle surface were a key factor in enhancing bacteria survival during s...

  11. New metabolic pathway for degradation of 2-nitrobenzoate by Arthrobacter sp. SPG

    Directory of Open Access Journals (Sweden)

    Pankaj Kumar Arora

    2015-06-01

    Full Text Available Arthrobacter sp. SPG utilized 2-nitrobenzoate as its sole source of carbon and energy and degraded it with accumulation of stoichiometric amounts of nitrite ions. Salicylate and catechol were detected as metabolites of the 2-nitrobenzoate degradation using high performance liquid chromatography and gas chromatography-mass spectrometry. Enzyme activities for 2-nitrobenzoate-2-monooxygenase, salicylate hydroxylase, and catechol-1,2-dioxygenase were detected in the crude extracts of the 2-nitrobenzoate-induced cells of strain SPG. The 2-nitrobenzoate-monooxygenase activity resulted in formation of salicylate and nitrite from 2-nitrobenzoate whereas salicylate hydroxylase catalyzed the conversion of salicylate to catechol. The ring-cleaving enzyme, catechol-1,2-dioxygenase cleaved catechol to cis, cis-muconic acid. Cells of strain SPG were able to degrade 2-nitrobenzoate in sterile as well as non-sterile soil microcosms. The results of microcosm studies showed that strain SPG degraded more than 90% of 2-nitrobenzoate within 10-12 days. This study clearly shows that Arthrobacter sp. SPG degraded 2-nitrobenzoate via a new pathway with formation of salicylate and catechol as metabolites. Arthrobacter sp. SPG may be used for bioremediation of 2-nitrobenzoate-contaminated sites due to its ability to degrade 2-nitrobenzoate in soil.

  12. Metabolic pathway for degradation of 2-chloro-4-aminophenol by Arthrobacter sp. SPG

    OpenAIRE

    Arora, Pankaj Kumar; Mohanta, Tapan Kumar; Srivastava, Alok; Bae, Hanhong; Singh, Vijay Pal

    2014-01-01

    A degradation pathway of 2-chloro-4-aminophenol (2C4AP) was studied in an Arthrobacter sp. SPG that utilized 2C4AP as its sole source of carbon and energy. The 2C4AP degradation was initiated by a 2C4AP-deaminase that catalyzed the conversion of 2C4AP into chlorohydroquinone (CHQ) with removal of ammonium ion. In the next step, a CHQ-dehalogenase dehalogenated CHQ to hydroquinone (HQ) that cleaved into γ-hydroxymuconic semialdehyde by a HQ-dioxygenase. The 2C4AP degradation was also investiga...

  13. Draft Genome Sequence of a Papaverine-Degrading, Gram-positive Arthrobacter sp., Isolated from Soil Near Hohenheim, Germany

    OpenAIRE

    Reznicek, Ondrej; Facey, Sandra J; Hauer, Bernhard

    2015-01-01

    We present the 4.8-Mb draft genome of a soil bacterium identified as Arthrobacter sp. This Gram-positive soil bacterium is able to use the aromatic compound papaverine as sole carbon source and will be examined for novel oxygenases.

  14. Optimization of cultural conditions for growth associated chromate reduction by Arthrobacter sp. SUK 1201 isolated from chromite mine overburden

    International Nuclear Information System (INIS)

    Highlights: ► Isolation of a potent Cr(VI) resistant and reducing Arthrobacter SUK 1201 from chromite mine overburdens of Orissa, India. ► Phylogenetically (16S rDNA analysis), Arthrobacter SUK 1201 showed 99% nucleotide base pair similarity with Arthrobacter GZK-1. ► Production of insoluble chromium precipitates during chromate reduction under batch culture by the isolate SUK 1201. ► Confirmation of formation of insoluble chromium precipitate during reduction studies by EDX analysis. ► Optimization of cultural conditions for Cr(VI) reduction under batch culture leading to complete reduction of 2 mM of Cr(VI). - Abstract: Arthrobacter sp. SUK 1201, a chromium resistant and reducing bacterium having 99% sequence homology of 16S rDNA with Arthrobacter sp. GZK-1 was isolated from chromite mine overburden dumps of Orissa, India. The objective of the present study was to optimize the cultural conditions for chromate reduction by Arthrobacter sp. SUK 1201. The strain showed 67% reduction of 2 mM chromate in 7 days and was associated with the formation of green insoluble precipitate, which showed characteristic peak of chromium in to energy dispersive X-ray analysis. However, Fourier transform infrared spectra have failed to detect any complexation of end products of Cr(VI) reduction with the cell mass. Reduction of chromate increased with increased cell density and was maximum at 1010 cells/ml, but the reduction potential decreased with increase in Cr(VI) concentration. Chromate reducing efficiency was promoted when glycerol and glucose was used as electron donors. Optimum pH and temperature of Cr(VI) reduction was 7.0 and 35 °C respectively. The reduction process was inhibited by several metal ions and metabolic inhibitors but not by Cu(II) and DNP. These findings suggest that Arthrobacter sp. SUK 1201 has great promise for use in Cr(VI) detoxification under a wide range of environmental conditions.

  15. Metabolic pathway for degradation of 2-chloro-4-aminophenol by Arthrobacter sp. SPG.

    Science.gov (United States)

    Arora, Pankaj Kumar; Mohanta, Tapan Kumar; Srivastava, Alok; Bae, Hanhong; Singh, Vijay Pal

    2014-01-01

    A degradation pathway of 2-chloro-4-aminophenol (2C4AP) was studied in an Arthrobacter sp. SPG that utilized 2C4AP as its sole source of carbon and energy. The 2C4AP degradation was initiated by a 2C4AP-deaminase that catalyzed the conversion of 2C4AP into chlorohydroquinone (CHQ) with removal of ammonium ion. In the next step, a CHQ-dehalogenase dehalogenated CHQ to hydroquinone (HQ) that cleaved into γ-hydroxymuconic semialdehyde by a HQ-dioxygenase. The 2C4AP degradation was also investigated in sterile and non-sterile soil microcosms using strain SPG. The results show that the SPG cells degraded 2C4AP more rapidly in sterile soil than non-sterile soil. Our studies showed that strain SPG may be used for bioremediation of 2C4AP-contaminated sites. This is the first report of the 2C4AP degradation by any bacteria. PMID:25427856

  16. IN-VITRO BIOREDUCTION OF HEXAVALENT CHROMIUM BY VIABLE WHOLE CELLS OF Arthrobacter sp. SUK 1201

    Directory of Open Access Journals (Sweden)

    Satarupa Dey

    2014-08-01

    Full Text Available A chromium resistant and reducing bacterium Arthrobacter sp. SUK 1201 was isolated from chromite mine overburden dumps of Orissa, India. Viable whole cells of this isolate was capable of completely reducing 100 µM Cr(VI in chemically defined MS medium within 28 h of incubation under batch cultivation. Reduction of chromate increased with increased cell density and was maximum at a density of 1010 cells/ml, but the reduction potential of the suspended cells decreased with increase in Cr(VI concentration in the medium. Chromate reducing efficiency was promoted when glycerol and glucose was used as electron donors, while the optimum pH and temperature of Cr(VI reduction was found to be 7.0 and 35°C respectively. The reduction process was inhibited by divalent cations Ni, Co and Cd, but not by Cu and Fe. Similarly, carbonyl cyanide m-chlorophenylhydrazone (CCCP, N,N,-Di cyclohexyl carboiimide (DCC, sodium azide and sodium fluoride were inhibitory to chromate reduction, while in presence of 2,4 dinitrophenol (2,4 DNP chromate reduction by SUK 1201 cells remained unaffected.

  17. s-triazine degrading bacterial isolate Arthrobacter sp. AK-YN10, a candidate for bioaugmentation of atrazine contaminated soil.

    Science.gov (United States)

    Sagarkar, Sneha; Bhardwaj, Pooja; Storck, Veronika; Devers-Lamrani, Marion; Martin-Laurent, Fabrice; Kapley, Atya

    2016-01-01

    The Arthrobacter sp. strain AK-YN10 is an s-triazine pesticide degrading bacterium isolated from a sugarcane field in Central India with history of repeated atrazine use. AK-YN10 was shown to degrade 99 % of atrazine in 30 h from media supplemented with 1000 mg L(-1) of the herbicide. Draft genome sequencing revealed similarity to pAO1, TC1, and TC2 catabolic plasmids of the Arthrobacter taxon. Plasmid profiling analyses revealed the presence of four catabolic plasmids. The trzN, atzB, and atzC atrazine-degrading genes were located on a plasmid of approximately 113 kb.The flagellar operon found in the AK-YN10 draft genome suggests motility, an interesting trait for a bioremediation agent, and was homologous to that of Arthrobacter chlorophenolicus. The multiple s-triazines degradation property of this isolate makes it a good candidate for bioremediation of soils contaminated by s-triazine pesticides. PMID:26403923

  18. Arthrobacter pokkalii sp nov, a Novel Plant Associated Actinobacterium with Plant Beneficial Properties, Isolated from Saline Tolerant Pokkali Rice, Kerala, India

    Science.gov (United States)

    Krishnan, Ramya; Menon, Rahul Ravikumar; Tanaka, Naoto; Busse, Hans-Jürgen; Krishnamurthi, Srinivasan; Rameshkumar, Natarajan

    2016-01-01

    classification of strain P3B162T as a novel Arthrobacter species and we propose Arthrobacter pokkalii sp.nov.as its name. The type strain is P3B162T (= KCTC 29498T = MTCC 12358T). PMID:26963092

  19. Arthrobacter pokkalii sp nov, a Novel Plant Associated Actinobacterium with Plant Beneficial Properties, Isolated from Saline Tolerant Pokkali Rice, Kerala, India.

    Science.gov (United States)

    Krishnan, Ramya; Menon, Rahul Ravikumar; Tanaka, Naoto; Busse, Hans-Jürgen; Krishnamurthi, Srinivasan; Rameshkumar, Natarajan

    2016-01-01

    classification of strain P3B162T as a novel Arthrobacter species and we propose Arthrobacter pokkalii sp.nov.as its name. The type strain is P3B162T (= KCTC 29498T = MTCC 12358T). PMID:26963092

  20. Optimization of Endoglucanase Production from a Novel Bacterial Isolate, Arthrobacter sp. HPG166 and Characterization of Its Properties

    Directory of Open Access Journals (Sweden)

    Shengwei Huang

    2015-10-01

    Full Text Available ABSTRACTIn this study, a potential novel cellulolytic bacteriumArthrobacter sp. HPG166 was isolated from the hindgut of root-feeding larvaeHolotrichia parallela. Optimization of fermentation factors for endoglucanase production byArthrobacter sp. HPG166 was carried out via response surface methodology. Sodium carboxymethylcellulose 1.19% (w/v and beef extract 0.35% (w/v were the ideal combination of carbon and nitrogen sources for enzyme production; the optimum temperature and pH for cellulase production were 34°C and pH 8.0 respectively. Under the optimized fermentation conditions, the maximum endoglucanase activity of 1.411 U mL-1 was obtained. The crude endoglucanase was thermotolerant as it retained 50.31% of its activity after incubation at 70°C for an hour. Metal profile of the enzyme indicated that Mg2+ and Na+ were strong stimulators while Mn2+ and Co+ drastically inhibited its activity. Due to its particular characteristics, this enzyme could have potential for industrial applications.

  1. Studies on Bioflocculant Production by Arthrobacter sp. Raats, a Freshwater Bacteria Isolated from Tyume River, South Africa

    Directory of Open Access Journals (Sweden)

    Uchechukwu Nwodo

    2012-01-01

    Full Text Available A bioflocculant-producing bacteria was isolated from Tyume River in the Eastern Cape Province, South Africa and identified by 16S rRNA gene nucleotide sequence to have 91% similarity to Arthrobacter sp. 5J12A, and the nucleotide sequence was deposited in GenBank as Arthrobacter sp. Raats (accession number HQ875723. The bacteria produced an extracellular bioflocculant when grown aerobically in a production medium containing glucose as sole carbon source and had an initial pH of 7.0. Influences of carbon, nitrogen and metal ions sources, as well as initial pH on flocculating activity were investigated. The bacteria optimally produced the bioflocullant when lactose and urea were used as sole sources of carbon and nitrogen respectively with flocculating activities of 75.4% and 83.4% respectively. Also, the bacteria produced the bioflocculant optimally when initial pH of the medium was 7.0 (flocculating activity 84%, and when Mg2+ was used as cation (flocculating activity 77%. Composition analyses indicated the bioflocculant to be principally a glycoprotein made up of about 56% protein and 25% total carbohydrate.

  2. Arthrobacter nitroguajacolicus sp. nov., a novel 4-nitroguaiacol-degrading actinobacterium

    Czech Academy of Sciences Publication Activity Database

    Koutoučková, L.; Schumann, P.; Durnová, E.; Spröer, C.; Sedláček, I.; Neča, J.; Zdráhal, Zbyněk; Němec, M.

    2004-01-01

    Roč. 54, č. 3 (2004), s. 773-777. ISSN 1466-5026 R&D Projects: GA ČR GA204/00/P095 Institutional research plan: CEZ:AV0Z4031919 Keywords : Nitroguaiacol * actinobacterium * Arthrobacter Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 3.015, year: 2004

  3. A method for the production of D-tagatose using a recombinant Pichia pastoris strain secreting β-D-galactosidase from Arthrobacter chlorophenolicus and a recombinant L-arabinose isomerase from Arthrobacter sp. 22c

    Directory of Open Access Journals (Sweden)

    Wanarska Marta

    2012-08-01

    Full Text Available Abstract Background D-Tagatose is a natural monosaccharide which can be used as a low-calorie sugar substitute in food, beverages and pharmaceutical products. It is also currently being tested as an anti-diabetic and obesity control drug. D-Tagatose is a rare sugar, but it can be manufactured by the chemical or enzymatic isomerization of D-galactose obtained by a β-D-galactosidase-catalyzed hydrolysis of milk sugar lactose and the separation of D-glucose and D-galactose. L-Arabinose isomerases catalyze in vitro the conversion of D-galactose to D-tagatose and are the most promising enzymes for the large-scale production of D-tagatose. Results In this study, the araA gene from psychrotolerant Antarctic bacterium Arthrobacter sp. 22c was isolated, cloned and expressed in Escherichia coli. The active form of recombinant Arthrobacter sp. 22c L-arabinose isomerase consists of six subunits with a combined molecular weight of approximately 335 kDa. The maximum activity of this enzyme towards D-galactose was determined as occurring at 52°C; however, it exhibited over 60% of maximum activity at 30°C. The recombinant Arthrobacter sp. 22c L-arabinose isomerase was optimally active at a broad pH range of 5 to 9. This enzyme is not dependent on divalent metal ions, since it was only marginally activated by Mg2+, Mn2+ or Ca2+ and slightly inhibited by Co2+ or Ni2+. The bioconversion yield of D-galactose to D-tagatose by the purified L-arabinose isomerase reached 30% after 36 h at 50°C. In this study, a recombinant Pichia pastoris yeast strain secreting β-D-galactosidase Arthrobacter chlorophenolicus was also constructed. During cultivation of this strain in a whey permeate, lactose was hydrolyzed and D-glucose was metabolized, whereas D-galactose was accumulated in the medium. Moreover, cultivation of the P. pastoris strain secreting β-D-galactosidase in a whey permeate supplemented with Arthrobacter sp. 22c L-arabinose isomerase resulted in a 90% yield

  4. Effects of Cd (Ⅱ) on the physico-biochemical behaviors of Arthrobacter sp.and Bacillus sp.%镉胁迫对节杆菌(Arthrobacter sp.)和芽孢杆菌(Bacillus sp.)生理生化特性的影响

    Institute of Scientific and Technical Information of China (English)

    杜瑞英

    2012-01-01

    将节杆菌和芽孢杆菌分别暴露于不同质量比的镉溶液中,进行不同暴露时间的急性毒性试验.结果表明,20 mg/kg的Cd(Ⅱ)处理会使节杆菌中还原型谷胱甘肽(GSH)质量浓度显著降低,细胞膜脂质过氧化产物——硫代巴比妥酸活性物质(TBARS)浓度显著升高;0.2mg/kg的Cd(Ⅱ)处理会使芽孢杆菌中GSH质量浓度、过氧化氢酶(CAT)活性显著降低.节杆菌的可溶性蛋白、可溶性糖质量浓度随暴露时间延长而减少,GSH质量浓度、CAT和超氧化物歧化酶(SOD)活性随暴露时间延长而增加,TBARS浓度呈先减后增的变化趋势;芽孢杆菌的可溶性蛋白质量浓度、CAT活性和TBARS浓度呈先增后减的变化趋势,可溶性糖、GSH质量浓度和SOD活性呈先减后增的变化趋势.镉处理对节杆菌和芽孢杆菌具有一定的胁迫作用,两种菌通过启动不同的抗性系统来抵抗外界胁迫.%This paper is engaged in the study of the effects of Cd(II) on the physico-biochemical behaviors of Arthrobacter sp. through tox-icity testing. The toxicity test has been arranged by putting the an-tioxidant system of Arthrobacter sp. and Bacillus sp. under the exposure to different concentrations of Cd(II) for different lengths of testing time. The results of our testing show that Cd(II) has a strong impact on the antioxidant system of Arthrobacter sp. and Bacillus sp. . However, it is possible to reduce GSH content and increase TBARS content of Arthrobacter sp. significantly by letting Cd(II) treated with 20 mg/kg. Our testing proves that it is possible to reduce the GSH content and CAT activity of Bacillus sp. significantly by treating Cd(II) with 0.2 mg/kg, for the Arthrobacter sp. , the soluble protein and soluble sugar content can be reduced through prolonging the time of exposure. On the contrary, it is also possible to increase the GSH content and the CAT & SOD activity by means of prolonging the exposure, with the TBARS content

  5. Degradation of Swainsonine by the NADP-Dependent Alcohol Dehydrogenase A1R6C3 in Arthrobacter sp. HW08

    Directory of Open Access Journals (Sweden)

    Yan Wang

    2016-05-01

    Full Text Available Swainsonine is an indolizidine alkaloid that has been found in locoweeds and some fungi. Our previous study demonstrated that Arthrobacter sp. HW08 or its crude enzyme extract could degrade swainsonie efficiently. However, the mechanism of swainsonine degradation in bacteria remains unclear. In this study, we used label-free quantitative proteomics method based on liquid chromatography-electrospray ionization-tandem mass spectrometry to dissect the mechanism of swainsonine biodegradation by Arthrobacter sp. HW08. The results showed that 129 differentially expressed proteins were relevant to swainsonine degradation. These differentially expressed proteins were mostly related to the biological process of metabolism and the molecular function of catalytic activity. Among the 129 differentially expressed proteins, putative sugar phosphate isomerase/epimerase A1R5X7, Acetyl-CoA acetyltransferase A0JZ95, and nicotinamide adenine dinucleotide phosphate (NADP-dependent alcohol dehydrogenase A1R6C3 were found to contribute to the swainsonine degradation. Notably, NADP-dependent alcohol dehyrodgenase A1R6C3 appeared to play a major role in degrading swainsonine, but not as much as Arthrobacter sp. HW08 did. Collectively, our findings here provide insights to understand the mechanism of swainsonine degradation in bacteria.

  6. Degradation of Swainsonine by the NADP-Dependent Alcohol Dehydrogenase A1R6C3 in Arthrobacter sp. HW08

    Science.gov (United States)

    Wang, Yan; Zhai, A’guan; Zhang, Yanqi; Qiu, Kai; Wang, Jianhua; Li, Qinfan

    2016-01-01

    Swainsonine is an indolizidine alkaloid that has been found in locoweeds and some fungi. Our previous study demonstrated that Arthrobacter sp. HW08 or its crude enzyme extract could degrade swainsonie efficiently. However, the mechanism of swainsonine degradation in bacteria remains unclear. In this study, we used label-free quantitative proteomics method based on liquid chromatography-electrospray ionization-tandem mass spectrometry to dissect the mechanism of swainsonine biodegradation by Arthrobacter sp. HW08. The results showed that 129 differentially expressed proteins were relevant to swainsonine degradation. These differentially expressed proteins were mostly related to the biological process of metabolism and the molecular function of catalytic activity. Among the 129 differentially expressed proteins, putative sugar phosphate isomerase/epimerase A1R5X7, Acetyl-CoA acetyltransferase A0JZ95, and nicotinamide adenine dinucleotide phosphate (NADP)-dependent alcohol dehydrogenase A1R6C3 were found to contribute to the swainsonine degradation. Notably, NADP-dependent alcohol dehyrodgenase A1R6C3 appeared to play a major role in degrading swainsonine, but not as much as Arthrobacter sp. HW08 did. Collectively, our findings here provide insights to understand the mechanism of swainsonine degradation in bacteria. PMID:27196926

  7. Production of Xylanase from Arthrobacter sp. MTCC 6915 Using Saw Dust As Substrate under Solid State Fermentation

    Directory of Open Access Journals (Sweden)

    Sevanan Murugan

    2011-01-01

    Full Text Available Saw dust was used as substrate for xylanase production from Arthrobacter sp. MTCC 6915. The study of period of incubation, temperature, pH, carbon, and nitrogen sources for xylanase production was optimized. Xylanase production was found to be optimum at an incubation period of 96 hrs (117.0 U/mL, temperature 30°C (105.0 U/mL, and pH 9.0 (102.9 U/mL. The results showed that the xylanase production was found to be higher in the presence of carboxymethylcellulose (176.4 U/mL and dextrose (126.0 U/mL. It was also observed that peptone (170.1 U/mL and beef extract (161.7 U/mL supported maximum xylanase production.The enzyme was characterized and found to be fairly active at pH 9 (764.4 U/mL and temperature 60°C (819 U/mL. Even in the present study, a major difference in the production temperature (30°C and optimal temperature (60°C of the enzyme activity was observed. However, the pH of the production media and the enzyme activity were found to be the same (pH 9.

  8. Synergistic effect using vermiculite as media with a bacterial biofilm of Arthrobacter sp. for biodegradation of di-(2-ethylhexyl) phthalate.

    Science.gov (United States)

    Wen, Zhi-Dan; Wu, Wei-Min; Ren, Nan-Qi; Gao, Da-Wen

    2016-03-01

    Vermiculite is one of matrix material used for constructed wetland (CW) for the treatment of municipal wastewater. Arthrobacter sp. strain C21 (CGMCC No. 7671), isolated from a constructed wetland receiving municipal wastewater, forms biofilm on the surface of vermiculite. Di-(2-ethylhexyl) phthalate (DEHP), a typical phthalate pollutant in environment, can be degraded by the biofilm of strain C21 formed on vermiculite. Results of laboratory studies indicated that DEHP was removed from aqueous phase via biodegradation, adsorption by vermiculite, and adsorption by biofilm biomass. Synergistic effect of these three reactions enhanced the overall DEHP removal efficiency. During a batch incubation test with vermiculite and the cell suspension, bacterial adhesion to the media surface occurred within 5h and the phthalate esters (PEs) removal was due to both biodegradation and vermiculite adsorption. As the biofilm developed on surface of vermiculite (5-36 h), biodegradation became the predominance for PEs removal. As mature biofilm was formed (36-54 h), the adsorption of PEs by biofilm biomass became a main driving force for the removal of PEs from aqueous phase. The content of extracellular polymers (EPS) of the biofilm and DEHP removal performance showed a significant positive correlation (rp>0.86). PMID:26547620

  9. AcEST: BP912230 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_F06 448 Adiantum capillus-veneris mRNA. clone: YMU001_000016_F06. BP912230 - Show ... s mus... 52 9e-07 sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine ... oxidase OS=Arthrobacte... 50 3e-06 sp|Q6FS20|ALO_C ...

  10. Proizvodnja β-fruktofuranozidaze s pomoću bakterije Arthrobacter sp. i primjena tog enzima u pretvorbi steviozida i rebaudiozida A

    OpenAIRE

    Xu, Zhong-Wei; Li, Yu-Qiang; Wang, Yong-Hua; Yang, Bo; Ning, Zheng-Xiang

    2009-01-01

    U proizvodnji enzima β-fruktofuranozidaze upotrijebljen je soj bakterije Arthrobacter sp. 10137. Kao najbolji izvori ugljika i dušika za proizvodnju enzima u pokusu na tresilici upotrijebljeni su saharoza i kukuruzni ekstrakt u omjeru 10:1. Maksimalna aktivnost β-fruktofuranozidaze od 26,69 U/mL postignuta je šaržnim uzgojem nakon 22,5 h. Sirovi enzim β-fruktofuranozidaza, dobiven ultrafiltracijom i frakcioniranjem s (NH4)2SO4, pročišćen je 7 puta, što je potvrđeno usporedbom specifične aktiv...

  11. Isolation and characterization of atrazine-degrading Arthrobacter sp. AD26 and use of this strain in bioremediation of contaminated soil

    Institute of Scientific and Technical Information of China (English)

    LI Qingyan; LI Ying; ZHU Xikun; CAI Baoli

    2008-01-01

    A bacterial strain (AD26) capable of utilizing atrazine as a sole nitrogen source for growth was isolated from an industrial wastewatersample by enrichment culture. The 16S rRNA gene sequencing identified AD26 as anArthrobacter sp. PCR assays indicated that AD26contained atrazine-degrading genes trzN and atzBC. The trzN gene of AD26 only differs from the trzN ofArthrobacter aurescens TC1by one base (A→T at 907) and one amino acid (Met→Leu at 303). The specific activity of trzN of AD26 in crude cell extract was0.28 U/mg, which was 1.2 times that of TC 1. This strain has shown faster growth and atrazine-degradation rates in atrazine-containingminimal media than two well characterized atrazine-degrading bacteria, Pseudomonas sp. ADP and Arthrobacter aurescens TC 1. Afterincubating for 48 h at 30℃, the OD600 of AD26 reached 2.6 compared with 1.33 of ADP. AD26 was capable of degrading 500 mg/Lof atrazine in minimal medium at 95% in 72 h, while the degradative rates by TC1 and ADP were only 90% and 86%, respectively. Abioremediation trial of contaminated soil has indicated that AD26 can degrade as high as 98% of atrazine contained in soil (300 mg/kg)after incubating for 20 d at 26℃, nominating this strain as a good candidate for use in bioremediation programs.

  12. Evaluation of chromate reductase activity in the cell-free culture filtrate of Arthrobacter sp. SUK 1201 isolated from chromite mine overburden.

    Science.gov (United States)

    Dey, Satarupa; Paul, A K

    2016-08-01

    Arthrobacter sp. SUK 1201, a chromate resistant and reducing bacterium isolated from chromite mine overburden of Sukinda valley, Odisha, India has been evaluated for its hexavalent chromium [Cr(VI)] reduction potential using cell-free culture filtrate as extracellular chromate reductase enzyme. Production of the enzyme was enhanced in presence of Cr(VI) and its reducing efficiency was increased with increasing concentration of Cr(VI). The Michaelis-Menten constant (Km) and the maximum specific velocity (Vmax) of the extracellular Cr(VI) reductase were calculated to be 54.03 μM Cr(VI) and 5.803 U mg(-1) of protein respectively showing high affinity towards Cr(VI). The reducing activity of the enzyme was maximum at pH 6.5-7.5 and at a temperature of 35 °C and was dependent on NADH. The enzyme was tolerant to different metals such as Mn(II), Mg(II) and Fe(III) and was able to reduce Cr(VI) present in chromite mine seepage. These findings suggest that the extracellular chromate reductase of Arthrobacter sp. SUK 1201 has a great promise for use in Cr(VI) detoxification under different environmental conditions, particularly in the mining waste water treatment systems. PMID:27176938

  13. A new cold-adapted β-D-galactosidase from the Antarctic Arthrobacter sp. 32c – gene cloning, overexpression, purification and properties

    Directory of Open Access Journals (Sweden)

    Kur Józef

    2009-07-01

    Full Text Available Abstract Background The development of a new cold-active β-D-galactosidases and microorganisms that efficiently ferment lactose is of high biotechnological interest, particularly for lactose removal in milk and dairy products at low temperatures and for cheese whey bioremediation processes with simultaneous bio-ethanol production. Results In this article, we present a new β-D-galactosidase as a candidate to be applied in the above mentioned biotechnological processes. The gene encoding this β-D-galactosidase has been isolated from the genomic DNA library of Antarctic bacterium Arthrobacter sp. 32c, sequenced, cloned, expressed in Escherichia coli and Pichia pastoris, purified and characterized. 27 mg of β-D-galactosidase was purified from 1 L of culture with the use of an intracellular E. coli expression system. The protein was also produced extracellularly by P. pastoris in high amounts giving approximately 137 mg and 97 mg of purified enzyme from 1 L of P. pastoris culture for the AOX1 and a constitutive system, respectively. The enzyme was purified to electrophoretic homogeneity by using either one step- or a fast two step- procedure including protein precipitation and affinity chromatography. The enzyme was found to be active as a homotrimeric protein consisting of 695 amino acid residues in each monomer. Although, the maximum activity of the enzyme was determined at pH 6.5 and 50°C, 60% of the maximum activity of the enzyme was determined at 25°C and 15% of the maximum activity was detected at 0°C. Conclusion The properties of Arthrobacter sp. 32cβ-D-galactosidase suggest that this enzyme could be useful for low-cost, industrial conversion of lactose into galactose and glucose in milk products and could be an interesting alternative for the production of ethanol from lactose-based feedstock.

  14. Enhanced U(VI) release from autunite mineral by aerobic Arthrobacter sp. in the presence of aqueous bicarbonate

    Energy Technology Data Exchange (ETDEWEB)

    Katsenovich, Yelena; Carvajal, Denny A.; Wellman, Dawn M.; Lagos, Leonel

    2012-04-20

    The bacterial effect on U(VI) leaching from the autunite mineral (Ca[(UO{sub 2})(PO{sub 4})]{sub 2} {center_dot} 3H{sub 2}O) was investigated to provide a more comprehensive understanding into important microbiological processes affecting autunite stability within subsurface bicarbonate-bearing environments. Experiments were performed in a culture of G975 Arthrobacter oxydans strain, herein referred to as G975, a soil bacterium previously isolated from Hanford Site soil. 91 mg of autunite powder and 50 mL of phosphorus-limiting sterile media were amended with bicarbonate ranging between 1-10 mM in glass reactor bottles and inoculated with G975 strain after the dissolution of autunite was at steady state. SEM observations indicated G975 formed a biofilm on the autunite surface and penetrated the mineral cleavages. The mineral surface colonization by bacteria tended to increase concomitantly with bicarbonate concentrations. Additionally, a sterile cultureware with inserts was used in non-contact bioleaching experiments where autunite and bacteria cells were kept separately. The data suggest the G975 bacteria is able to enhance U(VI) leaching from autunite without the direct contact with the mineral. In the presence of bicarbonate, the damage to bacterial cells caused by U(VI) toxicity was reduced, yielding similar values for total organic carbon (TOC) degradation and cell density compared to U(VI)-free controls. The presence of active bacterial cells greatly enhanced the U(VI) bioleaching from autunite in bicarbonate-amended media.

  15. Complete Genome Sequencing of Protease-Producing Novel Arthrobacter sp. Strain IHBB 11108 Using PacBio Single-Molecule Real-Time Sequencing Technology

    OpenAIRE

    Kiran, Shashi; Swarnkar, Mohit K.; Pal, Mohinder; Thakur, Rishu; Tewari, Rupinder; Singh, Anil Kumar; Gulati, Arvind

    2015-01-01

    A previously uncharacterized species of the genus Arthrobacter, strain IHBB 11108 (MCC 2780), is a Gram-positive, strictly aerobic, nonmotile, cold-adapted, and protease-producing alkaliphilic actinobacterium, isolated from shallow undersurface water from Chandra Tal Lake, Lahaul-Spiti, India. The complete genome of the strain is 3.6 Mb in size with an average 58.97% G+C content.

  16. Influence of single-walled carbon nanotubes on the growth and phenol biodegradation characteristics of Arthrobacter sp.W1%单壁碳纳米管对Arthrobacter sp.W1生长及苯酚降解功能的影响

    Institute of Scientific and Technical Information of China (English)

    李端行; 王经伟; 沈文丽; 张照婧; 厉舒祯; 李会杰; 刘紫嫣; 马桥; 曲媛媛

    2015-01-01

    单壁碳纳米管(SWCNTs)对大肠杆菌等模式菌株的生长抑制作用明显,为了解SWCNTs对具有环境功能的菌株的作用,以苯酚降解菌Arthrobacter sp.Wl为对象,考察不同浓度SWCNTs下菌株W1的生长曲线和苯酚降解曲线,并通过扫描电镜观察、细胞凋亡检测、DNA泄漏量分析和活性氧产量分析考察作用机制.结果表明,特定浓度范围的SWCNTs (0.5-5.0 mg/L)会加快W1的苯酚降解速率,且1.5-2.0 mg/L SWCNTs不抑制Wl的生长.SWCNTs在溶液中形成团簇并吸附Wl细胞,且对Wl产生以物理穿刺为主的毒性作用,但在特定浓度范围的SWCNTS条件下,SWCNTs-菌株-苯酚体系增加了菌体与苯酚的接触机会,从而对Wl生长和苯酚降解产生明显的促进作用.本研究结果可为进一步揭示SWCNTs的环境微生物效应提供理论依据.

  17. Purification and properties of xylanase A from alkali-tolerant Bacillus sp. strain BP-23.

    OpenAIRE

    A. Blanco; Vidal, T; Colom, J F; Pastor, F I

    1995-01-01

    Xylanase A from the recently isolated Bacillus sp. strain BP-23 was purified to homogeneity. The enzyme shows a molecular mass of 32 kDa and an isoelectric point of 9.3. Optimum temperature and pH for xylanase activity were 50 degrees C and 5.5 respectively. Xylanase A was completely inhibited by N-bromosuccinimide. The main products of birchwood xylan hydrolysis were xylotetraose and xylobiose. The enzyme was shown to facilitate chemical bleaching of pulp, generating savings of 38% in terms ...

  18. Bioavailability of Ag(I) with Arthrobacter oxidas and Arthrobacter globiformis

    CERN Document Server

    Gelagutashvili, E; Ginturi, E; Bagdavadze, N; Kuchava, N; Tsakadze, K; Janjalia, M

    2012-01-01

    The biosorption of Ag(I)_ Arthrobacter species (Arthrobacter globiformis 151B and Arthrobacter oxidas 61B) was studied at simultaneous application of dialysis and atomic absorption analysis. The biosorption constants and nature of interaction for Ag(I) -Arthrobacter oxidas and Ag(I) -Arthrobacter globiformis were determined. The biosorption constants for Ag(I)- -Arthrobacter globiformis and for Ag(I) -Arthrobacter oxidas equal to 65.0 x10-4 and 35.0 x10-4 respectively.

  19. Cloning and sequencing of the trpE gene from Arthrobacter globiformis ATCC 8010 and several related subsurface Arthrobacter isolates

    Energy Technology Data Exchange (ETDEWEB)

    Chernova, T.; Viswanathan, V.K.; Austria, N.; Nichols, B.P.

    1998-09-01

    Tryptophan dependent mutants of Arthrobacter globiformis ATCC 8010 were isolated and trp genes were cloned by complementation and marker rescue of the auxotrophic strains. Rescue studies and preliminary sequence analysis reveal that at least the genes trpE, trpC, and trpB are clustered together in this organism. In addition, sequence analysis of the entire trpE gene, which encodes component I of anthranilate synthase, is described. Segments of the trpE gene from 17 subsurface isolates of Arthrobacter sp. were amplified by PCR and sequenced. The partial trpE sequences from the various strains were aligned and subjected to phylogenetic analysis. The data suggest that in addition to single base changes, recombination and genetic exchange play a major role in the evolution of the Arthrobacter genome.

  20. Degradation of the Phosphonate Herbicide Glyphosate by Arthrobacter atrocyaneus ATCC 13752

    OpenAIRE

    Pipke, Rüdiger; Amrhein, Nikolaus

    1988-01-01

    Of nine authentic Arthrobacter strains tested, only A. atrocyaneus ATCC 13752 was capable of using the herbicide glyphosate [N-(phosphonomethyl)glycine] as its sole source of phosphorus. Contrary to the previously isolated Arthrobacter sp. strain GLP-1, which degrades glyphosate via sarcosine, A. atrocyaneus metabolized glyphosate to aminomethylphosphonic acid. The carbon of aminomethylphosphonic acid was entirely converted to CO2. This is the first report on glyphosate degradation by a bacte...

  1. Preliminary separation and qualitative analysis of carotenoids in Arthrobacter sp.%一株节杆菌发酵产物中类胡萝卜素的分离及组分分析的初探

    Institute of Scientific and Technical Information of China (English)

    翟玉贵; 张伟国; 钱和

    2014-01-01

    [目的]对实验室保存的一株红色球菌进行菌株鉴定,并对色素提取液的组分进行定性分析.[方法]采取形态学观察、16S rDNA序列同源性分析和生理生化分析相结合的方法确定菌株的分类地位.使用乙醇-丙酮混合液提取胞内色素,采用硅胶G薄板层析法对色素提取液进行初步分离纯化,并结合其光谱吸收特性、质谱结果进行定性分析.[结果]实验结果表明此菌株属于节杆菌属(Arthrobacter sp.).薄板层析结果显示该菌株内主要有4种色素组分,且靠近溶剂前沿组分为黄色,其它组分皆为橘红色.吸收光谱特性、质谱结果显示黄色组分可能为β-胡萝卜素,橘红色组分可能为螺菌黄质系类胡萝卜素.[结论]此株节杆菌以较为廉价的糖蜜和玉米浆作为营养物质用于满足自身生长需要,并且积累胞内类胡萝卜素,因此该菌的进一步研究有一定的价值.

  2. Genome sequence of the fish pathogen Renibacterium salmoninarum suggests reductive evolution away from an environmental Arthrobacter ancestor.

    Science.gov (United States)

    Wiens, Gregory D; Rockey, Daniel D; Wu, Zaining; Chang, Jean; Levy, Ruth; Crane, Samuel; Chen, Donald S; Capri, Gina R; Burnett, Jeffrey R; Sudheesh, Ponnerassery S; Schipma, Matthew J; Burd, Henry; Bhattacharyya, Anamitra; Rhodes, Linda D; Kaul, Rajinder; Strom, Mark S

    2008-11-01

    Renibacterium salmoninarum is the causative agent of bacterial kidney disease and a significant threat to healthy and sustainable production of salmonid fish worldwide. This pathogen is difficult to culture in vitro, genetic manipulation is challenging, and current therapies and preventative strategies are only marginally effective in preventing disease. The complete genome of R. salmoninarum ATCC 33209 was sequenced and shown to be a 3,155,250-bp circular chromosome that is predicted to contain 3,507 open-reading frames (ORFs). A total of 80 copies of three different insertion sequence elements are interspersed throughout the genome. Approximately 21% of the predicted ORFs have been inactivated via frameshifts, point mutations, insertion sequences, and putative deletions. The R. salmoninarum genome has extended regions of synteny to the Arthrobacter sp. strain FB24 and Arthrobacter aurescens TC1 genomes, but it is approximately 1.9 Mb smaller than both Arthrobacter genomes and has a lower G+C content, suggesting that significant genome reduction has occurred since divergence from the last common ancestor. A limited set of putative virulence factors appear to have been acquired via horizontal transmission after divergence of the species; these factors include capsular polysaccharides, heme sequestration molecules, and the major secreted cell surface antigen p57 (also known as major soluble antigen). Examination of the genome revealed a number of ORFs homologous to antibiotic resistance genes, including genes encoding beta-lactamases, efflux proteins, macrolide glycosyltransferases, and rRNA methyltransferases. The genome sequence provides new insights into R. salmoninarum evolution and may facilitate identification of chemotherapeutic targets and vaccine candidates that can be used for prevention and treatment of infections in cultured salmonids. PMID:18723615

  3. Genome Sequence of the Fish Pathogen Renibacterium salmoninarum Suggests Reductive Evolution away from an Environmental Arthrobacter Ancestor▿ †

    Science.gov (United States)

    Wiens, Gregory D.; Rockey, Daniel D.; Wu, Zaining; Chang, Jean; Levy, Ruth; Crane, Samuel; Chen, Donald S.; Capri, Gina R.; Burnett, Jeffrey R.; Sudheesh, Ponnerassery S.; Schipma, Matthew J.; Burd, Henry; Bhattacharyya, Anamitra; Rhodes, Linda D.; Kaul, Rajinder; Strom, Mark S.

    2008-01-01

    Renibacterium salmoninarum is the causative agent of bacterial kidney disease and a significant threat to healthy and sustainable production of salmonid fish worldwide. This pathogen is difficult to culture in vitro, genetic manipulation is challenging, and current therapies and preventative strategies are only marginally effective in preventing disease. The complete genome of R. salmoninarum ATCC 33209 was sequenced and shown to be a 3,155,250-bp circular chromosome that is predicted to contain 3,507 open-reading frames (ORFs). A total of 80 copies of three different insertion sequence elements are interspersed throughout the genome. Approximately 21% of the predicted ORFs have been inactivated via frameshifts, point mutations, insertion sequences, and putative deletions. The R. salmoninarum genome has extended regions of synteny to the Arthrobacter sp. strain FB24 and Arthrobacter aurescens TC1 genomes, but it is approximately 1.9 Mb smaller than both Arthrobacter genomes and has a lower G+C content, suggesting that significant genome reduction has occurred since divergence from the last common ancestor. A limited set of putative virulence factors appear to have been acquired via horizontal transmission after divergence of the species; these factors include capsular polysaccharides, heme sequestration molecules, and the major secreted cell surface antigen p57 (also known as major soluble antigen). Examination of the genome revealed a number of ORFs homologous to antibiotic resistance genes, including genes encoding β-lactamases, efflux proteins, macrolide glycosyltransferases, and rRNA methyltransferases. The genome sequence provides new insights into R. salmoninarum evolution and may facilitate identification of chemotherapeutic targets and vaccine candidates that can be used for prevention and treatment of infections in cultured salmonids. PMID:18723615

  4. Intracellular inclusions of a n-alkane-grown Arthrobacter

    International Nuclear Information System (INIS)

    The ultrastructural changes associated with the growth of a marine Arthrobacter sp. on n-hexadecane were demonstrated by transmission electron microscopy. Multiple electron translucent areas (ETI), similar to inclusions described by other investigators, were found in hydrocarbon-grown cells but not in peptone-grown cells. Stereological planimetry demonstrated that the ETI occupy as much as 40% of the hydrocarbon-grown cell's volume. Electron dense structures (EDI) were observed in hexadecane and in peptone-grown cells. Gas chromatographic analysis indicated traces of n-hexadecane associated with the hydrocarbon-grown cells: however, the hydrocarbon levels were not high enough to suggest the presence of hydrocarbon inclusions in the cells. Solvent partition studies with disrupted 14C-n-hexadecane-grown cells suggested that the intracellular radioactivity was associated with polar compounds. Acrylate-inhibited, hydrocarbon-grown Arthrobacter sp. did not form ETI, suggesting that the formation of ETI involves the participation of Coenzyme A. Thin-layer and gas chromatography indicated that the major intracellular components were glycerides, with one or more R groups composed of palmitic acid and free palmitic acid. 27 references, 5 figures, 2 tables

  5. South West Pacific climate at c. 6600-6000 BP inferred from giant clam Tridacna maxima and massive coral Porites sp. records

    Science.gov (United States)

    Duprey, N.; Pujol, N.; Lazareth, C. E.; Cabioch, G.; Correge, T.; Le Cornec, F.; Maes, C.; Galipaud, J.; Caquineau, S.; Madeng-Yogo, M.

    2011-12-01

    In the last three decades, the El Niño Southern Oscillation (ENSO) has been characterized by more frequent and stronger El Niño events. Recent paleo-climate studies demonstrated that ENSO periodicity was lower during the Mid-Holocene and that it increased towards present-day. While a better knowledge on such past changes is necessary to reliably predict future climate, the origin of the Mid-Holocene ENSO regime shift remains controversial. The present study is focused on the climate in the Southwest Pacific c. 6 600-6 000 BP. This period precedes the Mid-Holocene ENSO-shift, and is essential to understand the ENSO evolution. The Vanuatu archipelago (South West Pacific; 15° 40'S; 167°00' E) is characteristic of an open ocean context and climatic conditions are strongly linked to the ENSO variability in relation with the position of the South Pacific Convergence Zone (SPCZ). The Sea Surface Salinity (SSS) and Sea Surface Temperature (SST) are highly correlated to the Southern Oscillation Index (SOI) and the Niño 3.4 index. Consequently, high-resolution SSS and SST records from massive corals and giant clams provide reliable tools to track ENSO variability back in time in this region. Two massive Porites sp. coral colonies, dated at 6758 - 6544 14C cal. BP, and one giant Tridacna maxima clam dated at 6257-6056 14C cal. BP, were collected on Espiritu Santo Island. These archives were sampled at monthly resolution and analyzed for Sr/Ca ratio and δ18O. SST was reconstructed from corals Sr/Ca and the giant clam δ18O. The δ18O composition of seawater (δw), calculated from the coral δ18O record, was used as a proxy for evaporation/precipitation (E/P) budget. Compared to present-day conditions, reconstructed SST are 2.5°C lower at ~6600 BP and 1°C lower at ~6100 BP, and both archives present a slightly higher (+0.5°C) seasonal amplitude. Fossil Porites sp. from Vanuatu showed that the E/P budget was positively correlated to the SST c. 6600BP whereas the inverse

  6. Draft Genome Sequence of Arthrobacter enclensis NCIM 5488T for Secondary Metabolism

    Science.gov (United States)

    Neurgaonkar, Priya S.; Dharne, Mahesh S.

    2016-01-01

    Here, we report the draft genome sequence of Arthrobacter enclensis NCIM 5488T, an actinobacterium isolated from a marine sediment sample from Chorao Island, Goa, India. This draft genome sequence consists of 4,226,231 bp with a G+C content of 67.08%, 3,888 protein-coding genes, 50 tRNAs, and 10 rRNAs. Analysis of the genome using bioinformatics tools such as antiSMASH and NaPDoS showed the presence of many unique natural product biosynthetic gene clusters. PMID:27257206

  7. Effect of NaCl and Na2SO4 on the biodecolourization of K-2BP by Halomonas sp. GYW

    Science.gov (United States)

    Lian, Jing; Xu, Zhifang; Guo, Jianbo; Yue, Lin; Guo, Yankai; Zhang, Chenxiao; Yang, Jingliang

    2014-01-01

    In this paper, the effect of NaCl and Na2SO4 on the biodecolourization of reactive brilliant red K-2BP by a Halomonas sp. GYW (EF188281) was investigated in details. The decolourisation efficiency and the oxidation–reduction potential (ORP) change were explored during the decolourization process. The results from sequencing batch tests showed that Na2SO4 influenced the decolourization efficiency more slightly than NaCl in different synthetic dye solutions with different mixtures of Na2SO4 and NaCl. In the dye solutions with the same salt concentration or the same Na+ concentration, high Na2SO4 concentration did not inhibit the decolourization process and even stimulated the decolourization efficiency of reactive brilliant red K-2BP. Compared to NaCl system, the addition of Na2SO4 increased the ORP values about 35 mV, which agreed with the theoretic analysis of Gibbs function. This study improved our knowledge of azo dye decolourization under high salinity conditions and provided efficient option for the treatment of azo dye wastewater.

  8. Isolation and characterization of an acrylamide-degrading yeast Rhodotorula sp. strain MBH23 KCTC 11960BP.

    Science.gov (United States)

    Rahim, M B H; Syed, M A; Shukor, M Y

    2012-10-01

    As well as for chemical and environmental reasons, acrylamide is widely used in many industrial applications. Due to its carcinogenicity and toxicity, its discharge into the environment causes adverse effects on humans and ecology alike. In this study, a novel acrylamide-degrading yeast has been isolated. The isolate was identified as Rhodotorula sp. strain MBH23 using ITS rRNA analysis. The results showed that the best carbon source for growth was glucose at 1.0% (w/v). The optimum acrylamide concentration, being a nitrogen source for cellular growth, was at 500 mg l(-1). The highest tolerable concentration of acrylamide was 1500 mg l(-1) whereas growth was completely inhibited at 2000 mg l(-1). At 500 mg l(-1), the strain MBH completely degraded acrylamide on day 5. Acrylic acid as a metabolite was detected in the media. Strain MBH23 grew well between pH 6.0 and 8.0 and between 27 and 30 °C. Amides such as 2-chloroacetamide, methacrylamide, nicotinamide, acrylamide, acetamide, and propionamide supported growth. Toxic heavy metals such as mercury, chromium, and cadmium inhibited growth on acrylamide. PMID:22144174

  9. Biodegradation of α-, β-, and γ-hexachlorocyclohexane by Arthrobacter fluorescens and Arthrobacter giacomelloi.

    Science.gov (United States)

    De Paolis, M R; Lippi, D; Guerriero, E; Polcaro, C M; Donati, E

    2013-06-01

    The organochlorine pesticide γ-hexachlorocyclohexane (γ-HCH, lindane) and its non-insecticidal isomers α-, β-, and δ- continue to pose serious environmental and health concerns, although their use has been restricted or completely banned for decades. The present study reports the first results on the ability of two Arthrobacter strains, not directly isolated from a HCH-polluted site, to grow in a mineral salt medium containing α-, β-, or γ-HCH (100 mgl(-1)) as sole source of carbon. Growth of cultures and HCHs degradation by Arthrobacter fluorescens and Arthrobacter giacomelloi were investigated after 1, 2, 3, 4, and 7 days of incubation by enumerating colony forming units and GC with ECD detection, respectively. Both bacteria are able to metabolize the HCHs: A. giacomelloi is the most effective one, as after 72 h of incubation it produces 88 % degradation of α-, 60 % of β-, and 56 % of γ-HCH. The formation of possible persistent compounds was studied by GC/MS and by HPLC analysis. Pentachlorocyclohexenes and tetrachlorocyclohexenes have been detected as metabolites, which are almost completely eliminated after 72 h of incubation, while no phenolic compounds were found. PMID:23553101

  10. Arthrobacter enclensis sp. nov., isolated from sediment sample

    Digital Repository Service at National Institute of Oceanography (India)

    Dastager, S.G.; Qin, L.; Tang, S.K.; Krishnamurthi, S.; Lee, J.C.; Li, W.J.

    A novel bacterial strain designated as NIO-1008(T) was isolated from marine sediments sample in Chorao Island India. Cells of the strains were gram positive and non-motile, displayed a rod-coccus life cycle and formed cream to light grey colonies...

  11. Genetic differentiation of Arthrobacter population from heavy metal-contaminated environment

    Institute of Scientific and Technical Information of China (English)

    ZHANG Hanbo; REN Weimin; SHAO Qiyong; DUAN Changqun

    2007-01-01

    Six samples containing extremely high concentration of Pb,Zn,and Cd were obtained from the layers of 5-10 cm and 25-30 cm three tailing piles,with ages of about 10,20 and more than 80 years,respectively.Then,48 bacterial strains were obtained from these samples,and subsequently their phylogenetic positions were determined by analysis on the partial sequence of 16S rRNA gene (fragment length ranging from 474 to 708 bp).These isolates were members of the Arthrobacter genus,phylogenetically close to A.keyseri and A.ureafaciens,with sequence ranging from 99.1%to 100%.Furthermore,genetic variation between subpopulations from different samples was revealed by analysis on their randomly amplified polymorphic DNA profile.Nei genetic distance showed that the greatest differentiation occurred between subpopulation A and C.Notably,either genetic distance between subpopulations from the layers of 5-10 cm and 25-30 cm of each tailing pile or between same layers of different tailing pile increased with the history of tailings.Moreover,correlation analysis showed that soluble Pb has a significantly negative relationship with Nei'gene diversity of subpopulation.It was assumed that soluble Pb may be responsible for the reduced genetic diversity of the Arthrobacter population.Our data provided evidence that genetic differentiation of microbial populations was consistent with the changes of environmental factors,particularly heavy metals.

  12. Heavy metal resistance in Arthrobacter ramosus strain G2 isolated from mercuric salt-contaminated soil

    International Nuclear Information System (INIS)

    Present study describes isolation of a multiple metal-resistant Arthrobacter ramosus strain from mercuric salt-contaminated soil. The isolate was found to resist and bioaccumulate several metals, such as cadmium, cobalt, zinc, chromium and mercury. Maximum tolerated concentrations for above metals were found to be 37, 525, 348, 1530 and 369 μM, respectively. The isolate could also reduce and detoxify redox-active metals like chromium and mercury, indicating that it has great potential in bioremediation of heavy metal-contaminated sites. Chromate reductase and mercuric reductase (MerA) activities in protein extract of the culture were found to be 2.3 and 0.17 units mg-1 protein, respectively. MerA enzyme was isolated from the culture by (NH4)2SO4 precipitation followed by dye affinity chromatography and its identity was confirmed by nano-LC-MS/MS. Its monomeric molecular weight, and optimum pH and temperature were 57 kDa, 7.4 and 55 deg. C, respectively. Thus, the enzyme was mildly thermophilic as compared to other MerA enzymes. Km and Vmax of the enzyme were 16.9 μM HgCl2 and 6.2 μmol min-1 mg-1 enzyme, respectively. The enzyme was found to be NADPH-specific. To our knowledge this is the first report on characterization of MerA enzyme from an Arthrobacter sp.

  13. Biosorption of Cr(VI)_ and Cr(III)_Arthrobacter species

    OpenAIRE

    Gelagutashvili, E.; Pataraia, E. Ginturi D.; Gurielidze, M.

    2011-01-01

    The biosorption of Cr(VI)_ and Cr(III)_ Arthrobacter species (Arthrobacter globiformis and Arthrobacter oxidas) was studied simultaneous application dialysis and atomic absorption analysis. Also biosorption of Cr(VI) in the presence of Zn(II) during growth of Arthrobacter species and Cr(III) in the presence of Mn(II) were discussed. Comparative Cr(VI)_ and Cr(III)_ Arthrobacter species shown, that Cr(III) was more effectively adsorbed by both bacterium than Cr(VI). The adsorption capacity is ...

  14. AcEST: BP916252 [AcEST

    Lifescience Database Archive (English)

    Full Text Available denine DNA glycosylase OS... 30 5.0 sp|P46881|PAOX_ARTGO Phenylethylamine oxid...sp|P46881|PAOX_ARTGO Phenylethylamine oxidase OS=Arthrobacter globiformis PE=1 SV=1 Length = 638 Score = 28.... Q9PLI5 Definition sp|Q9PLI5|Y114_CHLMU Uncharacterized protein TC_0114 OS=Chlamydia muridarum Align len...terized protein TC_0114 OS=Chlamydia muridarum GN=TC_0114 PE=4 SV=2 Length = 122 ...VGPKGWAVRPLKRHASWVQNVVRQFGPYPSRA 77 >tr|Q8CQV6|Q8CQV6_STAES Putative uncharacterized protein OS=Staphylococcus epidermid

  15. Beta-galactosidase from psychrotrophic microorganism (strain arthrobacter)

    Czech Academy of Sciences Publication Activity Database

    Hašek, Jindřich; Skálová, Tereza; Petroková, Hana; Vondráčková-Buchtelová, Eva; Dohnálek, Jan; Spiwok, V.; Lipovová, P.; Strnad, H.; Králová, B.

    2004-01-01

    Roč. 11, č. 1 (2004), s. 18-19. ISSN 1211-5894 R&D Projects: GA ČR GA204/02/0843 Institutional research plan: CEZ:AV0Z4050913 Keywords : .beta.-galactoside * cold active enzymes * Arthrobacter Subject RIV: EB - Genetics ; Molecular Biology

  16. Isolation of Arthrobacter species from the phyllosphere and demonstration of their epiphytic fitness

    OpenAIRE

    Scheublin, T.R.; Leveau, J.H.J.

    2013-01-01

    Bacteria of the genus Arthrobacter are common inhabitants of the soil environment, but can also be recovered from leaf surfaces (the phyllosphere). Using enrichment cultures on 4-chlorophenol, we succeeded in specifically isolating Arthrobacter bacteria from ground cover vegetation in an apple orchard. Based on 16S rRNA gene sequencing, the isolates were found to belong to at least three different species of Arthrobacter. Compared to the model bacterial epiphyte Pantoea agglomerans, the Arthr...

  17. Chromate reduction by Arthrobacter CR47 in biofilm packed bed reactors

    International Nuclear Information System (INIS)

    Bacterial strain Cr47 was isolated from a landfarming process soil sample. It was identified, by 16s rDNA sequencing, as Arthrobacter sp. The time course of the Cr(VI) reduction was monitored in batch operated packed bed biofilm reactors (12mL void volume) and in recirculating packed bed biofilm reactors (100 mL void volume) inoculated with bacterial strain Cr47. The reduction was evaluated with, 30 mg L-1 Cr(VI) laboratory solutions prepared with K2Cr2O7 and enriched with glucose-minimal medium, and with 30 mg L-1 Cr(VI) industrial model solutions prepared with chrome plating waste waters enriched with sucrose-minimal medium. Under batch mode the reduction reaction by the biofilm seemed to fit well an exponential-decay model with a first order kinetic parameter of 0.071 mg(L h)-1 Cr(VI). In the recirculating reactor, monitored after 4 weeks from inoculation and fed with laboratory solutions the removal rate was 0.79 mg(L h)-1. In the reactor fed with the industrial model solutions the maximum Cr(VI) removal rate attained was 0.49 mg(L h)-1. Artrobacter sp. packed bed biofilm reactors achieved Cr(VI) reduction rates comparable to other aerobic and anaerobic fixed film bioreactors previously reported

  18. Wide Distribution of Closely Related, Antibiotic-Producing Arthrobacter Strains throughout the Arctic Ocean

    DEFF Research Database (Denmark)

    Wietz, Matthias; Månsson, Maria; Bowman, Jeff S.;

    2012-01-01

    We isolated 16 antibiotic-producing bacterial strains throughout the central Arctic Ocean, including seven Arthrobacter spp. with almost identical 16S rRNA gene sequences. These strains were numerically rare, as revealed using 454 pyrosequencing libraries. Arthrobacter spp. produced arthrobacilin...

  19. Draft Genome Sequence of Arthrobacter chlorophenolicus Strain Mor30.16, Isolated from the Bean Rhizosphere

    OpenAIRE

    Miranda-Ríos, José Antonio; Ramírez-Trujillo, José Augusto; Nova-Franco, Bárbara; Lozano-Aguirre Beltrán, Luis Fernando; Iturriaga, Gabriel; Suárez-Rodríguez, Ramón

    2015-01-01

    Bacteria of the genus Arthrobacter are commonly found in the soil and plant rhizosphere. In this study we report the draft genome of Arthrobacter chlorophenolicus strain Mor30.16 that was isolated from rhizosphere of beans grown in Cuernavaca Morelos, Mexico. This strain promotes growth and ameliorates drought stress in bean plants.

  20. Ability of Cyanobacteria and Arthrobacter Species to Remove Gold Ions from Solution

    CERN Document Server

    Gelagutashvili, E; Rcheulichvili, A; Tsakadze, K; Bagdavadze, N; Kuchava, N; Djandjalia, M

    2012-01-01

    The biosorption of Au(III) - Spirulina platensis and Au(III) - Arthrobacter species (Arthrobacter globiformis and Arthrobacter oxidas) were studied at simultaneous application of dialysis and atomic absorption analysis. Also biosorption of Au(III) - Spirulina platensis at various pH were discussed. Biosorption constants for Au-cyanobacteris Spirulina platensis at different pH, and for Arthrobacter oxidas and Arthrobacter globiformis at pH=7.1 are : 1. K=3.91 x 10-4 (Au- Arthrobacter oxidas 61B, pH=7.1) 2. K=14.17 x 10-4 . (Au- Arthrobacter globiformis 151B, pH=7.1). 3. K=2.07x10-4 (Au- Spirulina platensis, pH=7.1) 4. K= 4.87x10-4 (Au- Spirulina platensis, pH=6.2) 5. K=8.7x10-4 (Au- Spirulina platensis, pH=8.4)

  1. Biosorption of Cr(VI)_ and Cr(III)_Arthrobacter species

    CERN Document Server

    Gelagutashvili, E; Gurielidze, M

    2011-01-01

    The biosorption of Cr(VI)_ and Cr(III)_ Arthrobacter species (Arthrobacter globiformis and Arthrobacter oxidas) was studied simultaneous application dialysis and atomic absorption analysis. Also biosorption of Cr(VI) in the presence of Zn(II) during growth of Arthrobacter species and Cr(III) in the presence of Mn(II) were discussed. Comparative Cr(VI)_ and Cr(III)_ Arthrobacter species shown, that Cr(III) was more effectively adsorbed by both bacterium than Cr(VI). The adsorption capacity is the same for both the Chromium-Arthrobacter systems. The biosorption constants for Cr(III) is higher than for Cr(VI) 5.7-5.9- fold for both species. Comparative Freundlich biosorption characteristics Cr(VI) Arthrobacter species of living and dry cells shown, that capacity(n) is in both cases the same(1.25,1.35). Dry cells have larger biosorption constant for both species, than living cells. Biosorption characteristics (K) and (n) for A. oxidas are without Mn(II) and in the presence of Mn(II) 2.6 x 10-4 (K), 1.37 (n) and 2...

  2. Characterization of an exo-inulinase from Arthrobacter: a novel NaCl-tolerant exo-inulinase with high molecular mass.

    Science.gov (United States)

    Shen, Jidong; Zhang, Rui; Li, Junjun; Tang, Xianghua; Li, Ruixian; Wang, Min; Huang, Zunxi; Zhou, Junpei

    2015-01-01

    A glycoside hydrolase family 32 exo-inulinase gene was cloned from Arthrobacter sp. HJ7 isolated from saline soil located in Heijing town. The gene encodes an 892-residue polypeptide with a calculated mass of 95.1 kDa and a high total frequency of amino acid residues G, A, and V (30.0%). Escherichia coli BL21 (DE3) cells were used as hosts to express the exo-inulinase gene. The recombinant exo-inulinase (rInuAHJ7) showed an apparently maximal activity at pH 5.0-5.5 and 40-45°C. The addition of 1.0 and 10.0 mM Zn(2+) and Pb(2+) had little or no effect on the enzyme activity. rInuAHJ7 exhibited good salt tolerance, retaining more than 98% inulinase activity at a concentration of 3.0%-20.0% (w/v) NaCl. Fructose was the main product of inulin, levan, and Jerusalem artichoke tubers hydrolyzed by the enzyme. The present study is the first to report the identification and characterization of an Arthrobacter sp exo-inulinase showing a high molecular mass of 95.1 kDa and NaCl tolerance. These results suggest that the exo-inulinase might be an alternative material for potential applications in processing seafood and other foods with high saline contents, such as marine algae, pickles, and sauces. PMID:25695343

  3. AcEST: BP912817 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_C02 513 Adiantum capillus-veneris mRNA. clone: YMU001_000023_C02. BP912817 - Show ... t sp_hit_id Q06862 Definition sp|Q06862|ACCC_ANASP Biotin ... carboxylase OS=Anabaena sp. (strain PCC 7120) Alig ... cant alignments: (bits) Value sp|Q06862|ACCC_ANASP Biotin ... carboxylase OS=Anabaena sp. (strain ... 245 8e-65 ...

  4. Evaluation of 4-bromophenol biodegradation in mixed pollutants system by Arthrobacter chlorophenolicus A6 in an upflow packed bed reactor.

    Science.gov (United States)

    Sahoo, Naresh Kumar; Pakshirajan, Kannan; Ghosh, Pranab Kumar

    2014-09-01

    Bromophenol is listed as priority pollutant by U.S. EPA, however, there is no report so far on its removal in mixed pollutants system by any biological reactor operated in continuous mode. Furthermore, bromophenol along with chlorophenol and nitrophenol are usually the major constituents of paper pulp and pesticide industrial effluent. The present study investigated simultaneous biodegradation of these three pollutants with specially emphasis on substrate competition and crossed inhibition by Arthrobacter chlorophenolicus A6 in an upflow packed bed reactor (UPBR). A 2(3) full factorial design was employed with these pollutants at two different levels by varying their influent concentration in the range of 250-450 mg l(-1). Almost complete removal of all these pollutants and 97 % effluent toxicity removal were achieved in the UPBR at a pollutant loading rate of 1707 mg l(-1) day(-1) or lesser. However, at higher loading rates, the reactor performance deteriorated due to transient accumulation of toxic intermediates. Statistical analysis of the results revealed a strong negative interaction of 4-CP on 4-NP biodegradation. On the other hand, interaction effect between 4-CP and 4-BP was found to be insignificant. Among these three pollutants 4-NP preferentially degraded, however, 4-CP exerted more inhibitory effect on 4-NP biodegradation. This study demonstrated the potential of A. chlorophenolicus A6 for biodegradation of 4-BP in mixed pollutants system by a flow through UPBR system. PMID:24934870

  5. AcEST: BP918182 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E03. BP918182 - Show BP91818...is mRNA. clone: YMU001_000110_E03. Accession BP918182 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918... protei... 140 4e-33 sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 139 6e-33 sp|P93011|PP18...RPTDARRVFDEMDVRDSVSYNT 278 Query: 314 IIXXXXXXXXXXXALQLFHEMQKKCVKPDEVTYITVLNACSH 18

  6. Erythema caused by a localised skin infection with Arthrobacter mysorens

    Directory of Open Access Journals (Sweden)

    Chakraborty Trinad

    2010-12-01

    Full Text Available Abstract Background Skin erythemas of unknown origin are a frequent reason for consulting the general practitioner or dermatologist. Case presentation Here we report a case of an erythema resembling the erythema migrans manifestation of Lyme disease, but with atypical symptoms like persistent pruritus. The patient had no history of a recent tick-bite but displayed a positive serology for an advanced stage of Lyme borreliosis, which stood in contrast to the clinical manifestation of erythema migrans as a symptom of early Lyme disease. Three skin swabs and soil samples, collected in the area where the patient possibly acquired the infection, were examined by bacterial and fungal culture methods. Microorganisms were identified by using 16 S rRNA gene sequencing and bioinformatics. The patient and soil isolates were compared by employing RAPD analysis. The serum samples of the patient were examined by immunoblotting. Arthrobacter mysorens, a soil bacterium, was isolated from the collected skin and soil samples. The identity of both isolates was determined by molecular fingerprinting methods. A. mysorens was proven to be causative for the erythema by direct isolation from the affected skin and a positive serology, thus explaining the atypical appearance of the erythema compared to erythema migrans caused by Borrelia infection. Conclusions Infections with A.mysorens might be underreported and microbiological diagnostic techniques should be applied in cases of patients with unclear erythemas, resembling erythema migrans, without a history of tick bites.

  7. Review of the taxonomy of the genus Arthrobacter, emendation of the genus Arthrobacter sensu lato, proposal to reclassify selected species of the genus Arthrobacter in the novel genera Glutamicibacter gen. nov., Paeniglutamicibacter gen. nov., Pseudoglutamicibacter gen. nov., Paenarthrobacter gen. nov. and Pseudarthrobacter gen. nov., and emended description of Arthrobacter roseus.

    Science.gov (United States)

    Busse, Hans-Jürgen

    2016-01-01

    In this paper, the taxonomy of the genus Arthrobacter is discussed, from its first description in 1947 to the present state. Emphasis is given to intrageneric phylogeny and chemotaxonomic characteristics, concentrating on quinone systems, peptidoglycan compositions and polar lipid profiles. Internal groups within the genus Arthrobacter indicated from homogeneous chemotaxonomic traits and corresponding to phylogenetic grouping and/or high 16S rRNA gene sequence similarities are highlighted. Furthermore, polar lipid profiles and quinone systems of selected species are shown, filling some gaps concerning these chemotaxonomic traits. Based on phylogenetic groupings, 16S rRNA gene sequence similarities and homogeneity in peptidoglycan types, quinone systems and polar lipid profiles, a description of the genus Arthrobacter sensu lato and an emended description of Arthrobacter roseus are provided. Furthermore, reclassifications of selected species of the genus Arthrobacter into novel genera are proposed, namely Glutamicibacter gen. nov. (nine species), Paeniglutamicibacter gen. nov. (six species), Pseudoglutamicibacter gen. nov. (two species), Paenarthrobacter gen. nov. (six species) and Pseudarthrobacter gen. nov. (ten species). PMID:26486726

  8. AcEST: BP917450 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_A06 314 Adiantum capillus-veneris mRNA. clone: YMU001_000101_A06. BP917450 CL1387C ... t sp_hit_id O14772 Definition sp|O14772|FPGT_HUMAN Fucose -1-phosphate guanylyltransferase OS=Homo sapiens Al ... cant alignments: (bits) Value sp|O14772|FPGT_HUMAN Fucose -1-phosphate guanylyltransferase OS=H... 31 2.2 sp| ...

  9. AcEST: BP913755 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_H06 435 Adiantum capillus-veneris mRNA. clone: YMU001_000033_H06. BP913755 - Show ... t sp_hit_id O15050 Definition sp|O15050|LBA1_HUMAN Lupus ... brain antigen 1 homolog OS=Homo sapiens Align leng ... cant alignments: (bits) Value sp|O15050|LBA1_HUMAN Lupus ... brain antigen 1 homolog OS=Homo sapie... 32 1.5 sp ...

  10. AcEST: BP913312 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_H04 435 Adiantum capillus-veneris mRNA. clone: YMU001_000028_H04. BP913312 CL2867C ... t sp_hit_id Q28661 Definition sp|Q28661|PROC_RABIT Vitamin ... K-dependent protein C (Fragment) OS=Oryctolagus cu ... cant alignments: (bits) Value sp|Q28661|PROC_RABIT Vitamin ... K-dependent protein C (Fragment) OS... 33 0.52 sp| ...

  11. AcEST: BP915120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000066_G01 415 Adiantum capillus-veneris mRNA. clone: YMU001_000066_G01. BP915120 - Show ... t sp_hit_id P44340 Definition sp|P44340|HIS5_HAEIN Imidazole ... glycerol phosphate synthase subunit hisH OS=Haemop ... cant alignments: (bits) Value sp|P44340|HIS5_HAEIN Imidazole ... glycerol phosphate synthase subun... 30 3.8 sp|Q4Q ...

  12. AcEST: BP920596 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_A07 495 Adiantum capillus-veneris mRNA. clone: YMU001_000139_A07. BP920596 CL2605C ... t sp_hit_id Q9SZ30 Definition sp|Q9SZ30|HIS5_ARATH Imidazole ... glycerol phosphate synthase hisHF, chloroplastic O ... cant alignments: (bits) Value sp|Q9SZ30|HIS5_ARATH Imidazole ... glycerol phosphate synthase hisHF... 274 2e-73 sp| ...

  13. AcEST: BP916819 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000092_A09 340 Adiantum capillus-veneris mRNA. clone: YMU001_000092_A09. BP916819 CL2605C ... t sp_hit_id Q9SZ30 Definition sp|Q9SZ30|HIS5_ARATH Imidazole ... glycerol phosphate synthase hisHF, chloroplastic O ... cant alignments: (bits) Value sp|Q9SZ30|HIS5_ARATH Imidazole ... glycerol phosphate synthase hisHF... 136 1e-41 sp| ...

  14. Application of NAA method to study chromium uptake by Arthrobacter oxydans

    International Nuclear Information System (INIS)

    To study chromium uptake by Arthrobacter oxydans (Cr(VI)-reducer bacteria isolated from Columbia basalt rocks, USA) instrumental neutron activation analysis method was applied. It was established that chromate accumulation is dose-dependent and it is more intensive in the interval of concentrations of Cr(VI) (10-50 mg/l). At low concentrations of Cr(VI) (up to 50 mg/l) the most intensive formation of Cr(V) was also found (using ESR method). Besides, it was estimated that reduction from Cr(VI) to Cr(V) is faster process than the uptake of Cr(VI). According to ENAA measurements Cr(III), in constant to Cr(VI), is not accumulated in Arthrobacter oxydans cells up to concentration of 200 mg/l. Using epithermal neutron activation analysis the background levels of 17 major, minor and trace elements were determined in Arthrobacter oxydans

  15. AcEST: BP915162 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_C04 522 Adiantum capillus-veneris mRNA. clone: YMU001_000067_C04. BP915162 - Show ... ession BP915162 Tissue type prothallium Developmental s tage - Contig ID - Sequence CAGACCAAAACCAGACTGAGCT ... Methanococcus thermoli... 65 3e-10 sp|Q9HN70|THSA_HALS A Thermosome subunit alpha OS=Halobacterium s... 65 ...

  16. Application of thermoalkalophilic xylanase from Arthrobacter sp. MTCC 5214 in biobleaching of kraft pulp

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, R.; Bhosle, N.B.

    released by enzyme treatment showed a characteristic peak at 280 nm indicating the presence of lignin in the released coloring matter. Enzymatic prebleaching of kraft pulp showed 20 % reduction in kappa number of the pulp without much change in viscosity...

  17. Purification and Characterization of Two Extracellular Alkaline Phosphatases from a Psychrophilic Arthrobacter Isolate

    OpenAIRE

    Prada, P; Brenchley, J E

    1997-01-01

    Two extracellular, heat-labile alkaline phosphatases were purified from a psychrophilic Arthrobacter isolate, D10. The enzymes were active over different pH ranges, used distinct substrates, and had different kinetic properties. Each enzyme reacted specifically to its own antibody during immunoblot analysis. One had both monophosphatase and diesterase activities.

  18. [Heterotrophic Nitrification and Aerobic Denitrification of the Hypothermia Aerobic Denitrification Bacterium: Arthrobacter arilaitensis].

    Science.gov (United States)

    He, Teng-xia; Ni, Jiu-pai; Li, Zhen-lun; Sun, Quan; Ye Qing; Xu, Yi

    2016-03-15

    High concentrations of ammonium, nitrate and nitrite nitrogen were employed to clarify the abilities of heterotrophic nitrification and aerobic denitrification of Arthrobacter arilaitensis strain Y-10. Meanwhile, by means of inoculating the strain suspension into the mixed ammonium and nitrate, ammonium and nitrite nitrogen simulated wastewater, we studied the simultaneous nitrification and denitrification ability of Arthrobacter arilaitensis strain Y-10. In addition, cell optical density was assayed in each nitrogen removal process to analyze the relationship of cell growth and nitrogen removal efficiency. The results showed that the hypothermia denitrification strain Arthrobacter arilaitensis Y-10 exhibited high nitrogen removal efficiency during heterotrophic nitrification and aerobic denitrification. The ammonium, nitrate and nitrite removal rates were 65.0%, 100% and 61.2% respectively when strain Y-10 was cultivated for 4 d at 15°C with initial ammonium, nitrate and nitrite nitrogen concentrations of 208.43 mg · L⁻¹, 201.16 mg · L⁻¹ and 194.33 mg · L⁻¹ and initial pH of 7.2. Nitrite nitrogen could only be accumulated in the medium containing nitrate nitrogen during heterotrophic nitrification and aerobic denitrification process. Additionally, the ammonium nitrogen was mainly removed in the inorganic nitrogen mixed synthetic wastewater. In short, Arthrobacter arilaitensis Y-10 could conduct nitrification and denitrification effectively under aerobic condition and the ammonium nitrogen removal rate was more than 80.0% in the inorganic nitrogen mixed synthetic wastewater. PMID:27337904

  19. AcEST: BP917190 [AcEST

    Lifescience Database Archive (English)

    Full Text Available lignments: (bits) Value sp|Q9JHC9|ELF2_MOUSE ETS-related transcription factor Elf-2 OS=M... 30 4.2 sp...YMU001_000097_D09 473 Adiantum capillus-veneris mRNA. clone: YMU001_000097_D09. BP9...17190 - Show BP917190 Clone id YMU001_000097_D09 Library YMU01 Length 473 Definition Adiantum capillus-veneris...|Q9JHC9|ELF2_MOUSE ETS-related transcription factor Elf-2 O...eic Acids Res. 25:3389-3402. Query= BP917190|Adiantum capillus-veneris mRNA, clon

  20. AcEST: BP913500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000030_H08 548 Adiantum capillus-veneris mRNA. clone: YMU001_000030_H08. BP913500 - Show ... 4e-06 sp|Q9NJA9|MYSP_ANISI Paramyosin OS=Anisakis simplex ... GN=PARA PE=1... 51 4e-06 sp|Q8MUF6|MYSP_BLOTA Para ...

  1. AcEST: BP917468 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_C01 405 Adiantum capillus-veneris mRNA. clone: YMU001_000101_C01. BP917468 CL1354C ... nitiation factor 3... 30 2.8 sp|Q70KF4|CMYA5_MOUSE Cardiomyopathy -associated protein 5 OS=Mus... 30 2.8 sp|P59583|WR ...

  2. AcEST: BP919526 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_B04 413 Adiantum capillus-veneris mRNA. clone: YMU001_000126_B04. BP919526 - Show ... pendent RNA helic... 33 0.58 sp|Q70KF4|CMYA5_MOUSE Cardiomyopathy -associated protein 5 OS=Mus... 33 0.58 sp|A8MU46|S ...

  3. AcEST: BP918619 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_E12 360 Adiantum capillus-veneris mRNA. clone: YMU001_000115_E12. BP918619 - Show ... 30 4.9 sp|O74473|CDC11_SCHPO Septation initiation network ... scaffold prot... 30 4.9 sp|Q8L7F9|B3GTF_ARATH Beta ...

  4. AcEST: BP916454 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_H03 484 Adiantum capillus-veneris mRNA. clone: YMU001_000087_H03. BP916454 CL4119C ... =Rattus norve... 29 9.8 sp|O00292|LFTY2_HUMAN Left-right ... determination factor 2 OS=Homo ... 29 9.8 sp|P2562 ...

  5. AcEST: BP917060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_D07 570 Adiantum capillus-veneris mRNA. clone: YMU001_000095_D07. BP917060 CL2496C ... 6.0 sp|Q3UJU9|RMD3_MOUSE Regulator of microtubule dynamics ... protein 3... 30 6.1 sp|P34535|YNC2_CAEEL LMBR1 dom ...

  6. AcEST: BP916490 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000088_C05 481 Adiantum capillus-veneris mRNA. clone: YMU001_000088_C05. BP916490 CL2710C ... ... 31 2.5 sp|Q08473|SQD_DROME RNA-binding protein squid ... OS=Drosophila mela... 31 3.3 sp|Q04047|NONA_DROME ...

  7. AcEST: BP920625 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_D10 474 Adiantum capillus-veneris mRNA. clone: YMU001_000139_D10. BP920625 - Show ... ... 30 7.1 sp|Q08473|SQD_DROME RNA-binding protein squid ... OS=Drosophila mela... 30 7.1 sp|P48676|PERI_XENLA ...

  8. AcEST: BP917032 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_A10 304 Adiantum capillus-veneris mRNA. clone: YMU001_000095_A10. BP917032 CL2443C ... bacillus brev... 29 8.4 sp|Q17990|LITE1_CAEEL High-energy ... light unresponsive protein 1 O... 29 8.4 >sp|Q9FYH ...

  9. AcEST: BP915586 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_D03 449 Adiantum capillus-veneris mRNA. clone: YMU001_000073_D03. BP915586 - Show ... Query: 285 NLFSKTSWSSRLLPLSPCKASNAASSSSIRVCSICFS*ACAE IS 416 ++ +WS ++P+SP ++ +SS+IR ++ S CAE ... S Sbjct: 28 ... 2 SMLRHNNWSLVIIPISPLRSE--TTSSNIRPITVSISPMCAE FS 323 >sp|Q9DC22|IQWD1_MOUSE Nuclear receptor inte ...

  10. AcEST: BP920341 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_A03 473 Adiantum capillus-veneris mRNA. clone: YMU001_000136_A03. BP920341 CL37Con ... h factor-like doma... 30 4.2 sp|Q8WXX7|AUTS2_HUMAN Autism ... susceptibility gene 2 protein OS=Ho... 30 4.2 sp|P ...

  11. AcEST: BP919292 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000123_D06 541 Adiantum capillus-veneris mRNA. clone: YMU001_000123_D06. BP919292 CL1357C ... en 3 OS=Epstein-Ba... 30 7.5 sp|Q8WXX7|AUTS2_HUMAN Autism ... susceptibility gene 2 protein OS=Ho... 30 7.5 sp|Q ...

  12. AcEST: BP916458 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_H07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000087_H07. BP916458 CL1357C ... C2orf71 OS=Homo sa... 30 7.6 sp|Q8WXX7|AUTS2_HUMAN Autism ... susceptibility gene 2 protein OS=Ho... 30 7.6 >sp| ...

  13. AcEST: BP913557 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000031_E11 489 Adiantum capillus-veneris mRNA. clone: YMU001_000031_E11. BP913557 - Show ... illus fumigatus (s... 30 4.5 sp|Q8WXX7|AUTS2_HUMAN Autism ... susceptibility gene 2 protein OS=Ho... 30 4.5 sp|P ...

  14. AcEST: BP918415 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C03 548 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C03. BP918415 CL1357C ... tor IF-2 OS=Soliba... 30 7.7 sp|Q8WXX7|AUTS2_HUMAN Autism ... susceptibility gene 2 protein OS=Ho... 30 7.7 >sp| ...

  15. AcEST: BP918623 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_F04 410 Adiantum capillus-veneris mRNA. clone: YMU001_000115_F04. BP918623 - Show ... sp|Q8JUX6|POLN_CHIKS Non-structural polyprotein OS=Chikungunya ... v... 29 6.5 sp|Q5K2K3|L_ISFV Large structural prot ...

  16. AcEST: BP918245 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_C01 499 Adiantum capillus-veneris mRNA. clone: YMU001_000111_C01. BP918245 CL2777C ... urase, endoplasmic... 30 6.1 sp|P48619|FAD3C_RICCO Omega-3 ... fatty acid desaturase, chloroplast... 30 6.1 sp|P2 ...

  17. AcEST: BP916977 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000094_C03 433 Adiantum capillus-veneris mRNA. clone: YMU001_000094_C03. BP916977 - Show ... t sp_hit_id P23597 Definition sp|P23597|PRTE_ERWCH Proteases ... secretion protein prtE OS=Erwinia chrysanthemi Ali ... cant alignments: (bits) Value sp|P23597|PRTE_ERWCH Proteases ... secretion protein prtE OS=Erwinia... 37 0.035 sp|Q ... winia tasmaniensis... 29 7.3 >sp|P23597|PRTE_ERWCH Proteases ... secretion protein prtE OS=Erwinia chrysanthemi GN= ...

  18. AcEST: BP914869 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_G06 553 Adiantum capillus-veneris mRNA. clone: YMU001_000063_G06. BP914869 - Show ... rase OS=Mortier... 142 1e-33 sp|P48623|FAD3E_ARATH Omega-3 ... fatty acid desaturase, endoplasmic... 131 3e-30 sp ... |P48624|FAD3E_BRANA Omega-3 ... fatty acid desaturase, endoplasmic... 130 4e-30 sp ... |P48626|FAD3E_TOBAC Omega-3 ... fatty acid desaturase, endoplasmic... 122 9e-28 sp ... |P32291|FAD3E_PHAAU Omega-3 ... fatty acid desaturase, endoplasmic... 120 4e-27 sp ...

  19. AcEST: BP917007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000094_F07 500 Adiantum capillus-veneris mRNA. clone: YMU001_000094_F07. BP917007 - Show ... .8 sp|Q66121|ORF1A_CMVIX Replication protein 1a OS=Cucumber ... mosaic ... 30 6.3 sp|Q83270|ORF1A_CMVII Replicatio ... n protein 1a OS=Cucumber ... mosaic ... 30 6.3 sp|Q552M6|ZDHC7_DICDI Putative Z ...

  20. AcEST: BP913057 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000026_A03 499 Adiantum capillus-veneris mRNA. clone: YMU001_000026_A03. BP913057 - Show ... : Swiss-Prot sp_hit_id O43521 Definition sp|O43521|BIM _HUMAN Bcl-2-like protein 11 OS=Homo sapiens Align ... ing significant alignments: (bits) Value sp|O43521|BIM _HUMAN Bcl-2-like protein 11 OS=Homo sapiens GN=BCL ...

  1. AcEST: BP914390 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_D04 481 Adiantum capillus-veneris mRNA. clone: YMU001_000058_D04. BP914390 - Show ... atase lux... 64 4e-10 sp|P0AEC4|ARCB_SHIFL Aerobic respiration ... control sensor protein ... 64 5e-10 sp|P0AEC3|ARCB ... _ECOLI Aerobic respiration ... control sensor protein ... 64 5e-10 sp|P58363|ARCB ...

  2. AcEST: BP916255 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000085_C02 324 Adiantum capillus-veneris mRNA. clone: YMU001_000085_C02. BP916255 CL1284C ... : Swiss-Prot sp_hit_id P22265 Definition sp|P22265|TSH _DROME Protein teashirt OS=Drosophila melanogaster ... ing significant alignments: (bits) Value sp|P22265|TSH _DROME Protein teashirt OS=Drosophila melanogaster ...

  3. AcEST: BP918383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_H03 522 Adiantum capillus-veneris mRNA. clone: YMU001_000112_H03. BP918383 - Show ... : Swiss-Prot sp_hit_id P16473 Definition sp|P16473|TSH R_HUMAN Thyrotropin receptor OS=Homo sapiens Align ... ing significant alignments: (bits) Value sp|P16473|TSH R_HUMAN Thyrotropin receptor OS=Homo sapiens GN=TSH ...

  4. AcEST: BP912563 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_D04 489 Adiantum capillus-veneris mRNA. clone: YMU001_000020_D04. BP912563 - Show ... 30 5.9 sp|P40899|ISP3_SCHPO Sexual differentiation process ... protein isp3... 30 7.6 >sp|Q9WV41|INSL6_RAT Insuli ... T 190 >sp|P40899|ISP3_SCHPO Sexual differentiation process ... protein isp3 OS=Schizosaccharomyces pombe GN=isp3 ...

  5. AcEST: BP915683 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000074_E11 545 Adiantum capillus-veneris mRNA. clone: YMU001_000074_E11. BP915683 - Show ... -86 OS=Caenorhabdi... 30 9.9 sp|Q6GQ81|SMCR7_XENLA Smith -Magenis syndrome chromosome region c... 30 9.9 sp| ... SIAAPEKRELEQFFKQQPRPSGE 391 >sp|Q6GQ81|SMCR7_XENLA Smith -Magenis syndrome chromosome region candidate gene ...

  6. AcEST: BP918482 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_A07 504 Adiantum capillus-veneris mRNA. clone: YMU001_000114_A07. BP918482 CL3633C ... : Swiss-Prot sp_hit_id Q08350 Definition sp|Q08350|CAD H7_PICAB Cinnamyl alcohol dehydrogenase 7/8 OS=Pice ... ing significant alignments: (bits) Value sp|Q08350|CAD H7_PICAB Cinnamyl alcohol dehydrogenase 7/8 OS=Pice ...

  7. AcEST: BP919659 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_F08 574 Adiantum capillus-veneris mRNA. clone: YMU001_000127_F08. BP919659 CL3633C ... : Swiss-Prot sp_hit_id Q08350 Definition sp|Q08350|CAD H7_PICAB Cinnamyl alcohol dehydrogenase 7/8 OS=Pice ... ing significant alignments: (bits) Value sp|Q08350|CAD H7_PICAB Cinnamyl alcohol dehydrogenase 7/8 OS=Pice ...

  8. AcEST: BP915785 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000076_G08 542 Adiantum capillus-veneris mRNA. clone: YMU001_000076_G08. BP915785 CL3695C ... tion sp|P46547|PIP_AERSO Proline iminopeptidase OS=Aeromonas ... sobria Align length 138 Score (bit) 113.0 E-value ... alue sp|P46547|PIP_AERSO Proline iminopeptidase OS=Aeromonas ... sobria G... 113 5e-25 sp|Q12L09|META_SHEDO Homoser ...

  9. AcEST: BP917456 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_B01 460 Adiantum capillus-veneris mRNA. clone: YMU001_000101_B01. BP917456 - Show ... sp|A4SJR0|GLMM_AERS4 Phosphoglucosamine mutase OS=Aeromonas ... salm... 29 8.5 sp|A0KNE8|GLMM_AERHH Phosphoglucosa ... mine mutase OS=Aeromonas ... hydr... 29 8.5 >sp|P26410|HYPB_RHOCA Hydrogenase n ...

  10. AcEST: BP912354 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_B04 386 Adiantum capillus-veneris mRNA. clone: YMU001_000018_B04. BP912354 CL820Co ... d Q76BK2 Definition sp|Q76BK2|MIF_XENLA Macrophage migration ... inhibitory factor OS=Xenopus laevis Align length 5 ... ments: (bits) Value sp|Q76BK2|MIF_XENLA Macrophage migration ... inhibitory factor OS=Xe... 41 0.002 sp|P91850|MIFH ...

  11. AcEST: BP919941 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_H09 463 Adiantum capillus-veneris mRNA. clone: YMU001_000130_H09. BP919941 CL396Co ... 5 Definition sp|P53865|CNM67_YEAST Chaotic nuclear migration ... protein 67 OS=Saccharomyces cerevisiae Align lengt ... (bits) Value sp|P53865|CNM67_YEAST Chaotic nuclear migration ... protein 67 OS=Sa... 31 2.7 >sp|P53865|CNM67_YEAST ...

  12. AcEST: BP914078 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_F02 462 Adiantum capillus-veneris mRNA. clone: YMU001_000039_F02. BP914078 - Show ... -binding protein ... 32 1.0 sp|P44779|FUCI_HAEIN L-fucose ... isomerase OS=Haemophilus influenza... 32 1.7 sp|A5 ... UAS8|FUCI_HAEIE L-fucose ... isomerase OS=Haemophilus influenza... 32 1.7 sp|O9 ...

  13. AcEST: BP921676 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000152_H01 542 Adiantum capillus-veneris mRNA. clone: YMU001_000152_H01. BP921676 - Show ... inition sp|Q05057|POLG_PYFV1 Genome polyprotein OS=Parsnip ... yellow fleck virus (isolate P-121) Align length 47 ... ) Value sp|Q05057|POLG_PYFV1 Genome polyprotein OS=Parsnip ... yellow fleck ... 30 7.6 >sp|Q05057|POLG_PYFV1 Geno ...

  14. AcEST: BP920732 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000140_G12 525 Adiantum capillus-veneris mRNA. clone: YMU001_000140_G12. BP920732 CL1275C ... ,5-trisphosphate receptor type... 31 4.1 sp|O93742|BACH _HALSD Halorhodopsin OS=Halorubrum sodomense GN=ho. ... -trisphosphate receptor type 3... 30 5.3 sp|P33742|BACH _HALSS Halorhodopsin OS=Halobacterium sp. (strain . ...

  15. AcEST: BP918428 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D05 431 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D05. BP918428 CL2013C ... =... 32 1.1 sp|Q46444|QHED_COMTE Quinohaemoprotein ethanol ... dehydrogenase typ... 31 1.9 sp|Q6Q4H1|PTDSR_HYDAT ... ADPAHK 181 >sp|Q46444|QHED_COMTE Quinohaemoprotein ethanol ... dehydrogenase type-1 OS=Comamonas testosteroni GN= ...

  16. AcEST: BP918569 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_A09 472 Adiantum capillus-veneris mRNA. clone: YMU001_000115_A09. BP918569 - Show ... t sp_hit_id Q9BM98 Definition sp|Q9BM98|JANA_DROMA Sex -regulated protein janus-A OS=Drosophila mauritiana ... cant alignments: (bits) Value sp|Q9BM98|JANA_DROMA Sex -regulated protein janus-A OS=Drosophila... 89 7e-1 ...

  17. AcEST: BP914244 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000056_F12 503 Adiantum capillus-veneris mRNA. clone: YMU001_000056_F12. BP914244 CL240Co ... inition sp|Q9SW17|RBOHG_ARATH Putative respiratory burst ... oxidase homolog protein G OS=Arabidopsis thaliana ... ) Value sp|Q9SW17|RBOHG_ARATH Putative respiratory burst ... oxidase homolog... 54 3e-07 sp|Q9SBI0|RBOHB_ARATH ...

  18. AcEST: BP913582 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000031_H02 480 Adiantum capillus-veneris mRNA. clone: YMU001_000031_H02. BP913582 - Show ... 948U0 Definition sp|Q948U0|RBOHA_SOLTU Respiratory burst ... oxidase homolog protein A OS=Solanum tuberosum Ali ... ts: (bits) Value sp|Q948U0|RBOHA_SOLTU Respiratory burst ... oxidase homolog protein ... 98 7e-28 sp|O48538|RBO ...

  19. AcEST: BP919459 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_C12 508 Adiantum capillus-veneris mRNA. clone: YMU001_000125_C12. BP919459 - Show ... 664W4 Definition sp|Q664W4|ACEK_YERPS Isocitrate dehydrogen ase kinase/phosphatase OS=Yersinia pseudotuberculos ... ts: (bits) Value sp|Q664W4|ACEK_YERPS Isocitrate dehydrogen ase kinase/phosphatase... 32 1.7 sp|A4TH34|ACEK_YER ...

  20. AcEST: BP915553 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_A02 471 Adiantum capillus-veneris mRNA. clone: YMU001_000073_A02. BP915553 - Show ... OS=Homo sapiens GN... 33 0.63 sp|P35358|OPSG_GECGE Green -sensitive opsin P521 OS=Gecko gecko P... 31 3.2 sp ... SEMRRKLLAVSASKVISTVKRKTSC 52 >sp|P35358|OPSG_GECGE Green -sensitive opsin P521 OS=Gecko gecko PE=1 SV=1 Leng ...

  1. AcEST: BP913707 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_D04 578 Adiantum capillus-veneris mRNA. clone: YMU001_000033_D04. BP913707 - Show ... Q43093 Definition sp|Q43093|SSG2_PEA Granule-bound starch ... synthase 2, chloroplastic/amyloplastic OS=Pisum sa ... nts: (bits) Value sp|Q43093|SSG2_PEA Granule-bound starch ... synthase 2, chloroplasti... 78 3e-14 sp|Q43847|SSY ...

  2. AcEST: BP920115 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_B12 515 Adiantum capillus-veneris mRNA. clone: YMU001_000133_B12. BP920115 - Show ... _id Q43846 Definition sp|Q43846|SSY3_SOLTU Soluble starch ... synthase 3, chloroplastic/amyloplastic OS=Solanum ... gnments: (bits) Value sp|Q43846|SSY3_SOLTU Soluble starch ... synthase 3, chloroplastic/am... 61 2e-11 sp|Q6MAS9 ...

  3. AcEST: BP913307 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_G11 593 Adiantum capillus-veneris mRNA. clone: YMU001_000028_G11. BP913307 - Show ... _id Q43846 Definition sp|Q43846|SSY3_SOLTU Soluble starch ... synthase 3, chloroplastic/amyloplastic OS=Solanum ... gnments: (bits) Value sp|Q43846|SSY3_SOLTU Soluble starch ... synthase 3, chloroplastic/am... 199 9e-52 sp|P0327 ...

  4. AcEST: BP919574 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_F10 602 Adiantum capillus-veneris mRNA. clone: YMU001_000126_F10. BP919574 CL849Co ... _id Q9FNF2 Definition sp|Q9FNF2|SSY1_ARATH Soluble starch ... synthase, chloroplastic/amyloplastic OS=Arabidopsi ... gnments: (bits) Value sp|Q9FNF2|SSY1_ARATH Soluble starch ... synthase, chloroplastic/amyl... 290 3e-78 sp|P9356 ...

  5. AcEST: BP916668 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000090_B12 565 Adiantum capillus-veneris mRNA. clone: YMU001_000090_B12. BP916668 - Show ... Definition sp|Q08473|SQD_DROME RNA-binding protein squid ... OS=Drosophila melanogaster Align length 19 Score ( ... its) Value sp|Q08473|SQD_DROME RNA-binding protein squid ... OS=Drosophila mela... 32 2.8 sp|Q5RAU9|ZN131_PONAB ...

  6. AcEST: BP918727 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_G10 559 Adiantum capillus-veneris mRNA. clone: YMU001_000116_G10. BP918727 CL871Co ... Definition sp|Q08473|SQD_DROME RNA-binding protein squid ... OS=Drosophila melanogaster Align length 36 Score ( ... its) Value sp|Q08473|SQD_DROME RNA-binding protein squid ... OS=Drosophila mela... 41 0.005 sp|Q5R5W2|TADBP_PON ...

  7. AcEST: BP913187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_E03 540 Adiantum capillus-veneris mRNA. clone: YMU001_000027_E03. BP913187 CL397Co ... sp|P0C423|LEP4_AERSA Type 4 prepilin-like proteins leader ... peptid... 30 5.8 sp|A2T195|LEP4_AERS4 Type 4 prepi ... lin-like proteins leader ... peptid... 30 5.8 sp|P62285|ASPM_BOVIN Abnormal spi ...

  8. AcEST: BP913566 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000031_F09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000031_F09. BP913566 CL397Co ... sp|P0C423|LEP4_AERSA Type 4 prepilin-like proteins leader ... peptid... 30 6.3 sp|A2T195|LEP4_AERS4 Type 4 prepi ... lin-like proteins leader ... peptid... 30 6.3 sp|P62285|ASPM_BOVIN Abnormal spi ...

  9. AcEST: BP918026 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_G03 468 Adiantum capillus-veneris mRNA. clone: YMU001_000108_G03. BP918026 - Show ... sp|P25960|LEP4_ECOLI Type 4 prepilin-like proteins leader ... peptide-processing enzyme OS=Escherichia coli (str ... sp|P25960|LEP4_ECOLI Type 4 prepilin-like proteins leader ... peptid... 34 0.37 sp|P46567|SRG13_CAEEL Serpentine ...

  10. AcEST: BP914517 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_G07 591 Adiantum capillus-veneris mRNA. clone: YMU001_000059_G07. BP914517 CL2239C ... 4 sp|P09767|HEMA_INBVI Hemagglutinin (Fragment) OS=Influenza ... B vir... 32 2.4 sp|P09766|HEMA_INBUS Hemagglutinin ... (Fragment) OS=Influenza ... B vir... 32 2.4 sp|P03463|HEMA_INBSI Hemagglutinin ...

  11. AcEST: BP921486 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000150_E04 191 Adiantum capillus-veneris mRNA. clone: YMU001_000150_E04. BP921486 - Show ... : Swiss-Prot sp_hit_id P07374 Definition sp|P07374|UREA _CANEN Urea se OS=Canavalia ensiformis Align length ... ing significant alignments: (bits) Value sp|P07374|UREA _CANEN Urea se OS=Canavalia ensiformis PE=1 SV=3 89 ...

  12. AcEST: BP918895 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_G04 568 Adiantum capillus-veneris mRNA. clone: YMU001_000118_G04. BP918895 - Show ... 9AWA5 Definition sp|Q9AWA5|GWD1_SOLTU Alpha-glucan water ... dikinase, chloroplastic OS=Solanum tuberosum Align ... ts: (bits) Value sp|Q9AWA5|GWD1_SOLTU Alpha-glucan water ... dikinase, chloroplastic ... 239 7e-63 sp|Q9SAC6|GW ...

  13. AcEST: BP912981 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_A08 382 Adiantum capillus-veneris mRNA. clone: YMU001_000025_A08. BP912981 - Show ... ein At5g4880... 43 4e-04 sp|P27540|ARNT_HUMAN Aryl hydrocarbon ... receptor nuclear transloca... 34 0.26 sp|Q9BE97|AR ... NT_BOVIN Aryl hydrocarbon ... receptor nuclear transloca... 34 0.26 sp|P41739|AR ...

  14. AcEST: BP919648 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_E08 563 Adiantum capillus-veneris mRNA. clone: YMU001_000127_E08. BP919648 - Show ... : Swiss-Prot sp_hit_id O43593 Definition sp|O43593|HAIR _HUMAN Protein hair less OS=Homo sapiens Align lengt ... ing significant alignments: (bits) Value sp|O43593|HAIR _HUMAN Protein hair less OS=Homo sapiens GN=HR PE=1. ...

  15. AcEST: BP917148 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000096_G02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000096_G02. BP917148 - Show ... sp|Q7ZZL8|TMHS_CHICK Tetraspan membrane protein of hair ... cell stereocilia homolog OS=Gallus gallus Align le ... sp|Q7ZZL8|TMHS_CHICK Tetraspan membrane protein of hair ... cell ste... 32 2.3 sp|P56720|SRBP1_RAT Sterol regu ...

  16. AcEST: BP911829 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_F08 522 Adiantum capillus-veneris mRNA. clone: YMU001_000009_F08. BP911829 - Show ... 2 sp|Q5PPI7|TMHS_RAT Tetraspan membrane protein of hair ... cell stere... 33 0.82 sp|Q4KL25|TMHS_MOUSE Tetrasp ... an membrane protein of hair ... cell ste... 33 0.82 sp|Q8TAF8|TMHS_HUMAN Tetraspan ...

  17. AcEST: BP916427 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_E11 467 Adiantum capillus-veneris mRNA. clone: YMU001_000087_E11. BP916427 - Show ... taining pr... 32 1.1 sp|Q06708|VAC14_YEAST Vacuole morphology ... and inheritance protein... 32 1.8 sp|O67485|Y1525_ ... QTASATTLNPAKRT 2965 >sp|Q06708|VAC14_YEAST Vacuole morphology ... and inheritance protein 14 OS=Saccharomyces cerevi ...

  18. AcEST: BP913171 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_C08 408 Adiantum capillus-veneris mRNA. clone: YMU001_000027_C08. BP913171 CL860Co ... t sp_hit_id Q06881 Definition sp|Q06881|BCCP_ANASP Biotin ... carboxyl carrier protein of acetyl-CoA carboxylase ... cant alignments: (bits) Value sp|Q06881|BCCP_ANASP Biotin ... carboxyl carrier protein of acetyl-C... 37 0.030 s ...

  19. AcEST: BP912679 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000021_F06 573 Adiantum capillus-veneris mRNA. clone: YMU001_000021_F06. BP912679 CL860Co ... t sp_hit_id P49786 Definition sp|P49786|BCCP_BACSU Biotin ... carboxyl carrier protein of acetyl-CoA carboxylase ... cant alignments: (bits) Value sp|P49786|BCCP_BACSU Biotin ... carboxyl carrier protein of acetyl-C... 35 2e-04 s ...

  20. AcEST: BP915012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_E02 510 Adiantum capillus-veneris mRNA. clone: YMU001_000065_E02. BP915012 CL860Co ... t sp_hit_id Q06881 Definition sp|Q06881|BCCP_ANASP Biotin ... carboxyl carrier protein of acetyl-CoA carboxylase ... cant alignments: (bits) Value sp|Q06881|BCCP_ANASP Biotin ... carboxyl carrier protein of acetyl-C... 37 6e-05 s ...

  1. AcEST: BP915507 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_D11 512 Adiantum capillus-veneris mRNA. clone: YMU001_000072_D11. BP915507 CL860Co ... t sp_hit_id Q06881 Definition sp|Q06881|BCCP_ANASP Biotin ... carboxyl carrier protein of acetyl-CoA carboxylase ... cant alignments: (bits) Value sp|Q06881|BCCP_ANASP Biotin ... carboxyl carrier protein of acetyl-C... 37 6e-05 s ...

  2. AcEST: BP918715 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_F09 421 Adiantum capillus-veneris mRNA. clone: YMU001_000116_F09. BP918715 CL17Con ... finition sp|O98997|RCA_PHAAU Ribulose bisphosphate car boxylase/oxygenase activase, chloroplastic OS=Phase ... s) Value sp|O98997|RCA_PHAAU Ribulose bisphosphate car boxylase/oxygenase ... 57 3e-08 sp|Q9ZT00|RCA_MAIZE ...

  3. AcEST: BP913699 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_C08 531 Adiantum capillus-veneris mRNA. clone: YMU001_000033_C08. BP913699 CL17Con ... finition sp|O98997|RCA_PHAAU Ribulose bisphosphate car boxylase/oxygenase activase, chloroplastic OS=Phase ... s) Value sp|O98997|RCA_PHAAU Ribulose bisphosphate car boxylase/oxygenase ... 109 6e-24 sp|Q7X999|RCA2_LAR ...

  4. AcEST: BP911592 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000006_G08 335 Adiantum capillus-veneris mRNA. clone: YMU001_000006_G08. BP911592 - Show ... OS=Homo sapiens GN... 30 3.8 sp|P95375|EXBB_NEIMC Biopolymer ... transport protein exbB OS=Neisse... 30 4.9 sp|P641 ... 00|EXBB_NEIMB Biopolymer ... transport protein exbB OS=Neisse... 30 4.9 sp|P640 ...

  5. AcEST: BP920834 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000142_C08 393 Adiantum capillus-veneris mRNA. clone: YMU001_000142_C08. BP920834 - Show ... e protein YOR044W O... 30 2.9 sp|Q3Z259|BTUC_SHISS Vitamin ... B12 import system permease protein ... 30 2.9 sp|Q ... 7C1M5|BTUC_SHIFL Vitamin ... B12 import system permease protein ... 30 2.9 sp|Q ...

  6. AcEST: BP911489 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000005_E10 549 Adiantum capillus-veneris mRNA. clone: YMU001_000005_E10. BP911489 CL2376C ... ot sp_hit_id Q66HB6 Definition sp|Q66HB6|CAGE1_RAT Cancer -associated gene 1 protein homolog OS=Rattus norveg ... icant alignments: (bits) Value sp|Q66HB6|CAGE1_RAT Cancer -associated gene 1 protein homolog OS=... 44 5e-04 ...

  7. AcEST: BP916154 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_G12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000083_G12. BP916154 - Show ... sp|Q8CCP0|SDCG1_MOUSE Serologically defined colon cancer ... antigen 1 homolog OS=Mus musculus Align length 48 ... sp|Q8CCP0|SDCG1_MOUSE Serologically defined colon cancer ... antigen... 45 1e-04 sp|O60524|SDCG1_HUMAN Serologi ...

  8. AcEST: BP914492 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_E05 529 Adiantum capillus-veneris mRNA. clone: YMU001_000059_E05. BP914492 - Show ... ly 4 group A membe... 30 9.4 sp|Q28555|HAND1_SHEEP Heart - and neural crest derivatives-expres... 30 9.4 sp| ... Q0VCE2|HAND1_BOVIN Heart - and neural crest derivatives-expres... 30 9.4 sp| ...

  9. AcEST: BP915472 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_A05 503 Adiantum capillus-veneris mRNA. clone: YMU001_000072_A05. BP915472 - Show ... ion sp|Q9UBH6|XPR1_HUMAN Xenotropic and polytropic retrovirus ... receptor 1 OS=Homo sapiens Align length 96 Score ( ... lue sp|Q9UBH6|XPR1_HUMAN Xenotropic and polytropic retrovirus ... recept... 47 7e-05 sp|Q9QZ70|XPR1_CRIGR Xenotropic ...

  10. AcEST: BP918223 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_A01 522 Adiantum capillus-veneris mRNA. clone: YMU001_000111_A01. BP918223 CL3665C ... ot sp_hit_id Q41144 Definition sp|Q41144|STC_RICCO Sugar ... carrier protein C OS=Ricinus communis Align length ... icant alignments: (bits) Value sp|Q41144|STC_RICCO Sugar ... carrier protein C OS=Ricinus communis ... 159 6e-3 ...

  11. AcEST: BP914506 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_F08 538 Adiantum capillus-veneris mRNA. clone: YMU001_000059_F08. BP914506 - Show ... P... 39 0.012 sp|P47153|YJ86_YEAST Uncharacterized TLC ... domain-containing prote... 33 1.1 sp|O13752|YF22_S ... CHPO Uncharacterized TLC ... domain-containing prote... 32 1.9 sp|Q5JZQ7|CLN8_C ...

  12. AcEST: BP918457 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F12 503 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F12. BP918457 - Show ... 489 Definition sp|P08489|GLT4_WHEAT Glutenin, high molecular ... weight subunit PW212 OS=Triticum aestivum Align le ... : (bits) Value sp|P08489|GLT4_WHEAT Glutenin, high molecular ... weight subunit PW2... 38 0.030 sp|P10388|GLT5_WHEA ...

  13. AcEST: BP917374 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_A09 153 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A09. BP917374 - Show ... ptor 64b OS=Drosoph... 30 3.8 sp|Q7VIW9|HIS5_HELHP Imidazole ... glycerol phosphate synthase subun... 29 8.5 >sp|P8 ... VMPAVFWTEVREHYLALKRLVHLL 262 >sp|Q7VIW9|HIS5_HELHP Imidazole ... glycerol phosphate synthase subunit hisH OS=Helico ...

  14. AcEST: BP917692 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_C06 418 Adiantum capillus-veneris mRNA. clone: YMU001_000104_C06. BP917692 CL2903C ... tor subunit TOM6 ... 46 5e-05 sp|Q8Y9G5|HIS6_LISMO Imidazole ... glycerol phosphate synthase subun... 30 4.9 sp|Q72 ... 2Y7|HIS6_LISMF Imidazole ... glycerol phosphate synthase subun... 30 4.9 sp|Q5T ...

  15. AcEST: BP912779 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_G07 190 Adiantum capillus-veneris mRNA. clone: YMU001_000022_G07. BP912779 - Show ... sindicus PE=... 30 2.9 sp|Q95QW4|CDF1_CAEEL Cation diffusion ... facilitator family protein... 30 2.9 sp|P76223|YNJ ... AESGYCQWFGRWGNGCWC 49 >sp|Q95QW4|CDF1_CAEEL Cation diffusion ... facilitator family protein 1 OS=Caenorhabditis ele ...

  16. AcEST: BP918522 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_E04 480 Adiantum capillus-veneris mRNA. clone: YMU001_000114_E04. BP918522 CL3820C ... rot sp_hit_id P07687 Definition sp|P07687|HYEP_RAT Epoxide ... hydrolase 1 OS=Rattus norvegicus Align length 70 S ... ficant alignments: (bits) Value sp|P07687|HYEP_RAT Epoxide ... hydrolase 1 OS=Rattus norvegicus GN=E... 33 0.63 s ...

  17. AcEST: BP915262 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000069_D12 517 Adiantum capillus-veneris mRNA. clone: YMU001_000069_D12. BP915262 CL3820C ... rot sp_hit_id P07687 Definition sp|P07687|HYEP_RAT Epoxide ... hydrolase 1 OS=Rattus norvegicus Align length 70 S ... ficant alignments: (bits) Value sp|P07687|HYEP_RAT Epoxide ... hydrolase 1 OS=Rattus norvegicus GN=E... 33 0.92 s ...

  18. AcEST: BP918177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_D10 560 Adiantum capillus-veneris mRNA. clone: YMU001_000110_D10. BP918177 - Show BP918177...is mRNA. clone: YMU001_000110_D10. Accession BP918177 Tissue type prothallium Developmental stage - Contig I...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP918177|Adiantum capillus-veneris mRNA, clone: YMU001_0001...o sapiens GN=... 31 4.7 sp|P17765|POLG_BYMV Genome polyprotein OS=Bean yellow mosaic vir... 31 4.7 sp|Q06248...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918177|Adiantum capillus-veneris mRNA, clone

  19. AcEST: BP911818 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_E07 537 Adiantum capillus-veneris mRNA. clone: YMU001_000009_E07. BP911818... CL3769Contig1 Show BP911818 Clone id YMU001_000009_E07 Library YMU01 Length 537 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000009_E07. Accession BP911818 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911818|Adiantum c...MQ1|PP376_ARATH Pentatricopeptide repeat-containing protei... 47 6e-05 sp|Q9SFV9|PP218_ARATH Pentatricopepti

  20. AcEST: BP917754 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A06 425 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A06. BP91775...4 CL28Contig1 Show BP917754 Clone id YMU001_000105_A06 Library YMU01 Length 425 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000105_A06. Accession BP917754 Tissue type prothallium Developmental stage ...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91775...H R H + S SERR + Sbjct: 1722 ARRSHRSPSERSHHSPSERSHHSPSERRHHSPSERSHCSPSERSHCSPSERRHR 1775 >sp|Q9JIG7|CCD22_MO

  1. AcEST: BP920648 [AcEST

    Lifescience Database Archive (English)

    Full Text Available on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920648|Adiantu...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920648|Adiantum capillus-veneris ...YMU001_000139_G01 166 Adiantum capillus-veneris mRNA. clone: YMU001_000139_G01. BP920648 CL768Conti...g1 Show BP920648 Clone id YMU001_000139_G01 Library YMU01 Length 166 Definition Adiantum cap...on sp|Q5G872|SCUB2_DANRE Signal peptide, CUB and EGF-like domain-cont

  2. BP's emissions trading system

    International Nuclear Information System (INIS)

    Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate

  3. AcEST: BP914102 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1 OS=... 30 2.8 sp|P35438|NMDZ1_MOUSE Glutamate [NMDA] receptor subunit zeta-1 O... 30 2.8 sp|A8MJN5|SECA_ALKOO Protein tra...14102 - Show BP914102 Clone id YMU001_000039_H05 Library YMU01 Length 320 Definition Adiantum capillus-vener...ot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q05586 Definition sp|Q05586|NMDZ1_HUMAN Glutama...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914102.....................done Score E Sequences producing significant alignments: (bits) Value sp|Q05586|NMDZ1_HUMAN Glutama

  4. Improved biosorption for Cr(VI) reduction and removal by Arthrobacter viscosus using zeolite

    OpenAIRE

    Silva, Bruna Andreia Nogueira Airosa; Figueiredo, Hugo; Quintelas, C.; Neves, Isabel C.; Tavares, M.T.

    2012-01-01

    The aim of the present work was to optimize the reduction and removal of chromium from aqueous solutions by a biosorption system consisting of a bacteria supported on a zeolite. The system proposed combines the biosorption properties of Arthrobacter viscosus, with the ion exchange capacity of NaY zeolite. Experiments were also performed without the zeolite for comparison purposes. Experimental parameters such as solution pH, biomass concentration and initial Cr(VI) concentration were investig...

  5. Biodegradation by an Arthrobacter Species of Hydrocarbons Partitioned into an Organic Solvent

    OpenAIRE

    Efroymson, Rebecca A.; Alexander, Martin

    1991-01-01

    An Arthrobacter strain mineralized naphthalene and n-hexadecane dissolved in 2,2,4,4,6,8,8-heptamethylnonane. The extent of mineralization increased with greater volumes of solvent. Measurements under aseptic conditions of the partitioning of naphthalene into the aqueous phase from the solid phase or from heptamethylnonane showed that the rates were rapid and did not limit mineralization. The rate of mineralization of hexadecane was rapid, although partitioning of the compound into aqueous so...

  6. Isolation and Preliminary Characterization of Twenty Bacteriophages Infecting Either Brevibacterium or Arthrobacter Strains

    OpenAIRE

    Trautwetter, Annie; Blanco, Carlos

    1988-01-01

    Thirty-seven bacteriophages plaquing on Corynebacterium, Brevibacterium, or Arthrobacter strains were isolated from soil or vegetation samples. Restriction analysis of phage DNA indicated that 20 phages were unique; one of them produced entirely turbid plaques on Brevibacterium ketoglutamicum and was characterized as temperate. All these phages were assigned to group B of the classification of Bradley (Bacteriol. Rev. 31:230-314, 1967) and had relatively narrow host ranges.

  7. AcEST: BP913580 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000031_G12 505 Adiantum capillus-veneris mRNA. clone: YMU001_000031_G12. BP913580 CL1372C ... 33 0.90 sp|O39927|POLG_HCVEU Genome polyprotein OS=Hepa titis C virus gen... 31 2.6 sp|O92531|POLG_HCVVO Ge ... nome polyprotein OS=Hepa titis C virus gen... 31 3.4 sp|Q2GK24|ENO_ANAPZ Eno ... 31 3.4 sp|O92529|POLG_HCVT5 Genome polyprotein OS=Hepa titis C virus gen... 30 4.5 sp|Q6NRB9|K0090_XENLA U ... 30 5.8 sp|O92530|POLG_HCVVN Genome polyprotein OS=Hepa titis C virus gen... 30 5.8 sp|Q68798|POLG_HCVJL Ge ...

  8. AcEST: BP911896 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 11896 - Show BP911896 Clone id YMU001_000010_E09 Library YMU01 Length 542 Definition Adiantum capillus-vener...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nu... alignments: (bits) Value sp|Q8YSM9|MUTL_ANASP DNA mismatch repair protein mutL OS=Anabaen... 31 4.5 sp|Q00960|NMDE2_RAT Glutama...te [NMDA] receptor subunit epsilon-2 ... 30 5.8 sp|Q01097|NMDE2_MOUSE Glutamate [NMDA] r...eceptor subunit epsilon-... 30 5.8 sp|Q13224|NMDE2_HUMAN Glutamate [NMDA] recepto

  9. AcEST: BP918729 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_G12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000116_G12. BP918729 - Show ... : Swiss-Prot sp_hit_id Q39090 Definition sp|Q39090|UFO _ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis ... ing significant alignments: (bits) Value sp|Q39090|UFO _ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis ... OS=Tamiami virus (isolate Rat... 30 7.7 >sp|Q39090|UFO _ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis ... thaliana GN=UFO ... PE=1 SV=2 Length = 442 Score = 42.4 bits (98), Exp ...

  10. AcEST: BP920877 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000142_G11 465 Adiantum capillus-veneris mRNA. clone: YMU001_000142_G11. BP920877 CL3887C ... : Swiss-Prot sp_hit_id Q39090 Definition sp|Q39090|UFO _ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis ... ing significant alignments: (bits) Value sp|Q39090|UFO _ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis ... /N-rich) domain-bearing prote... 30 6.8 >sp|Q39090|UFO _ARATH Protein UNUSUAL FLORAL ORGANS OS=Arabidopsis ... thaliana GN=UFO ... PE=1 SV=2 Length = 442 Score = 34.3 bits (77), Exp ...

  11. AcEST: BP915302 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000069_H10 479 Adiantum capillus-veneris mRNA. clone: YMU001_000069_H10. BP915302 - Show ... OS=Ga... 33 0.87 sp|Q62314|TGON2_MOUSE Trans-Golgi network ... integral membrane prot... 31 2.5 sp|Q73GW6|SYP_WOL ... -rich ... 25 6.8 sp|Q62313|TGON1_MOUSE Trans-Golgi network ... integral membrane prot... 29 9.6 sp|Q4WN42|MCES_AS ...

  12. AcEST: BP913293 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_F09 508 Adiantum capillus-veneris mRNA. clone: YMU001_000028_F09. BP913293 - Show ... 46 sp|Q8J2J3|AMN1_PICAN Antagonist of mitotic exit network ... protein ... 33 0.59 sp|Q8C7B6|FXL22_MOUSE F-box/LR ... .7 sp|Q6C725|AMN1_YARLI Antagonist of mitotic exit network ... protein ... 32 2.3 sp|O49286|FBL5_ARATH F-box/LRR- ...

  13. AcEST: BP919386 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E08 575 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E08. BP919386 - Show ... gateri... 32 3.0 sp|Q62314|TGON2_MOUSE Trans-Golgi network ... integral membrane prot... 31 3.9 sp|Q4L6C3|ODO2_ST ... dococc... 31 5.1 sp|Q62313|TGON1_MOUSE Trans-Golgi network ... integral membrane prot... 31 5.1 sp|Q5KVE4|PGK_GEO ...

  14. AcEST: BP918920 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000119_A09 556 Adiantum capillus-veneris mRNA. clone: YMU001_000119_A09. BP918920 - Show ... ce... 43 0.001 sp|Q67WR2|FCL1_ORYSJ Probable GDP-L-fucose ... synthase 1 OS=Oryza s... 42 0.002 sp|Q5UR12|TGDS_M ... dratase OS=... 41 0.005 sp|O49213|FCL1_ARATH GDP-L-fucose ... synthase 1 OS=Arabidopsis thal... 39 0.013 sp|Q9LM ...

  15. AcEST: BP918153 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_B10 482 Adiantum capillus-veneris mRNA. clone: YMU001_000110_B10. BP918153 CL3622C ... ryza sativa... 51 3e-06 sp|O49213|FCL1_ARATH GDP-L-fucose ... synthase 1 OS=Arabidopsis thal... 50 5e-06 sp|Q93V ... ha... 50 7e-06 sp|Q67WR2|FCL1_ORYSJ Probable GDP-L-fucose ... synthase 1 OS=Oryza s... 49 9e-06 sp|Q9LMU0|FCL2_A ...

  16. AcEST: BP916049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000082_D10 531 Adiantum capillus-veneris mRNA. clone: YMU001_000082_D10. BP916049 - Show ... sp_hit_id Q8N0W3 Definition sp|Q8N0W3|FUK_HUMAN L-fucose ... kinase OS=Homo sapiens Align length 142 Score (bit ... ant alignments: (bits) Value sp|Q8N0W3|FUK_HUMAN L-fucose ... kinase OS=Homo sapiens GN=FUK PE=2 ... 81 3e-15 sp ...

  17. AcEST: BP913858 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000037_B08 602 Adiantum capillus-veneris mRNA. clone: YMU001_000037_B08. BP913858 - Show ... OS=Homo sapiens GN... 32 3.2 sp|Q8BV79|LBA1_MOUSE Lupus ... brain antigen 1 OS=Mus musculus GN=Lb... 32 3.2 sp ... OS=Parabacteroides... 31 4.2 sp|O15050|LBA1_HUMAN Lupus ... brain antigen 1 homolog OS=Homo sapie... 31 4.2 sp ...

  18. AcEST: BP921184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_F11 499 Adiantum capillus-veneris mRNA. clone: YMU001_000146_F11. BP921184 - Show ... sp_hit_id Q9Y3M8 Definition sp|Q9Y3M8|STA13_HUMAN StAR -related lipid transfer protein 13 OS=Homo sapiens ... ant alignments: (bits) Value sp|Q9Y3M8|STA13_HUMAN StAR -related lipid transfer protein 13 OS=... 30 4.5 sp ...

  19. AcEST: BP914363 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_A11 560 Adiantum capillus-veneris mRNA. clone: YMU001_000058_A11. BP914363 CL1158C ... sp_hit_id P08175 Definition sp|P08175|MS87F_DROME Male -specific sperm protein Mst87F OS=Drosophila melano ... ant alignments: (bits) Value sp|P08175|MS87F_DROME Male -specific sperm protein Mst87F OS=Dros... 31 3.6 sp ...

  20. AcEST: BP918305 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A02 488 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A02. BP918305 - Show ... 32 2.0 sp|P33478|POLG_DEN1S Genome polyprotein OS=Dengue ... virus type 1 (... 32 2.0 sp|Q9SAK0|PP132_ARATH Pen ... 30 4.5 sp|P17763|POLG_DEN1W Genome polyprotein OS=Dengue ... virus type 1 (... 30 5.8 >sp|B3H4P1|PP450_ARATH Pe ...

  1. AcEST: BP916029 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000082_B08 455 Adiantum capillus-veneris mRNA. clone: YMU001_000082_B08. BP916029 - Show ... ria ... 32 1.3 sp|Q8R2K4|TAF6L_MOUSE TAF6-like RNA polymer ase II p300/CBP-assoc... 31 2.2 sp|Q7TT49|MRCKB_RAT ... eta ... 31 2.2 sp|Q9Y6J9|TAF6L_HUMAN TAF6-like RNA polymer ase II p300/CBP-assoc... 31 2.9 sp|A7MCY6|TBKB1_HUM ...

  2. AcEST: BP921721 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000153_D02 435 Adiantum capillus-veneris mRNA. clone: YMU001_000153_D02. BP921721 CL638Co ... -phosphoadenosine 5'-phosph... 110 3e-24 sp|A9G7W0|SAT C2_SORC5 Probable bifunctional SAT /APS kinase 2 OS= ... ... 66 5e-11 sp|Q67QB5|SAT _SYMTH Sulfate adenylyltransferase OS=Symbiobacteri ... ... 65 9e-11 sp|A5D5R7|SAT _PELTS Sulfate adenylyltransferase OS=Pelotomaculum ... ... 61 2e-09 sp|Q8CR03|SAT _STAES Sulfate adenylyltransferase OS=Staphylococcu ...

  3. AcEST: BP915880 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_A06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000079_A06. BP915880 CL2735C ... ase... 68 4e-11 sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor ... kinase/phosphatase lux... 67 5e-11 sp|Q54YH4|DHKB_ ... ase... 66 1e-10 sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor ... kinase/phosphatase lux... 65 2e-10 sp|P37894|PLEC_ ...

  4. AcEST: BP921037 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_G09 503 Adiantum capillus-veneris mRNA. clone: YMU001_000144_G09. BP921037 CL2615C ... t sp_hit_id Q9SZ30 Definition sp|Q9SZ30|HIS5_ARATH Imidazole ... glycerol phosphate synthase hisHF, chloroplastic O ... cant alignments: (bits) Value sp|Q9SZ30|HIS5_ARATH Imidazole ... glycerol phosphate synthase hisHF... 30 4.9 >sp|Q9 ...

  5. AcEST: BP917208 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_F07 401 Adiantum capillus-veneris mRNA. clone: YMU001_000097_F07. BP917208 - Show ... t sp_hit_id A1JPY2 Definition sp|A1JPY2|TRPA_YERE8 Tryptophan ... synthase alpha chain OS=Yersinia enterocolitica se ... cant alignments: (bits) Value sp|A1JPY2|TRPA_YERE8 Tryptophan ... synthase alpha chain OS=Yersinia... 31 2.2 sp|Q596 ...

  6. Acaricomes phytoseiuli gen. nov., sp. nov., isolated from the predatory mite Phytoseiulus persimilis.

    Science.gov (United States)

    Pukall, Rüdiger; Schumann, Peter; Schütte, Conny; Gols, Rieta; Dicke, Marcel

    2006-02-01

    A Gram-positive, rod-shaped, non-spore-forming bacterium, strain CSCT, was isolated from diseased, surface-sterilized specimens of the predatory mite Phytoseiulus persimilis Athias-Henriot and subjected to polyphasic taxonomic analysis. Comparative analysis of the 16S rRNA gene sequence revealed that the strain was a new member of the family Micrococcaceae. Nearest phylogenetic neighbours were determined as Renibacterium salmoninarum (94.0%), Arthrobacter globiformis (94.8%) and Arthrobacter russicus (94.6%). Although the predominant fatty acids (anteiso C15:0), cell-wall sugars (galactose, glucose) and polar lipids (diphosphatidylglycerol, phosphatidylglycerol, phosphatidylinositol) are in accordance with those of members of the genus Arthrobacter, strain CSCT can be distinguished from members of the genus Arthrobacter by biochemical tests, the absence of a rod-coccus life cycle and the occurrence of the partially saturated menaquinone MK-10(H2) as the predominant menaquinone. The DNA G+C content is 57.7 mol%. On the basis of morphological, chemotaxonomic and phylogenetic differences from other species of the Micrococcaceae, a novel genus and species are proposed, Acaricomes phytoseiuli gen. nov., sp. nov. The type strain is CSCT (=DSM 14247T=CCUG 49701T). PMID:16449459

  7. AcEST: BP912832 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912832|Adiantum capillus-vener...... 31 4.8 sp|Q54ZB3|COG1_DICDI Conserved oligomeric Golgi complex subunit ... 31 4.8 sp|Q80W92|VAC14_RAT Pr...SSSTSPSPASSPSPTLSTPSPSLMP 355 >sp|Q54ZB3|COG1_DICDI Conserved oligomeric Golgi complex subunit 1 OS=Dictyost...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912832|Adiantum capillus-vener...YMU001_000023_D06 565 Adiantum capillus-veneris mRNA. clone: YMU001_000023_D06. BP9

  8. AcEST: BP915876 [AcEST

    Lifescience Database Archive (English)

    Full Text Available QPAGKTI 271 L+P +T+ Sbjct: 878 HLEPKFRTL 886 >sp|Q08530|BTR_BORPE Transcriptional regulatory protein btr OS=Bordetella pertussis...-1 OS=Bos taurus GN=DSC1 PE=1 SV=1 32 0.99 sp|Q08530|BTR_BORPE Transcriptional regulatory protein btr OS=Bo... 31 1.7 sp...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915876|Adiantum capillus-veneris...YMU001_000079_A02 337 Adiantum capillus-veneris mRNA. clone: YMU001_000079_A02. BP9...15876 - Show BP915876 Clone id YMU001_000079_A02 Library YMU01 Length 337 Definition Adiantum capillus-veneris

  9. AcEST: BP918183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E04 482 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E04. BP918183 - Show BP91818...is mRNA. clone: YMU001_000110_E04. Accession BP918183 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP918183|Adiantum capillus-veneris mRNA, clone: ...5RBR7|LYPA1_PONAB Acyl-protein thioesterase 1 OS=Pongo abeli... 35 0.18 sp|O75608|LYPA1_HUMAN Acyl-protein t...hioesterase 1 OS=Homo sapien... 35 0.18 sp|Q750X7|APTH1_ASHGO Acyl-protein thioesterase 1 OS=Ashbya goss... 35 0.18

  10. AcEST: BP918018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP918018...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM..._ARATH Probable alpha,alpha-trehalose-phosphate sy... 190 3e-48 sp|Q9LRA7|TPS9_ARATH Probable alpha,alpha-tr...ehalose-phosphate sy... 189 3e-48 sp|Q0WUI9|TPS8_ARATH Probable alpha,alpha-trehalose-phosphate sy... 18

  11. AcEST: BP919090 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_B05 548 Adiantum capillus-veneris mRNA. clone: YMU001_000121_B05. BP919090 - Show BP919090...is mRNA. clone: YMU001_000121_B05. Accession BP919090 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919090|Adiantum capillus-veneris mRNA, clone: YMU001_000121_B...HUMAN Transferrin receptor protein 2 OS=Homo sapi... 75 2e-13 sp|Q90997|TFR1_CHICK Transferrin receptor prot...02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapi... 61 3e-09 sp|Q2V905|TFR1_HORSE Transferrin re

  12. AcEST: BP918043 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A02 493 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A02. BP918043 CL3885C ... ession BP918043 Tissue type prothallium Developmental s tage - Contig ID CL3885Contig1 Sequence AATTCGCGGC ... NSLDEIQFSRGKSEFYQLLCAIVACGHIDQQL 1798 Query: 195 LLALS NMF 172 +LSN F Sbjct: 1799 GTSLSNAF 1806 >sp|Q4IBR4 ...

  13. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available QQVKPATEAKTEVKQPTTQQTAPAPKAAE 187 >sp|Q8R4H2|ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus muscu........done Score E Sequences producing significant alignments: (bits) Value tr|Q6K3C4|Q6K3C4_ORYSJ Putative u...17259 - Show BP917259 Clone id YMU001_000098_D05 Library YMU01 Length 523 Definition Adiantum capillus-vener...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917259|Adiant.......done Score E Sequences producing significant alignments: (bits) Value sp|A3GF

  14. AcEST: BP920886 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000143_A02 308 Adiantum capillus-veneris mRNA. clone: YMU001_000143_A02. BP920886 CL2791Conti...g1 Show BP920886 Clone id YMU001_000143_A02 Library YMU01 Length 308 Definition Adiantum ca...olamine-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae Align length 29 Score (bit) 29...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:...Value sp|P33412|ECT1_YEAST Ethanolamine-phosphate cytidylyltransferase... 29 6.4 >sp|P33412|ECT1_YEAST Ethanolamine-phosphate cytid

  15. AcEST: BP919822 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_E09 519 Adiantum capillus-veneris mRNA. clone: YMU001_000129_E09. BP919822 CL11...pillus-veneris mRNA. clone: YMU001_000129_E09. Accession BP919822 Tissue type prothallium Developmental stage - Contig ID CL11...orhync... 122 1e-27 sp|P20684|COX3_ONCCL Cytochrome c oxidase subunit 3 OS=Oncorhync... 122 1e-27 sp|P92665|...72Contig1 Sequence TTCTGGGGGTTCGTATCCACTAAAGCAGCCTATCTATGCCGCTG...TATTCATAGATTTGTC AATGCTGCAACTATAGAAACTTTCATGAATATTAATACCCAATGCAAAACAAAAAACACA ACTTAGGTTTCTTTTCAGTGTTAGTGTAAG

  16. AcEST: BP912565 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |Q00161|VG43_ICHV1 Uncharacterized gene 43 protein OS=Ictaluri... 29 9.9 sp|Q9USU9|TOA1_SCHPO Transcri...LYTTVYRNFYGLGDFLALVATSLHLDNIWPL 197 >sp|Q9USU9|TOA1_SCHPO Transcription initiatio...D_PROMS 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=isp...YMU001_000020_D06 487 Adiantum capillus-veneris mRNA. clone: YMU001_000020_D06. BP9...12565 - Show BP912565 Clone id YMU001_000020_D06 Library YMU01 Length 487 Definition Adiantum capillus-veneris

  17. AcEST: BP917000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B O... 30 8.0 >sp|A6VDX9|GSH1_PSEA7 Glutamate-...cterized protein OS=Branc... 37 0.39 tr|A3LIS4|A3LIS4_PSEAE Glutamate--cysteine ligase OS=Pseudom...17000 - Show BP917000 Clone id YMU001_000094_E08 Library YMU01 Length 495 Definition Adiantum capillus-vener...t : Swiss-Prot sp_hit_id A6VDX9 Definition sp|A6VDX9|GSH1_PSEA7 Glutamate--cystei...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917000|

  18. AcEST: BP920792 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 20792 - Show BP920792 Clone id YMU001_000141_F07 Library YMU01 Length 314 Definition Adiantum capillus-vener...lease 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q38PU2 Definition sp|Q38PU2|GRIK3_MACFA Glutamate r...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9207.......................done Score E Sequences producing significant alignments: (bits) Value sp|Q38PU2|GRIK3_MACFA Glutama...te receptor, ionotropic kainate 3 O... 32 0.98 sp|Q13003|GRIK3_HUMAN Glutamate receptor, ionotrop

  19. AcEST: BP919133 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7UA71 Definition sp|Q7UA71|MURC_SYNPX UDP-N-acetylmuramate.........................done Score E Sequences producing significant alignments: (bits) Value sp|Q7UA71|MURC_SYNPX UDP-N-acetylmurama...te--L-alanine ligase OS=S... 31 4.2 >sp|Q7UA71|MURC_SYNPX UDP-N-acetylmuramate--L-ala...19133 - Show BP919133 Clone id YMU001_000121_F02 Library YMU01 Length 599 Definition Adiantum capillus-vener...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91

  20. AcEST: BP917628 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|Q17QV9|STK40_BOVIN Serine/threonine-protein kinase 40 OS=Bos ... 31 4.1 >sp|Q9VKH0|COG8_DROME Conserved oligomer... Definition sp|Q9VKH0|COG8_DROME Conserved oligomeric Golgi complex subunit 8 OS=Drosophila melanogaster Ali...ificant alignments: (bits) Value sp|Q9VKH0|COG8_DROME Conserved oligomeric Golgi complex subunit ... 32 2.4 ...YMU001_000103_D04 523 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D04. BP9...17628 CL648Contig1 Show BP917628 Clone id YMU001_000103_D04 Library YMU01 Length 523 Definition Adiantum capillus-vener

  1. Sp1 specific binding sites within the human H-ras promoter: potential role of the 6 bp deletion sequence in the T24 H-ras1 gene.

    Science.gov (United States)

    Pintzas, A; Spandidos, D A

    1991-01-01

    Transcriptionally active domains have been identified and located within the 5'-region of the human normal and mutant T24 H-ras1 promoters, and have been characterised by linkage to the coding sequences of the bacterial chloramphenicol acetyltransferase (CAT) gene or by using DNaseI foot-printing analysis of the promoter sequence. It has been shown, using the latter method, that Sp-1 transcription factor binds to six GC sequences within the H-ras promoter. In the present study we have used unfractionated nuclear protein preparations from HeLa cells and a gel retardation assay to analyse specific binding of nuclear protein preparations from HeLa cells and a gel retardation assay to analyse specific binding of nuclear factors to several oligonucleotide sequences of the human H-ras1 promoter. Our data demonstrate the presence of three Spl specific binding sequences in the T24 promoter, one of them containing a Sp-1 consensus GGCGGC absent in the normal H-rasl promoter. PMID:1776841

  2. AcEST: BP913614 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_C03 511 Adiantum capillus-veneris mRNA. clone: YMU001_000032_C03. BP9...13614 - Show BP913614 Clone id YMU001_000032_C03 Library YMU01 Length 511 Definition Adiantum capillus-vener... programs, Nucleic Acids Res. 25:3389-3402. Query= BP913614|Adiantum capillus-veneris mRNA, clone: YMU001_00.....................................................done Score E Sequences producing significant alignment...S=Moorella thermoa... 69 1e-11 sp|Q8TZ24|AROE_METKA Shikimate dehydrogenase OS=Methanopyrus kan... 67 3e-11

  3. AcEST: BP920355 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sphosulfate reductase OS=Serratia proteamaculans (strain 568) GN=cysH PE=3 SV=1 L...20355 - Show BP920355 Clone id YMU001_000136_B07 Library YMU01 Length 298 Definition Adiantum capillus-vener...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920355|Adiantum capillus-vener...1 AWQEARYGKLWE---QGVEGIERYNDLN-KVEPMNRALE 145 >sp|Q8JGS1|STIL_DANRE SCL-interrupting locus protein homolog OS=Danio rerio GN=sti...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920355|Adiantum capillus-vener

  4. 78 FR 60270 - BP America Inc., BP Corporation North America Inc., BP America Production Company, and BP Energy...

    Science.gov (United States)

    2013-10-01

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission BP America Inc., BP Corporation North America Inc., BP America Production Company, and BP Energy Company; Notice of Designation of Commission Staff as Non-Decisional With...

  5. AcEST: BP918551 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_H01 281 Adiantum capillus-veneris mRNA. clone: YMU001_000114_H01. BP918551 CL64Con ... IAGRHTPGTFTNQLQTSFSEPRLLI 130 Query: 182 LTDPRTDHQPIKEA ALGNIPIIAFCDTDSPMRH 280 LTDPRTDHQPIKEA ALGNIP IAFCDT ... DSPMR+ Sbjct: 131 LTDPRTDHQPIKEA ALGNIPTIAFCDTDSPMRY 163 >sp|O80377|RSSA_DAUCA 40S r ... IAGRHTPGTFTNQLQTSFSEPRLLI 123 Query: 182 LTDPRTDHQPIKEA ALGNIPIIAFCDTDSPMRH 280 LTDPRTDHQPIKEA ALGNIP IAFCDT ... DSPMR+ Sbjct: 124 LTDPRTDHQPIKEA ALGNIPTIAFCDTDSPMRY 156 >sp|Q9ZSR8|RSSA_BRANA 40S r ...

  6. AcEST: BP912705 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000021_H11 492 Adiantum capillus-veneris mRNA. clone: YMU001_000021_H11. BP912705 - Show ... synthetase OS=Acinetobacter s... 31 2.7 sp|P21463|TSH R_RAT Thyrotropin receptor OS=Rattus norvegicus GN= ... LSGATPVEKSSDHYFFKLPNFGEYLQKWTRDEGRL 208 >sp|P21463|TSH R_RAT Thyrotropin receptor OS=Rattus norvegicus GN= ...

  7. AcEST: BP914637 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000061_C03 544 Adiantum capillus-veneris mRNA. clone: YMU001_000061_C03. BP914637 CL3941C ... ted protein kinase kinase ki... 37 0.076 sp|P30530|UFO _HUMAN Tyrosine-protein kinase receptor UFO ... OS=Homo ... ty protein kinase shkD OS=Dic... 35 0.17 sp|Q00993|UFO _MOUSE Tyrosine-protein kinase receptor UFO ... OS=Mus ...

  8. AcEST: BP920880 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000142_H02 586 Adiantum capillus-veneris mRNA. clone: YMU001_000142_H02. BP920880 CL1687C ... s clausii (strain ... 30 6.7 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy -associated protein 5 OS=Hom... 30 6.7 sp|Q6L8H2|KR ...

  9. AcEST: BP918456 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F11 456 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F11. BP918456 CL2911C ... ase 1, chloroplas... 59 1e-08 sp|P08955|PYR1_MESAU CAD ... protein OS=Mesocricetus auratus GN=CAD ... ... 52 9e-0 ... 7 sp|P27708|PYR1_HUMAN CAD ... protein OS=Homo sapiens GN=CAD ... PE=1 SV=3 52 9e-07 ...

  10. AcEST: BP917985 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_C02 472 Adiantum capillus-veneris mRNA. clone: YMU001_000108_C02. BP917985 - Show ... protein 2 OS=Mus mu... 30 4.2 sp|Q91437|PYR1_SQUAC CAD ... protein OS=Squalus acanthias GN=CAD ... PE=... 30 5.3 ... QQMHGKMAPLKSHVPCTEKPGKVQE 41 >sp|Q91437|PYR1_SQUAC CAD ... protein OS=Squalus acanthias GN=CAD ... PE=2 SV=1 Leng ...

  11. AcEST: BP918790 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_E04 390 Adiantum capillus-veneris mRNA. clone: YMU001_000117_E04. BP918790 CL2249C ... lus GN=Fbln1 PE=1 SV=2 29 6.4 sp|A9MQH4|CAIT_SALAR L-carnitine /gamma-butyrobetaine antiporter ... 29 6.4 sp|P1159 ...

  12. AcEST: BP914039 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B11 577 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B11. BP914039 CL791Co ... ipase C1786.02 OS=Schi... 30 6.7 sp|Q4WZL8|PFA3_ASPFU ... Palmitoyltransferase pfa3 OS=Aspergillus fu ... 30 ... 42 EIQALIQNGFVATTQDNSTDFASC 565 >sp|Q4WZL8|PFA3_ASPFU ... Palmitoyltransferase pfa3 OS=Aspergillus fu migatus ...

  13. AcEST: BP918656 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_A07 524 Adiantum capillus-veneris mRNA. clone: YMU001_000116_A07. BP918656 - Show ... A3 OS=Gibberella zea... 82 2e-15 sp|Q4WZL8|PFA3_ASPFU ... Palmitoyltransferase pfa3 OS=Aspergillus fu ... 81 ... rase At5g04270 OS=Ar... 78 2e-14 sp|Q4WC37|PFA4_ASPFU ... Palmitoyltransferase pfa4 OS=Aspergillus fu ... 78 ...

  14. AcEST: BP913762 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000035_A02 346 Adiantum capillus-veneris mRNA. clone: YMU001_000035_A02. BP913762 CL3933C ... lone id YMU001_000035_A02 Library YMU01 Length 346 Def inition Adiantum capillus-veneris mRNA. clone: YMU0 ... ink to BlastX Result : Swiss-Prot sp_hit_id P17847 Def inition sp|P17847|NIR_MAIZE Ferredoxin--nitrite red ...

  15. AcEST: BP916373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_A04 508 Adiantum capillus-veneris mRNA. clone: YMU001_000087_A04. BP916373 - Show ... protein 1 OS=Homo sa... 30 5.0 sp|P28049|LAB_XENLA Lupus ... La protein homolog B OS=Xenopus laevis... 30 5.0 s ... IGRLSKTGSESSGSVGSSTGSLSHI 424 >sp|P28049|LAB_XENLA Lupus ... La protein homolog B OS=Xenopus laevis GN=ssb-B PE ...

  16. AcEST: BP912711 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A06 502 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A06. BP912711 - Show ... myces cerevisiae GN... 49 1e-05 sp|P05455|LA_HUMAN Lupus ... La protein OS=Homo sapiens GN=SSB PE=1 ... 48 3e-0 ... 5 sp|P10881|LA_BOVIN Lupus ... La protein homolog OS=Bos taurus GN=SSB... 48 3e-0 ...

  17. AcEST: BP920100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_A04 617 Adiantum capillus-veneris mRNA. clone: YMU001_000133_A04. BP920100 CL3619C ... 2 OS=Saccharomyc... 39 0.028 sp|O43719|HTSF1_HUMAN HIV ... Tat-specific factor 1 OS=Homo sapiens ... 38 0.037 ... sp|Q5RB63|HTSF1_PONAB HIV ... Tat-specific factor 1 homolog OS=Pongo... 37 0.062 ...

  18. AcEST: BP914722 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000062_B09 193 Adiantum capillus-veneris mRNA. clone: YMU001_000062_B09. BP914722 CL6Cont ... one Score E Sequences producing significant alignments : (bits) Value sp|P06183|PSBR_SOLTU Photosystem II ... DEWSPSGDVYVGGTTGLAIWAVTLVGILAGGALLV 130 Query: 13 YNTS ... 2 YNTS ... Sbjct: 131 YNTS ... 134 >sp|Q40163|PSBR_SOLLC P ...

  19. AcEST: BP912638 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000021_B11 535 Adiantum capillus-veneris mRNA. clone: YMU001_000021_B11. BP912638 - Show ... ns GN=CPD P... 30 5.7 sp|Q8I5D2|ABRA_PLAF7 101 kDa malaria ... antigen OS=Plasmodium falci... 30 5.7 sp|Q0WQ91|WP ...

  20. AcEST: BP917650 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000103_G02 441 Adiantum capillus-veneris mRNA. clone: YMU001_000103_G02. BP917650 CL1320C ... 27914|POLG_DEN2T Genome polyprotein (Fragments) OS=Dengue ... vi... 32 0.90 sp|Q9WDA6|POLG_DEN2Q Genome polyprot ... ein OS=Dengue ... virus type 2 (... 32 0.90 sp|P12823|POLG_DEN2P Gen ...

  1. AcEST: BP912991 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_B07 477 Adiantum capillus-veneris mRNA. clone: YMU001_000025_B07. BP912991 CL54Con ... 27914|POLG_DEN2T Genome polyprotein (Fragments) OS=Dengue ... vi... 35 0.16 sp|Q9WDA6|POLG_DEN2Q Genome polyprot ... ein OS=Dengue ... virus type 2 (... 35 0.16 sp|P12823|POLG_DEN2P Gen ...

  2. AcEST: BP911510 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000005_G09 573 Adiantum capillus-veneris mRNA. clone: YMU001_000005_G09. BP911510 CL1320C ... 27914|POLG_DEN2T Genome polyprotein (Fragments) OS=Dengue ... vi... 32 1.7 sp|Q9WDA6|POLG_DEN2Q Genome polyprote ... in OS=Dengue ... virus type 2 (... 32 1.7 sp|P12823|POLG_DEN2P Geno ...

  3. AcEST: BP918919 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000119_A06 291 Adiantum capillus-veneris mRNA. clone: YMU001_000119_A06. BP918919 CL1729C ... p|P54891|RDRP_ACLSA RNA-directed RNA polymerase OS=Apple ... chloro... 30 4.8 sp|O06719|GERPC_BACSU Probable sp ... p|P54891|RDRP_ACLSA RNA-directed RNA polymerase OS=Apple ... chlorotic leaf spot virus (isolate apple ) PE=4 SV= ...

  4. AcEST: BP920407 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_G03 558 Adiantum capillus-veneris mRNA. clone: YMU001_000136_G03. BP920407 CL1355C ... SKMVGFALKAAEILEKEGISAEVINLRSIRPLDRP 270 Query: 542 TIN QS 556 TIN ... S Sbjct: 271 TIN AS 275 >sp|Q38799|ODPB_A ... SKMVGFALKAAEKLAEEGISAEVINLRSIRPLDRA 280 Query: 542 TIN QS 556 TIN ... S Sbjct: 281 TIN AS 285 >sp|O44451|ODPB_C ...

  5. AcEST: BP914328 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F09 454 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F09. BP914328 - Show ... rame = +1 Query: 16 MSPSTPL----NTNSPL*ITLEKIGSLALSLSIP HLKPYNSLYINNPSSYIPDCDIAYYH 183 +SP PL + +P +T E+IGS ... LS SIP ... Y S + P P + Sbjct: 94 LSPHDPLLQIKTSQTPTALTFERIGSAV ... LSTSIP QSSTYRSAQESAPHLLQPQFSLLPSA 153 Query: 184 EGLIWCPHQ ... rame = +1 Query: 16 MSPSTPL----NTNSPL*ITLEKIGSLALSLSIP HLKPYNSLYINNPSSYIPDCDIAYYH 183 +SP PL + +P +T E+IGS ...

  6. AcEST: BP914984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_B08 530 Adiantum capillus-veneris mRNA. clone: YMU001_000065_B08. BP914984 - Show ... bosyltransferase OS=Dro... 59 1e-08 sp|Q95XX1|PNCB_CAE EL Nicotinate phosphoribosyltransferase OS=Cae ... 5 ... NPTPYKVAVSDNLYNFIHDLWLQNAPIGEL 554 >sp|Q95XX1|PNCB_CAE EL Nicotinate phosphoribosyltransferase OS=Cae norha ...

  7. AcEST: BP914341 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_G12 448 Adiantum capillus-veneris mRNA. clone: YMU001_000057_G12. BP914341 - Show ... synthase component 1 OS=... 32 1.2 sp|O01811|MEC6_CAE EL Mechanosensory abnormality protein 6 OS=Cae ... 3 ... CGSIGYLSFCGNMDSSITIRTLTAWQGHLY 418 >sp|O01811|MEC6_CAE EL Mechanosensory abnormality protein 6 OS=Cae norha ...

  8. AcEST: BP913413 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000030_A02 464 Adiantum capillus-veneris mRNA. clone: YMU001_000030_A02. BP913413 - Show ... erized protein YKR047W OS... 29 8.7 sp|Q10130|DHS5_CAE EL Uncharacterized oxidoreductase dhs-5 OS=Cae ... 2 ... SLHTY----MYIHIYIYICMYTYVYKYMNTV 34 >sp|Q10130|DHS5_CAE EL Uncharacterized oxidoreductase dhs-5 OS=Cae norha ...

  9. AcEST: BP917848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000106_C10 380 Adiantum capillus-veneris mRNA. clone: YMU001_000106_C10. BP917848 - Show ... tein U88 OS=Human herpesv... 29 8.2 sp|Q95XX1|PNCB_CAE EL Nicotinate phosphoribosyltransferase OS=Cae ... 2 ... bjct: 281 LCVCLCVCLCVCVCVCVCLL 300 >sp|Q95XX1|PNCB_CAE EL Nicotinate phosphoribosyltransferase OS=Cae norha ...

  10. AcEST: BP917921 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000107_D03 261 Adiantum capillus-veneris mRNA. clone: YMU001_000107_D03. BP917921 CL1539C ... mys nipponensis akazara P... 30 4.8 sp|Q93971|TRPG_CAE EL Transient receptor potential channel OS=Cae ... 2 ... Query: 13 NAR 5 R Sbjct: 96 RQR 98 >sp|Q93971|TRPG_CAE EL Transient receptor potential channel OS=Cae norha ...

  11. AcEST: BP914643 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000061_C09 434 Adiantum capillus-veneris mRNA. clone: YMU001_000061_C09. BP914643 - Show ... -dehydrogenase 12 OS=Xeno... 29 6.6 sp|Q10938|YWS2_CAE EL Putative zinc finger protein B0310.2 OS=Cae ... 2 ... 7 FWYLGVVAAVWWGLRAAWCLLDGARVWVL 45 >sp|Q10938|YWS2_CAE EL Putative zinc finger protein B0310.2 OS=Cae norha ...

  12. AcEST: BP918829 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_A02 523 Adiantum capillus-veneris mRNA. clone: YMU001_000118_A02. BP918829 - Show ... galactosyltransferase 13... 35 0.21 sp|Q9N491|SQV2_CAE EL Beta-1,3-galactosyltransferase sqv-2 OS=Cae ... 3 ... 44 RVVHKRCNEGEEAL 303 VH+ C EG+ L Sbjct: 375 ARVHRACAE GDTPL 388 >sp|Q9SAA4|B3GT1_ARATH Probable beta-1,3- ...

  13. AcEST: BP911435 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000005_A01 558 Adiantum capillus-veneris mRNA. clone: YMU001_000005_A01. BP911435 CL2030C ... yme E1 regulatory subun... 39 0.017 sp|Q17820|SAE1_CAE EL SUMO-activating enzyme subunit aos-1 OS=Cae ... 3 ... ier-activating enzyme 7... 38 0.029 sp|Q18217|ULA1_CAE EL NEDD8-activating enzyme E1 regulatory subun... 3 ...

  14. AcEST: BP914710 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000062_A08 437 Adiantum capillus-veneris mRNA. clone: YMU001_000062_A08. BP914710 - Show ... 9.8 sp|Q5WQY5|POLS_CHIKN Structural polyprotein OS=Chikungunya ... virus... 29 9.8 sp|Q9LX93|ATL5F_ARATH RING-H2 fing ...

  15. AcEST: BP913301 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_G05 482 Adiantum capillus-veneris mRNA. clone: YMU001_000028_G05. BP913301 - Show ... =Dictyostelium discoideum GN=x... 30 5.7 sp|Q9YGN1|SAND _FUGRU Protein SAND ... OS=Fugu rubripes GN=sand ... PE=3 . ... SPYCF---QLLSILVENCRPEYLDLFRPILPIIFN 691 >sp|Q9YGN1|SAND _FUGRU Protein SAND ... OS=Fugu rubripes GN=sand ... PE=3 S ...

  16. AcEST: BP919806 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D04 576 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D04. BP919806 - Show ... osyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole -4-carboxamide isomerase, chloroplastic OS=Arabidop ... -phosphoribosylam... 40 0.008 sp|Q9RDX2|HIS6_LEGPN Imidazole ... glycerol phosphate synthase subun... 39 0.014 sp|Q ...

  17. AcEST: BP917586 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000102_G04 457 Adiantum capillus-veneris mRNA. clone: YMU001_000102_G04. BP917586 CL2755C ... 59200|DPO1_STRR6 DNA polymerase I OS=Streptococcus pneumonia ... 78 9e-17 sp|P59199|DPO1_STRPN DNA polymerase I ... OS=Streptococcus pneumonia ... 78 9e-17 sp|Q9S1G2|DPO1_RHILE DNA polymerase I ...

  18. AcEST: BP921028 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_F12 528 Adiantum capillus-veneris mRNA. clone: YMU001_000144_F12. BP921028 - Show ... d protein kinase homolog NT... 120 4e-27 sp|Q06060|MAP K_PEA Mitogen-activated protein kinase homolog D5 O ... ++ Sbjct: 370 LTEEQMKELIYREGLAFNPEY 390 >sp|Q06060|MAP K_PEA Mitogen-activated protein kinase homolog D5 O ...

  19. AcEST: BP914061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP914061 CL1730C ... d Q6A085 Definition sp|Q6A085|ZN629_MOUSE Zinc finger p rotein 629 OS=Mus musculus Align length 29 Score ( ... ments: (bits) Value sp|Q6A085|ZN629_MOUSE Zinc finger p rotein 629 OS=Mus musculus GN... 40 0.007 sp|Q3MJ6 ... ing pro... 40 0.012 sp|Q9UEG4|ZN629_HUMAN Zinc finger p rotein 629 OS=Homo sapiens GN... 40 0.012 sp|Q5R4K ... 8|ZN615_PONAB Zinc finger p rotein 615 OS=Pongo abelii GN... 39 0.026 sp|Q8N8J ...

  20. AcEST: BP921243 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_D06 610 Adiantum capillus-veneris mRNA. clone: YMU001_000147_D06. BP921243 CL1730C ... d Q6A085 Definition sp|Q6A085|ZN629_MOUSE Zinc finger p rotein 629 OS=Mus musculus Align length 29 Score ( ... ments: (bits) Value sp|Q6A085|ZN629_MOUSE Zinc finger p rotein 629 OS=Mus musculus GN... 40 0.007 sp|O7546 ... 7|Z324A_HUMAN Zinc finger p rotein 324A OS=Homo sapiens G... 40 0.009 sp|Q3MJ6 ... ing pro... 40 0.012 sp|Q9UEG4|ZN629_HUMAN Zinc finger p rotein 629 OS=Homo sapiens GN... 40 0.012 sp|Q5R4K ...

  1. AcEST: BP917573 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000102_E11 336 Adiantum capillus-veneris mRNA. clone: YMU001_000102_E11. BP917573 CL2782C ... e N-methyltransferas... 31 2.2 sp|Q02777|THA_RANCA Thyroid ... hormone receptor alpha OS=Rana cates... 30 2.9 sp| ... S=Mus musculus GN=F... 30 3.8 sp|P18115|THAB_XENLA Thyroid ... hormone receptor alpha-B OS=Xenopus... 29 6.4 sp|P ... 15204|THAA_XENLA Thyroid ... hormone receptor alpha-A OS=Xenopus... 29 6.4 sp|Q ... SPRDRRHHDYRRSPSYSEWSPHDRS 453 >sp|Q02777|THA_RANCA Thyroid ... hormone receptor alpha OS=Rana catesbeiana GN=thra ...

  2. AcEST: BP918058 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_B05 341 Adiantum capillus-veneris mRNA. clone: YMU001_000109_B05. BP918058 CL2782C ... erase OS=Photobact... 33 0.44 sp|P18115|THAB_XENLA Thyroid ... hormone receptor alpha-B OS=Xenopus... 33 0.58 sp| ... P15204|THAA_XENLA Thyroid ... hormone receptor alpha-A OS=Xenopus... 33 0.58 sp| ... ferase OS=Haemophil... 32 0.75 sp|Q02777|THA_RANCA Thyroid ... hormone receptor alpha OS=Rana cates... 32 0.98 sp ... IHNLRYYQRLMASIRSAIEEDRFD 355 >sp|P18115|THAB_XENLA Thyroid ... hormone receptor alpha-B OS=Xenopus laevis GN=thra ...

  3. AcEST: BP921073 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000145_C07 432 Adiantum capillus-veneris mRNA. clone: YMU001_000145_C07. BP921073 CL1749C ... ot sp_hit_id P0C6B8 Definition sp|P0C6B8|SVEP1_RAT Sushi , von Willebrand factor type A, EGF and pentraxin d ... icant alignments: (bits) Value sp|P0C6B8|SVEP1_RAT Sushi , von Willebrand factor type A, EGF and... 30 4.2 s ... OS=Mus musculus G... 30 5.5 sp|A2AVA0|SVEP1_MOUSE Sushi , von Willebrand factor type A, EGF a... 29 7.1 sp| ... rase OS=Chlamydia p... 29 9.3 >sp|P0C6B8|SVEP1_RAT Sushi , von Willebrand factor type A, EGF and pentraxin d ...

  4. AcEST: BP918431 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D08 339 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D08. BP918431 CL1749C ... ot sp_hit_id P0C6B8 Definition sp|P0C6B8|SVEP1_RAT Sushi , von Willebrand factor type A, EGF and pentraxin d ... icant alignments: (bits) Value sp|P0C6B8|SVEP1_RAT Sushi , von Willebrand factor type A, EGF and... 30 3.8 s ... OS=Mus musculus G... 30 4.9 sp|A2AVA0|SVEP1_MOUSE Sushi , von Willebrand factor type A, EGF a... 29 6.4 sp| ... rase OS=Chlamydia p... 29 8.4 >sp|P0C6B8|SVEP1_RAT Sushi , von Willebrand factor type A, EGF and pentraxin d ...

  5. AcEST: BP915214 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_H04 339 Adiantum capillus-veneris mRNA. clone: YMU001_000067_H04. BP915214 - Show ... y 6 group A member ... 32 1.3 sp|A8ALR3|CAIT_CITK8 L-carnitine /gamma-butyrobetaine antiporter ... 30 3.8 sp|P2376 ... A OS=Akkermansia mu... 30 4.9 sp|A9MQH4|CAIT_SALAR L-carnitine /gamma-butyrobetaine antiporter ... 30 4.9 sp|Q8XA3 ... 0|CAIT_ECO57 L-carnitine /gamma-butyrobetaine antiporter ... 30 4.9 sp|P1767 ... LLPPQARSLDP--QSYSLIHQLVS 258 >sp|A8ALR3|CAIT_CITK8 L-carnitine /gamma-butyrobetaine antiporter OS=Citrobacter kose ...

  6. AcEST: BP921244 [AcEST

    Lifescience Database Archive (English)

    Full Text Available s ... 30 6.7 sp|Q9SAD4|ESR1_ARATH Ethylene-responsive transcription factor ES... 30 6.7 sp|Q15751|HERC1_HUMA...neris mRNA. clone: YMU001_000147_D07. Accession BP921244 Tissue type prothallium Developmental stage ...3BAI2|YCX91_PHAAO Uncharacterized protein ORF91 OS=Phalaenop... 43 8e-04 sp|A0LUZ1|LEXA_ACIC1 LexA repressor...8 sp|O69979|LEXA_STRCO LexA repressor OS=Streptomyces coelicolor G... 31 2.3 sp|Q4U0G1|CLAP1_XENLA CLIP-associating pr...in-2 OS=Mus musculus GN=Ucn2 PE=2 SV=1 30 6.7 sp|Q82KE0|LEXA_STRAW LexA repressor OS=Streptomyces avermitili

  7. AcEST: BP916732 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000090_H07 559 Adiantum capillus-veneris mRNA. clone: YMU001_000090_H07. BP916732 - Show ... efinition sp|Q766C3|NEP1_NEPGR Aspartic proteinase nepenthes in-1 OS=Nepenthes ... gracilis Align length 65 Score (b ... ts) Value sp|Q766C3|NEP1_NEPGR Aspartic proteinase nepenthes in-1 OS=Nepent... 69 2e-11 sp|Q766C2|NEP2_NEPGR Asp ... artic proteinase nepenthes in-2 OS=Nepent... 65 2e-10 sp|P16228|CATE_RAT Cathe ... 46 1e-04 sp|P69476|NEP1_NEPDI Aspartic proteinase nepenthes in-1 (Fragment... 46 1e-04 sp|Q689Z7|PEPC_MONDO Gas ...

  8. AcEST: BP914149 [AcEST

    Lifescience Database Archive (English)

    Full Text Available on sp|Q5RDI0|SRBD1_PONAB S1 RNA-binding domain-containing protein 1 OS=Pongo abelii Align length 74 Score (b...is mRNA. clone: YMU001_000042_E02. Accession BP914149 Tissue type prothallium Developmental stage - Contig ID - Sequen...bits) Value sp|Q5RDI0|SRBD1_PONAB S1 RNA-binding domain-containing protein 1... 32 1.3 sp|Q8N5C6|SRBD1_HUMAN S1 RNA-binding domai...n-containing protein 1... 32 1.3 sp|P53118|ROG1_YEAST Putati...=Capsella ... 30 4.8 sp|Q497V5|SRBD1_MOUSE S1 RNA-binding domain-containing protein 1... 30 4.8 sp|Q66J97|R1

  9. Accumulation of rare earth elements by siderophore-forming Arthrobacter luteolus isolated from rare earth environment of Chavara, India

    Indian Academy of Sciences (India)

    E S Challaraj Emmanuel; T Ananthi; B Anandkumar; S Maruthamuthu

    2012-03-01

    In this study, Arthrobacter luteolus, isolated from rare earth environment of Chavara (Quilon district, Kerala, India), were found to produce catechol-type siderophores. The bacterial strain accumulated rare earth elements such as samarium and scandium. The siderophores may play a role in the accumulation of rare earth elements. Catecholate siderophore and low-molecular-weight organic acids were found to be present in experiments with Arthrobacter luteolus. The influence of siderophore on the accumulation of rare earth elements by bacteria has been extensively discussed.

  10. Impact of phenolic substrate and growth temperature on the arthrobacter chlorophenolicus proteome

    Energy Technology Data Exchange (ETDEWEB)

    Unell, Maria; Abraham, Paul E.; Shah, Manesh; Zhang, Bing; Ruckert, Christian; VerBerkmoes, Nathan C.; Jansson, Janet K.

    2009-02-15

    We compared the Arthrobacter chlorophenolicus proteome during growth on 4-chlorophenol, 4-nitrophenol or phenol at 5 C and 28 C; both for the wild type and a mutant strain with mass spectrometry based proteomics. A label free workflow employing spectral counting identified 3749 proteins across all growth conditions, representing over 70% of the predicted genome and 739 of these proteins form the core proteome. Statistically significant differences were found in the proteomes of cells grown under different conditions including differentiation of hundreds of unknown proteins. The 4-chlorophenol-degradation pathway was confirmed, but not that for phenol.

  11. Impact of Phenolic Substrate and Growth Temperature on the Arthrobacter chlorophenolicus Proteome

    Energy Technology Data Exchange (ETDEWEB)

    Unell, Maria [Swedish University of Agricultural Sciences, Upsalla, Sweden; Abraham, Paul E [ORNL; Shah, Manesh B [ORNL; Zhang, B [Vanderbilt University; Ruckert, Christian [Bielefeld University, Center for Biotechnology, Bielefeld, Germany; Verberkmoes, Nathan C [ORNL; Jansson, J [Swedish University of Agricultural Sciences, Upsalla, Sweden

    2009-01-01

    We compared the Arthrobacter chlorophenolicus proteome during growth on 4-chlorophenol, 4-nitrophenol, or phenol at 5 and 28 C, both for the wild-type and a mutant strain with mass spectrometry based proteomics. A label-free workflow employing spectral counting identified 3749 proteins across all growth conditions, representing over 70% of the predicted genome and 739 of these proteins form the core proteome. Statistically significant differences were found in the proteomes of cells grown under different conditions including differentiation of hundreds of unknown proteins. The 4-chlorophenol- degradation pathway was confirmed, but not that for phenol.

  12. AcEST: BP912676 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000021_F03 491 Adiantum capillus-veneris mRNA. clone: YMU001_000021_F03. BP912676 CL1449C ... ) OS=T... 42 4e-10 sp|P29736|MYRA_SINAL Myrosinase MA1 ... OS=Sinapis alba PE=1 SV=2 45 2e-09 sp|Q9H227|GBA3_ ... FGDRVKHWITLNE 194 >sp|P29736|MYRA_SINAL Myrosinase MA1 ... OS=Sinapis alba PE=1 SV=2 Length = 501 Score = 44. ...

  13. AcEST: BP916571 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000089_B07 541 Adiantum capillus-veneris mRNA. clone: YMU001_000089_B07. BP916571 CL1449C ... =TGG1 ... 42 5e-09 sp|P29736|MYRA_SINAL Myrosinase MA1 ... OS=Sinapis alba PE=1 SV=2 45 9e-09 sp|Q6UWM7|LCTL_ ... LFGDRVKNWITIN 204 >sp|P29736|MYRA_SINAL Myrosinase MA1 ... OS=Sinapis alba PE=1 SV=2 Length = 501 Score = 44. ...

  14. AcEST: BP917548 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000102_C05 138 Adiantum capillus-veneris mRNA. clone: YMU001_000102_C05. BP917548 CL1449C ... tima G... 35 0.088 sp|P29736|MYRA_SINAL Myrosinase MA1 ... OS=Sinapis alba PE=1 SV=2 35 0.15 sp|P26204|BGLS_T ... ITPFVTIYHWDLP 125 >sp|P29736|MYRA_SINAL Myrosinase MA1 ... OS=Sinapis alba PE=1 SV=2 Length = 501 Score = 34. ...

  15. AcEST: BP914161 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_F06 562 Adiantum capillus-veneris mRNA. clone: YMU001_000042_F06. BP914161 CL1395C ... 3W OS... 30 6.2 sp|P91620|SIF2_DROME Protein still life , isoforms C/SIF type 2 O... 30 6.3 sp|P91621|SIF1_ ... DROME Protein still life , isoform SIF type 1 OS=D... 30 6.3 sp|Q9BYE3|LCE3D ...

  16. AcEST: BP911864 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000010_B05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000010_B05. BP911864 CL1521C ... ponica ... 33 0.65 sp|P19814|TGON3_RAT Trans-Golgi network ... integral membrane protei... 33 0.85 sp|P0C6U4|R1A_ ... SQDSKREGLSDSP 242 >sp|P19814|TGON3_RAT Trans-Golgi network ... integral membrane protein TGN38 OS=Rattus norvegic ...

  17. AcEST: BP914443 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A02 529 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A02. BP914443 CL1901C ... .2 sp|Q6FRM1|AMN1_CANGA Antagonist of mitotic exit network ... protein ... 30 9.2 sp|P18168|SERR_DROME Serrate pr ... 3 >sp|Q6FRM1|AMN1_CANGA Antagonist of mitotic exit network ... protein 1 OS=Candida glabrata GN=AMN1 PE=3 SV=1 Le ...

  18. AcEST: BP913132 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000026_G12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000026_G12. BP913132 - Show ... i GN=... 33 0.63 sp|Q06304|AERA_AERSO Aerolysin OS=Aeromonas ... sobria GN=asa1 PE=3 ... 32 1.1 sp|Q08676|AERA_AERS ... A Aerolysin OS=Aeromonas ... salmonicida GN=ash3 ... 32 1.1 sp|Q54DK4|AK1_DICDI ...

  19. AcEST: BP913634 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_E02 560 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E02. BP913634 CL1411C ... Definition sp|A4SPA7|GLPK_AERS4 Glycerol kinase OS=Aeromonas ... salmonicida (strain A449) Align length 36 Score (b ... its) Value sp|A4SPA7|GLPK_AERS4 Glycerol kinase OS=Aeromonas ... salmonicida (s... 33 1.2 sp|A0KIT3|GLPK_AERHH Glyc ...

  20. AcEST: BP918912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_H10 522 Adiantum capillus-veneris mRNA. clone: YMU001_000118_H10. BP918912 CL3622C ... li... 46 1e-04 sp|Q67WR2|FCL1_ORYSJ Probable GDP-L-fucose ... synthase 1 OS=Oryza s... 45 2e-04 sp|Q67WR5|FCL2_O ... RYSJ Putative GDP-L-fucose ... synthase 2 OS=Oryza s... 45 2e-04 sp|Q9LMU0|FCL2_A ...

  1. AcEST: BP921707 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000153_B12 380 Adiantum capillus-veneris mRNA. clone: YMU001_000153_B12. BP921707 CL2322C ... nit BPTF O... 33 0.57 sp|Q9Y7N7|NAR1_SCHPO Nuclear architecture -related protein 1 OS=S... 31 2.2 sp|Q94HW3|DRL11_A ... FTLEEKQRLEKIKLE 1211 >sp|Q9Y7N7|NAR1_SCHPO Nuclear architecture -related protein 1 OS=Schizosaccharomyces pombe GN= ...

  2. AcEST: BP920643 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_F07 503 Adiantum capillus-veneris mRNA. clone: YMU001_000139_F07. BP920643 CL2246C ... fh5 ... 43 7e-04 sp|Q29JQ0|RETM_DROPS Protein real-time ... OS=Drosophila pseudoobscu... 43 7e-04 sp|Q7PWB1|RE ... TM_ANOGA Protein real-time ... OS=Anopheles gambiae GN=r... 43 7e-04 sp|Q16KN5|RE ...

  3. AcEST: BP916206 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_E08 501 Adiantum capillus-veneris mRNA. clone: YMU001_000084_E08. BP916206 CL1472C ... enorha... 32 1.6 sp|Q7PWB1|RETM_ANOGA Protein real-time ... OS=Anopheles gambiae GN=r... 32 2.1 sp|Q16KN5|RETM ... _AEDAE Protein real-time ... OS=Aedes aegypti GN=retm ... 32 2.1 sp|Q8R0F9|S14L ...

  4. AcEST: BP920931 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000143_E06 526 Adiantum capillus-veneris mRNA. clone: YMU001_000143_E06. BP920931 CL3107C ... sp_hit_id Q8BGC0 Definition sp|Q8BGC0|HTSF1_MOUSE HIV ... Tat-specific factor 1 homolog OS=Mus musculus Alig ... ant alignments: (bits) Value sp|Q8BGC0|HTSF1_MOUSE HIV ... Tat-specific factor 1 homolog OS=Mus m... 101 2e-2 ...

  5. AcEST: BP912216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E04 523 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E04. BP912216 CL2496C ... 9.0 sp|Q3UJU9|RMD3_MOUSE Regulator of microtubule dynamics ... protein 3... 30 9.1 >sp|Q50028|PUR1_MYCLE Amidopho ... 34 >sp|Q3UJU9|RMD3_MOUSE Regulator of microtubule dynamics ... protein 3 OS=Mus musculus GN=Fam82a2 PE=1 SV=2 Len ...

  6. AcEST: BP918413 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C01 528 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C01. BP918413 - Show ... =Geobac... 33 1.1 sp|Q94131|PIE1_CAEEL Pharynx and intestine ... in excess protein 1 O... 32 1.4 sp|A5UY94|PDXS_ROS ... 2 NAVSIPVMAKV 82 >sp|Q94131|PIE1_CAEEL Pharynx and intestine ... in excess protein 1 OS=Caenorhabditis elegans GN=p ...

  7. AcEST: BP914946 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000064_G01 546 Adiantum capillus-veneris mRNA. clone: YMU001_000064_G01. BP914946 CL3840C ... M1 Definition sp|Q5NCM1|S17A4_MOUSE Putative small intestine ... sodium-dependent phosphate transport protein OS=Mu ... (bits) Value sp|Q5NCM1|S17A4_MOUSE Putative small intestine ... sodium-dependent ... 37 0.081 sp|Q8BV57|SRCRL_MOUS ...

  8. AcEST: BP913251 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_B10 514 Adiantum capillus-veneris mRNA. clone: YMU001_000028_B10. BP913251 CL3840C ... M1 Definition sp|Q5NCM1|S17A4_MOUSE Putative small intestine ... sodium-dependent phosphate transport protein OS=Mu ... (bits) Value sp|Q5NCM1|S17A4_MOUSE Putative small intestine ... sodium-dependent ... 32 1.3 sp|Q8BV57|SRCRL_MOUSE ...

  9. AcEST: BP916005 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_G11 469 Adiantum capillus-veneris mRNA. clone: YMU001_000081_G11. BP916005 - Show ... 30 4.1 sp|P14337|POLG_DEN28 Genome polyprotein OS=Dengue ... virus type 2 (... 30 6.8 sp|Q1XH17|TRI72_MOUSE Tri ... FGL 79 >sp|P14337|POLG_DEN28 Genome polyprotein OS=Dengue ... virus type 2 (isolate Thailand/0168/1979) PE=1 SV= ...

  10. AcEST: BP915094 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000066_D10 488 Adiantum capillus-veneris mRNA. clone: YMU001_000066_D10. BP915094 CL722Co ... 29 9.9 sp|Q2YHF0|POLG_DEN4T Genome polyprotein OS=Dengue ... virus type 4 (... 29 9.9 sp|Q5UCB8|POLG_DEN4S Geno ... me polyprotein OS=Dengue ... virus type 4 (... 29 9.9 sp|Q58HT7|POLG_DEN4P Geno ...

  11. AcEST: BP919273 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000123_B10 497 Adiantum capillus-veneris mRNA. clone: YMU001_000123_B10. BP919273 - Show ... 31 2.8 sp|P17763|POLG_DEN1W Genome polyprotein OS=Dengue ... virus type 1 (... 31 3.6 sp|P33478|POLG_DEN1S Geno ... me polyprotein OS=Dengue ... virus type 1 (... 31 3.6 sp|P27909|POLG_DEN1B Geno ...

  12. AcEST: BP913572 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000031_G04 459 Adiantum capillus-veneris mRNA. clone: YMU001_000031_G04. BP913572 CL397Co ... sp|P0C423|LEP4_AERSA Type 4 prepilin-like proteins leader ... peptide-processing enzyme OS=Aeromonas salmonicida ... sp|P0C423|LEP4_AERSA Type 4 prepilin-like proteins leader ... peptid... 30 3.8 sp|A2T195|LEP4_AERS4 Type 4 prepi ...

  13. AcEST: BP915944 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_G12 455 Adiantum capillus-veneris mRNA. clone: YMU001_000079_G12. BP915944 CL3650C ... apiens GN=... 38 0.024 sp|Q9VGX3|FAU_DROME Protein anoxia ... up-regulated OS=Drosophila me... 36 0.069 sp|Q8WR6 ... AALEEAQR---AQGI 1620 >sp|Q9VGX3|FAU_DROME Protein anoxia ... up-regulated OS=Drosophila melanogaster GN=fau PE= ...

  14. AcEST: BP918766 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_C04 505 Adiantum capillus-veneris mRNA. clone: YMU001_000117_C04. BP918766 CL3650C ... P250 OS=Mu... 37 0.053 sp|Q9VGX3|FAU_DROME Protein anoxia ... up-regulated OS=Drosophila me... 36 0.090 sp|Q8WR6 ... 4 + Sbjct: 874 L 874 >sp|Q9VGX3|FAU_DROME Protein anoxia ... up-regulated OS=Drosophila melanogaster GN=fau PE= ...

  15. AcEST: BP921416 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000149_F04 459 Adiantum capillus-veneris mRNA. clone: YMU001_000149_F04. BP921416 - Show ... n ... 30 6.6 sp|Q9Q0U7|NRAM_I96A0 Neuraminidase OS=Influenza ... A virus (strain ... 29 8.6 sp|P06819|NRAM_I73A0 Ne ... uraminidase OS=Influenza ... A virus (strain ... 29 8.6 sp|Q710U6|NRAM_I59A0 Ne ...

  16. AcEST: BP919673 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_G10 404 Adiantum capillus-veneris mRNA. clone: YMU001_000127_G10. BP919673 CL2196C ... c ... 31 2.2 sp|P26135|HEMA_I74A2 Hemagglutinin OS=Influenza ... A virus (strain ... 31 2.2 sp|P26141|HEMA_I84A5 He ... magglutinin OS=Influenza ... A virus (strain ... 30 3.7 sp|P12586|HEMA_I82A6 He ...

  17. AcEST: BP912750 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_E01 440 Adiantum capillus-veneris mRNA. clone: YMU001_000022_E01. BP912750 - Show ... ... 32 0.88 sp|P26102|HEMA_I76AL Hemagglutinin OS=Influenza ... A virus (strain ... 31 2.6 sp|P26099|HEMA_I73A4 He ... magglutinin OS=Influenza ... A virus (strain ... 30 3.4 sp|P26095|HEMA_I73A1 He ...

  18. AcEST: BP912581 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_E11 490 Adiantum capillus-veneris mRNA. clone: YMU001_000020_E11. BP912581 - Show ... 30 6.9 sp|A6T691|LIPB_KLEP7 Octanoyltransferase OS=Klebsiella ... pneumonia... 29 9.1 >sp|P03594|ORF2A_BMV RNA-direc ... T 189 >sp|A6T691|LIPB_KLEP7 Octanoyltransferase OS=Klebsiella ... pneumoniae subsp. pneumoniae (strain ATCC 700721 / ...

  19. AcEST: BP914281 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ylation element-binding... 35 0.30 sp|P24788|CD2L1_MOUSE PITSLRE serine/threonine-pr...ylation element-binding protein 1 OS=Caenorhabditis japonica GN=cpb-1 PE=2 SV=1 Lengt...eris mRNA. clone: YMU001_000057_B07. Accession BP914281 Tissue type prothallium Developmental stage - Contig ID CL4075Cont...Q12967|GNDS_HUMAN Ral guanine nucleotide dissociation stimula... 32 1.5 sp|Q62504|MINT_MOUSE Msx2-int...23 >sp|Q12967|GNDS_HUMAN Ral guanine nucleotide dissociation stimulator OS=Homo sapien

  20. AcEST: BP914285 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_B11 341 Adiantum capillus-veneris mRNA. clone: YMU001_000057_B11. BP914285 - Show ... 29 8.3 sp|Q6PLS1|POLG_ASGVK Genome polyprotein OS=Apple ... stem grooving v... 29 8.3 sp|P44416|OAPB_HAEIN Opa ... ST 624 >sp|Q6PLS1|POLG_ASGVK Genome polyprotein OS=Apple ... stem grooving virus (strain Korea) PE=3 SV=1 Lengt ...

  1. AcEST: BP917622 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000103_C09 498 Adiantum capillus-veneris mRNA. clone: YMU001_000103_C09. BP917622 CL1552C ... 31 3.7 sp|Q6PLS1|POLG_ASGVK Genome polyprotein OS=Apple ... stem grooving v... 30 8.2 sp|Q06FL4|CEMA_PELHO Chl ... V 1722 >sp|Q6PLS1|POLG_ASGVK Genome polyprotein OS=Apple ... stem grooving virus (strain Korea) PE=3 SV=1 Lengt ...

  2. AcEST: BP920913 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000143_C08 485 Adiantum capillus-veneris mRNA. clone: YMU001_000143_C08. BP920913 - Show ... 4F8 Definition sp|Q9H4F8|SMOC1_HUMAN SPARC-related modular ... calcium-binding protein 1 OS=Homo sapiens Align le ... : (bits) Value sp|Q9H4F8|SMOC1_HUMAN SPARC-related modular ... calcium-binding prot... 33 0.59 sp|Q9STK5|PP269_AR ...

  3. AcEST: BP918323 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B08 445 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B08. BP918323 - Show ... ia pe... 30 3.5 sp|Q9UTK5|ALM1_SCHPO Abnormal long morphology ... protein 1 OS=Schiz... 30 3.5 sp|Q29527|C11B1_PAPHU ... LYYLRSLSGK 106 >sp|Q9UTK5|ALM1_SCHPO Abnormal long morphology ... protein 1 OS=Schizosaccharomyces pombe GN=alm1 PE= ...

  4. AcEST: BP914973 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_A09 648 Adiantum capillus-veneris mRNA. clone: YMU001_000065_A09. BP914973 CL884Co ... ens G... 33 1.3 sp|Q9UTK5|ALM1_SCHPO Abnormal long morphology ... protein 1 OS=Schiz... 33 1.3 sp|Q9ES03|TBX20_MOUSE ... EKSPDLQS 1386 >sp|Q9UTK5|ALM1_SCHPO Abnormal long morphology ... protein 1 OS=Schizosaccharomyces pombe GN=alm1 PE= ...

  5. AcEST: BP920073 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_F12 533 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F12. BP920073 - Show ... e, mitochondrial OS=Mus... 70 6e-12 sp|O45228|PROD_CAE EL Proline dehydrogenase, mitochondrial OS=Cae ... 7 ... Chrysomya bezziana PE=2 SV=1 30 7.3 sp|P34554|YNP1_CAE EL Uncharacterized protein T05G5.1 OS=Cae norha... 3 ... jct: 466 SSIMKGAQRERQLLWQELRRR 486 >sp|O45228|PROD_CAE EL Proline dehydrogenase, mitochondrial OS=Cae norha ...

  6. AcEST: BP918333 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C07 551 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C07. BP918333 - Show ... ein mutL OS=Bactero... 32 2.7 sp|Q3YV10|BTUB_SHISS Vitamin ... B12 transporter btuB OS=Shigella so... 32 2.7 sp|Q ... 83IS4|BTUB_SHIFL Vitamin ... B12 transporter btuB OS=Shigella fl... 32 2.7 sp|Q ...

  7. AcEST: BP914623 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000061_B01 465 Adiantum capillus-veneris mRNA. clone: YMU001_000061_B01. BP914623 CL2520C ... d Q863Y7 Definition sp|Q863Y7|PEVRA_PIG Endogenous retrovirus ... A receptor OS=Sus scrofa Align length 46 Score (bi ... ments: (bits) Value sp|Q863Y7|PEVRA_PIG Endogenous retrovirus ... A receptor OS=Sus scro... 31 2.1 sp|Q863Y8|PEVR2_P ...

  8. AcEST: BP913368 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_E02 560 Adiantum capillus-veneris mRNA. clone: YMU001_000029_E02. BP913368 CL2735C ... KLK7 Definition sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor ... kinase/phosphatase luxQ OS=Vibrio cholerae Align l ... s: (bits) Value sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor ... kinase/phosphatase lux... 45 1e-11 sp|Q87GU5|LUXQ_ ...

  9. AcEST: BP915090 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000066_D05 492 Adiantum capillus-veneris mRNA. clone: YMU001_000066_D05. BP915090 - Show ... LN1 O... 30 6.0 sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor ... kinase/phosphatase lux... 30 6.0 sp|Q8D5Z6|LUXQ_VI ... BVU Autoinducer 2 sensor ... kinase/phosphatase lux... 30 6.0 sp|P48027|GACS_PS ...

  10. AcEST: BP915170 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_D02 442 Adiantum capillus-veneris mRNA. clone: YMU001_000067_D02. BP915170 - Show ... 4.4 sp|Q8JUX5|POLS_CHIKS Structural polyprotein OS=Chikungunya ... virus... 30 4.5 sp|Q68FU0|TM174_RAT Transmembrane ... 44 >sp|Q8JUX5|POLS_CHIKS Structural polyprotein OS=Chikungunya ... virus (strain S27-African prototype) PE=3 SV=2 Len ...

  11. AcEST: BP919536 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_C03 457 Adiantum capillus-veneris mRNA. clone: YMU001_000126_C03. BP919536 - Show ... ewa... 30 4.9 sp|Q94KE2|TIC_ARATH Protein TIME FOR COFFEE ... OS=Arabidopsis thali... 30 6.4 sp|Q8BUH8|SENP7_MOU ... DEVTDEQL 177 >sp|Q94KE2|TIC_ARATH Protein TIME FOR COFFEE ... OS=Arabidopsis thaliana GN=TIC PE=1 SV=2 Length = ...

  12. AcEST: BP911660 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000007_F08 517 Adiantum capillus-veneris mRNA. clone: YMU001_000007_F08. BP911660 CL4247C ... GN=cut... 30 6.8 sp|Q7X7A9|FB4_ARATH F-box protein At1g11270 ... OS=Arabidopsis thali... 30 8.8 >sp|Q9GL59|VKGC_SHE ... -EKTRRMFCTPS 95 >sp|Q7X7A9|FB4_ARATH F-box protein At1g11270 ... OS=Arabidopsis thaliana GN=At1g11270 ... PE=1 SV=1 Len ...

  13. AcEST: BP914317 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_E10 478 Adiantum capillus-veneris mRNA. clone: YMU001_000057_E10. BP914317 - Show ... : Swiss-Prot sp_hit_id P00228 Definition sp|P00228|FER _WHEAT Fer redoxin, chloroplastic OS=Triticum aestiv ... value 2.0e-25 Report BLASTX 2.2.19 [Nov-02-2008] Refer ence: Altschul, Stephen F., Thomas L. Madden, Aleja ... ndro A. Schaffer , Jinghui Zhang, Zheng Zhang, Webb Miller, and Davi ... ing significant alignments: (bits) Value sp|P00228|FER _WHEAT Fer redoxin, chloroplastic OS=Triticum aestiv ...

  14. AcEST: BP915504 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_D08 571 Adiantum capillus-veneris mRNA. clone: YMU001_000072_D08. BP915504 - Show ... : Swiss-Prot sp_hit_id P00228 Definition sp|P00228|FER _WHEAT Fer redoxin, chloroplastic OS=Triticum aestiv ... value 2.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] Refer ence: Altschul, Stephen F., Thomas L. Madden, Aleja ... ndro A. Schaffer , Jinghui Zhang, Zheng Zhang, Webb Miller, and Davi ... ing significant alignments: (bits) Value sp|P00228|FER _WHEAT Fer redoxin, chloroplastic OS=Triticum aestiv ...

  15. AcEST: BP919119 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_D11 308 Adiantum capillus-veneris mRNA. clone: YMU001_000121_D11. BP919119 - Show ... 6 sp|P28604|NODQ_AZOBR Bifunctional enzyme nodQ OS=Azospirillum ... br... 31 2.2 sp|Q6AEW2|SYL_LEIXX Leucyl-tRNA synth ... >sp|P28604|NODQ_AZOBR Bifunctional enzyme nodQ OS=Azospirillum ... brasilense GN=nodQ PE=3 SV=2 Length = 620 Score = ...

  16. Epitope Mapping of the Brucella melitensis BP26 Immunogenic Protein: Usefulness for Diagnosis of Sheep Brucellosis

    OpenAIRE

    Seco-Mediavilla, Patricia; Verger, Jean-Michel; Grayon, Maggy; Cloeckaert, Axel; Marín, Clara M.; Zygmunt, Michel S; Fernández-Lago, Luis; Vizcaíno, Nieves

    2003-01-01

    Sequencing of bp26, the gene encoding the Brucella sp. immunogenic BP26 periplasmic protein, was performed in the reference strains of Brucella abortus, B. suis, and B. ovis. The three bp26 sequences were almost identical to that published for B. melitensis 16M bp26, and only minor nucleotide substitutions, without modifying the amino acid sequence, were observed between species. The bp26 genes of the seven B. abortus biovar reference strains and B. abortus S19 and RB51 vaccine strains were a...

  17. AcEST: BP913994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_F09 463 Adiantum capillus-veneris mRNA. clone: YMU001_000038_F09. BP913994 - Show ... ) Frame = -1 Query: 454 MAFSSDLQLLHYLPARLYALPLSSRVVPSG RLPLSATEPETT*MCLF 314 M FSS L+ LP L+ LS R +PSG ... S T+ ... CLF Sbjct: 752 MTFSSHHNLVSILPTLLFVENLSFRRIPSG SSITSLLLAYTSLHCLF 798 >sp|Q9LGU7|SPL1_ORYSJ Squamos ...

  18. AcEST: BP921723 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000153_D05 567 Adiantum capillus-veneris mRNA. clone: YMU001_000153_D05. BP921723 CL9Cont ... NGDAGFVKMIPTKPMTVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG ... 519 NGDAGFVKMIPTKPM VETFS YPPLGRFAVRDMRQTVAVGVIK+V ... EKKDPSG ... Sbjct: 384 NGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVA ... VGVIKSVEKKDPSG ... 436 >sp|O24534|EF1A_VICFA Elongation factor 1-alph ... NGDAGFVKMIPTKPMTVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG ... 519 NGDAG VKMIPTKPM VETF+EYPPLGRFAVRDMRQTVAVGVIK+V ...

  19. AcEST: BP918637 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_G07 487 Adiantum capillus-veneris mRNA. clone: YMU001_000115_G07. BP918637 - Show ... itives = 19/31 (61%) Frame = +2 Query: 377 ALNARQNQPSG FATIPAQSVAIGTGQTLRIL 469 A+ A +N PSG ... AT P V +GQT+ I ... L Sbjct: 300 AVAAAENMPSG QATRPGDIVTTMSGQTVEIL 330 >sp|Q9VTH4|SCLLA_DROME Pro ...

  20. AcEST: BP916133 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_E07 447 Adiantum capillus-veneris mRNA. clone: YMU001_000083_E07. BP916133 CL2729C ... Query: 81 ILRACSSFAKLHNYYITLQVSLPHSLIAFHTHT------NPSG KVLNIYST 215 +L CS + Y ++ LPHS + FHT+ +PSG ... VL ST Sb ... jct: 24 LLATCSLDKTIRLYSLSDFAELPHSPLKFHTYAVHCCSFSPSG HVLASCST 74 >sp|O60146|YNSG_SCHPO Uncharacterized t ...

  1. AcEST: BP915989 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_E06 446 Adiantum capillus-veneris mRNA. clone: YMU001_000081_E06. BP915989 - Show ... es = 16/26 (61%) Frame = +3 Query: 288 CTKQNYSCCWAKPSG HARTANSSACK 365 CTK SCC PSG ... ++ A+ ACK Sbjct: 25 CTK ... CKKSCCECCPSG CSKCASGCACK 50 >sp|A6NGA9|TM202_HUMAN Transmembrane ...

  2. AcEST: BP917928 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000107_D11 515 Adiantum capillus-veneris mRNA. clone: YMU001_000107_D11. BP917928 - Show ... MMLA-SQMLTGILLAMHYVGHVDYAFASVQHL 68 Query: 263 LCDLPSG LLIKHSRRGDACIY 201 + D+PSG ++++++ A ++ Sbjct: 69 MTD ... VPSG MILRYAHANGASLF 89 >sp|Q9UNH5|CC14A_HUMAN Dual speci ...

  3. AcEST: BP920349 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_B01 612 Adiantum capillus-veneris mRNA. clone: YMU001_000136_B01. BP920349 CL3163C ... chloride-dependent neutral and... 30 7.5 sp|P12625|PHB _BURPI Poly(3-hydroxybutyrate) depolymerase OS=Burk ...

  4. AcEST: BP912077 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_G08 536 Adiantum capillus-veneris mRNA. clone: YMU001_000012_G08. BP912077 CL1409C ... 3|CLPB_DEIRA Chaperone protein clpB OS=Deinococcus radio ... 96 1e-19 sp|Q8CQ88|CLPC_STAES ATP-dependent Clp ...

  5. AcEST: BP916051 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000082_E02 454 Adiantum capillus-veneris mRNA. clone: YMU001_000082_E02. BP916051 - Show ... 2|DNAJ_DEIRA Chaperone protein dnaJ OS=Deinococcus radio ... 36 0.090 sp|A1TLH8|DNAJ_ACIAC Chaperone protein ...

  6. AcEST: BP915522 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_F02 506 Adiantum capillus-veneris mRNA. clone: YMU001_000072_F02. BP915522 - Show ... 3|CLPB_DEIRA Chaperone protein clpB OS=Deinococcus radio ... 155 8e-38 sp|Q8RHQ8|CLPB_FUSNN Chaperone protei ...

  7. AcEST: BP920430 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_A03 306 Adiantum capillus-veneris mRNA. clone: YMU001_000137_A03. BP920430 - Show ... 7|DNAK_KINRD Chaperone protein dnaK OS=Kineococcus radio ... 67 2e-11 sp|Q0VST6|DNAK_ALCBS Chaperone protein ...

  8. AcEST: BP914795 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_A01 460 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A01. BP914795 - Show ... 0%), Positives = 17/26 (65%) Frame = +2 Query: 281 TSH TQSLEKTRFFPLILHGMGMFMFL 358 TSH ... Q EKTR + L+ G+ +F F ... L Sbjct: 703 TSH DQIKEKTRIYVLLFVGLAIFSFL 728 >sp|Q823A6|SURE1_CHLCV ...

  9. AcEST: BP917445 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_H08 374 Adiantum capillus-veneris mRNA. clone: YMU001_000100_H08. BP917445 - Show ... n-19 OS=Homo sapiens GN=SNX19 ... 30 2.8 sp|P22265|TSH _DROME Protein teashirt OS=Drosophila melanogaster ...

  10. AcEST: BP916106 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_C01 494 Adiantum capillus-veneris mRNA. clone: YMU001_000083_C01. BP916106 - Show ... ositives = 16/26 (61%) Frame = +1 Query: 37 CLLSIEKTSH TRSRQKAKHQQTPSLL 114 C +S+ TSH + Q K QTPSLL Sbjct: 6 ... 16 CTVSVHSTSH SPPNQNVKSNQTPSLL 641 >sp|Q8CNG6|URTF_STAES Probable ...

  11. AcEST: BP917097 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_H02 451 Adiantum capillus-veneris mRNA. clone: YMU001_000095_H02. BP917097 CL2350C ... ine-protein kinase pknD OS=Pro... 30 3.7 sp|Q556J9|SURF1 _DICDI SURF1 -like protein OS=Dictyostelium discoi.. ...

  12. AcEST: BP919397 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_F07 453 Adiantum capillus-veneris mRNA. clone: YMU001_000124_F07. BP919397 - Show ... NRFEKPDEW 1158 Query: 235 AIHK 224 I K Sbjct: 1159 RISK ... 1162 >sp|Q01804|OTUD4_HUMAN OTU domain-containing ...

  13. EST Table: BP122736 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP122736 epV30177 10/09/28 69 %/169 aa sp|P14296.1|ARYA_MANSE RecName: Full=Arylpho...rylphorin alpha subunit precursor [Manduca sexta] 10/08/29 35 %/167 aa FBpp0072365|Lsp1gamma-PA 10/08/28 n.h

  14. AcEST: BP915457 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_G07 574 Adiantum capillus-veneris mRNA. clone: YMU001_000071_G07. BP915457 - Show ... S=Homo sapiens GN=CEP110 PE=1 ... 31 3.8 sp|Q29L39|POE _DROPS Protein purity of essence OS=Drosophila pseu ...

  15. AcEST: BP917914 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000107_C05 484 Adiantum capillus-veneris mRNA. clone: YMU001_000107_C05. BP917914 CL730Co ... one Score E Sequences producing significant alignments : (bits) Value sp|Q6P5D4|CP135_MOUSE Centrosomal pr ... /59 (52%) Frame = -3 Query: 332 QIMDIIKEYETQLETLREANTS DDAEINVIEADLAASQRMLCRYGISEDMSLLDKEILE 156 Q+ + EYET ...

  16. AcEST: BP915444 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_F04 584 Adiantum capillus-veneris mRNA. clone: YMU001_000071_F04. BP915444 CL730Co ... one Score E Sequences producing significant alignments : (bits) Value sp|Q6P5D4|CP135_MOUSE Centrosomal pr ... /59 (52%) Frame = -2 Query: 331 QIMDVIKEYETQLETLREANTS DDAEINVIEADLAASQRMLCRYGISEDMSLLDKEILE 155 Q+ + EYET ...

  17. AcEST: BP919238 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_G07 478 Adiantum capillus-veneris mRNA. clone: YMU001_000122_G07. BP919238 - Show ... 24|ECOT3_LEIBR Ecotin-like protein 3 OS=Leishmania brazil ... 35 0.18 sp|A7TSJ7|YPI1_VANPO Type 1 phosphatase ...

  18. AcEST: BP918237 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_B04 457 Adiantum capillus-veneris mRNA. clone: YMU001_000111_B04. BP918237 CL1747C ... ives = 31/37 (83%) Frame = -1 Query: 454 RKGCTPGQLALAW LQHQGKDVAPIPGTTKQKNLEENV 344 RKGCTP QLALAW + HQG DV ... PIPGTTK +NL +N+ Sbjct: 265 RKGCTPSQLALAW VHHQGNDVCPIPGTTKIENLNQNM 301 >sp|Q09923|YAKC_SCHPO ...

  19. AcEST: BP918316 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B01 479 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B01. BP918316 CL1887C ... -LPRFQAENLENNKNL 255 Query: 300 YERIANLAKKHVCTPGQLALAW VLRQGDDVVPIPGTTKAKYFDENV 163 YERI +A + CTP QLALAW V ... QG+DV PIPGTTK + ++N+ Sbjct: 256 YERICEMAVRKGCTPSQLALAW VHHQGNDVCPIPGTTKIENLNQNM 301 >sp|Q09923|YAKC_SCHPO ...

  20. AcEST: BP912493 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_B06 132 Adiantum capillus-veneris mRNA. clone: YMU001_000019_B06. BP912493 CL66Con ... 31/37 (83%) Frame = -3 Query: 130 KPAEKEIIIDVPLASRLAW RGFIWPLAAISELRNGKL 20 KP +KEIIIDVPLA++LAW +G WPLAA+ ... EL+ G L Sbjct: 179 KPTDKEIIIDVPLATKLAW QGAGWPLAAVQELQRGTL 215 >sp|Q9SHE8|PSAF_ARATH Photos ...

  1. AcEST: BP915460 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_G12 435 Adiantum capillus-veneris mRNA. clone: YMU001_000071_G12. BP915460 - Show ... ssociated factor 1 homol... 29 6.3 sp|O17580|NOC2L_CAE EL Nucleolar complex protein 2 homolog OS=Cae ... 29 ...

  2. AcEST: BP917315 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000099_C07 517 Adiantum capillus-veneris mRNA. clone: YMU001_000099_C07. BP917315 CL4086C ... olymerase subunit beta' O... 30 6.7 sp|Q18195|ELP4_CAE EL Putative elongator complex protein 4 OS=Cae ... 3 ...

  3. AcEST: BP917984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_C01 515 Adiantum capillus-veneris mRNA. clone: YMU001_000108_C01. BP917984 CL4086C ... olymerase subunit beta' O... 30 6.7 sp|Q18195|ELP4_CAE EL Putative elongator complex protein 4 OS=Cae ... 3 ...

  4. AcEST: BP917942 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000107_F05 280 Adiantum capillus-veneris mRNA. clone: YMU001_000107_F05. BP917942 - Show ... in 230 OS=Homo sapiens GN... 30 3.7 sp|P34422|DPF6_CAE EL Dipeptidyl peptidase family member 6 OS=Cae ... 3 ...

  5. AcEST: BP921461 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000150_C01 333 Adiantum capillus-veneris mRNA. clone: YMU001_000150_C01. BP921461 - Show ... -1 Query: 123 GKTNPVYDDLIHKMVIG-ELDAVVGDITVTAERLSLVDFT QP 1 G TNP Y++L++K+ G + DAVVGDI + +R +VDFT QP Sbjct: ... 519 GLTNPNYNELVNKVTTGVDFDAVVGDIAIVTKRTRIVDFT QP 560 >sp|Q9SHV1|GLR22_ARATH Glutamate receptor 2. ...

  6. AcEST: BP917478 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_C11 359 Adiantum capillus-veneris mRNA. clone: YMU001_000101_C11. BP917478 - Show ... WLVCLDDRFGLAHQI-RTKQCRLYSLGLGSDDTHFE 192 Query: 41 NASA ... 30 + A Sbjct: 193 VSMA 196 >sp|P74466|CLPR_SYNY3 P ...

  7. AcEST: BP920632 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_E06 377 Adiantum capillus-veneris mRNA. clone: YMU001_000139_E06. BP920632 CL1431C ... KU5|MURI_LACJO Glutamate racemase OS=Lactobacillus johnson ... 31 2.2 sp|O35071|KIF1C_MOUSE Kinesin-like prote ...

  8. AcEST: BP916496 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000088_C12 509 Adiantum capillus-veneris mRNA. clone: YMU001_000088_C12. BP916496 CL1802C ... 83_ROSS1 Bacterial peptide chain release factor 1 (BRF -1) OS=Roseiflexus sp. (strain RS-1) GN=RoseRS_2868 ...

  9. AcEST: BP915480 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_B05 510 Adiantum capillus-veneris mRNA. clone: YMU001_000072_B05. BP915480 CL4026C ... itives = 16/24 (66%) Frame = +2 Query: 32 HMRLHDSLPTLC KAPPAKVHVSTR 103 HM+ HD L TLC + + +HV TR Sbjct: 3549 ... HMQQHDILDTLC RTIESTIHVVTR 3572 >sp|Q70CQ2|UBP34_HUMAN Ubiquitin ...

  10. AcEST: BP915705 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000074_G11 518 Adiantum capillus-veneris mRNA. clone: YMU001_000074_G11. BP915705 - Show ... K6|DNAJ_SHEAM Chaperone protein dnaJ OS=Shewanella amazon ... 56 1e-07 sp|A9KG87|DNAJ_COXBN Chaperone protein ...

  11. AcEST: BP920545 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000138_D08 495 Adiantum capillus-veneris mRNA. clone: YMU001_000138_D08. BP920545 CL4202C ... 64|HTPG_SHEAM Chaperone protein htpG OS=Shewanella amazon ... 32 1.2 sp|Q8CK02|GLNE_STRCO Glutamate-ammonia-l ...

  12. AcEST: BP920452 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_C05 516 Adiantum capillus-veneris mRNA. clone: YMU001_000137_C05. BP920452 - Show ... 41|HSP83_LEIAM Heat shock protein 83 OS=Leishmania amazon ... 30 5.1 sp|Q0I0F1|HSLO_SHESR 33 kDa chaperonin O ...

  13. AcEST: BP918395 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A05 328 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A05. BP918395 - Show ... son gag domain-containing prot... 29 8.4 sp|P16827|HEPA _HCMVA DNA helicase/primase complex-associated pro. ...

  14. AcEST: BP917805 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_F08 490 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F08. BP917805 - Show ... otein NPR1 OS=Arabidopsis thal... 30 7.8 sp|P19021|AMD _HUMAN Peptidyl-glycine alpha-amidating monooxygena ...

  15. AcEST: BP919685 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H10 544 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H10. BP919685 - Show ... LKEYLLSGDLLEAERCLQELEVPH 356 Query: 93 LNAVFIKRLIMSAMD ... 49 + + I+ ++ Sbjct: 357 FHHELVYEAIVMVLE 371 >sp|Q6 ... 4 EEVTKFKHKAVNIIQEYFYANDIGEVIRSLEDLAAPALNAVFIKRLIMSAMD RKYRARRH 25 EE + K KA II+EY + ND+ E ++ +++LA+P+L +F ...

  16. AcEST: BP920885 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0885 - Show BP920885 Clone id YMU001_000143_A01 Library YMU01 Length 93 Definition Adiantum capillus-veneris...iss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - ...nce too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  17. AcEST: BP915869 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5869 - Show BP915869 Clone id YMU001_000078_G08 Library YMU01 Length 92 Definition Adiantum capillus-veneris...ss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - R...ce too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  18. AcEST: BP916227 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6227 - Show BP916227 Clone id YMU001_000084_G08 Library YMU01 Length 97 Definition Adiantum capillus-veneris...: Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-valu...equence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  19. AcEST: BP912142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2142 - Show BP912142 Clone id YMU001_000015_F01 Library YMU01 Length 97 Definition Adiantum capillus-veneris...: Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-valu...equence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  20. AcEST: BP921019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1019 - Show BP921019 Clone id YMU001_000144_F01 Library YMU01 Length 95 Definition Adiantum capillus-veneris...Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value ...uence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  1. AcEST: BP914335 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_G05 537 Adiantum capillus-veneris mRNA. clone: YMU001_000057_G05. BP914335 - Show ... CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus gue ... 43 9e-04 sp|Q07E15|CTTB2_MUSPF Cortactin-bindin ...

  2. AcEST: BP919931 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_G11 521 Adiantum capillus-veneris mRNA. clone: YMU001_000130_G11. BP919931 CL1249C ... CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus gue ... 31 4.0 sp|Q2IBA2|CTTB2_CERAE Cortactin-binding ...

  3. AcEST: BP920061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E12 538 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E12. BP920061 CL291Co ... CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus gue ... 31 3.1 sp|Q09YG9|CTTB2_SAIBB Cortactin-binding ...

  4. AcEST: BP917788 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SGE 2454 >sp|Q14690|RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=...14690|RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDC... 30 7.1 sp|A4IQA2|ENGA_GEOTN GTP-binding prot...YMU001_000105_D12 596 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D12. BP9...17788 CL1546Contig1 Show BP917788 Clone id YMU001_000105_D12 Library YMU01 Length 596 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_D12. Accession BP917788 Tissue type prothallium Developmental stag

  5. AcEST: BP916880 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -like protein mll6452 OS=Rhizobium loti... 30 5.1 sp|Q3HXX9|NGFV2_HOPST Venom nerve growth factor 2 OS=Hoplo...+ +H +S KRL T + EKA Sbjct: 14 PRRIELLQQAGIEPDRILPADIDETPLRAEHPRSLAKRLSTEKAEKA 60 >sp|Q3HXX9|NGFV2_HOPST Venom nerve...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916880|Adiantum capillus-vener...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916880|Adiantum capillus-veneris mRNA, clone...YMU001_000093_B06 515 Adiantum capillus-veneris mRNA. clone: YMU001_000093_B06. BP9

  6. AcEST: BP912946 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912946|Adiantum capillus-ve... E3 ubiquitin-protein ligase C14F5.... 32 2.5 sp|Q21444|COG2_CAEEL Conserved oligomeric Golgi co...+ P +C++ Sbjct: 576 -HKQVVQSFSIFPVFRVCQM 594 >sp|Q21444|COG2_CAEEL Conserved oligomeric Golgi complex subuni...YMU001_000024_F08 599 Adiantum capillus-veneris mRNA. clone: YMU001_000024_F08. BP9...12946 - Show BP912946 Clone id YMU001_000024_F08 Library YMU01 Length 599 Definition Adiantum capillus-veneris mRNA. clone

  7. One-pot conversion of levan prepared from Serratia levanicum NN to difructose anhydride IV by Arthrobacter nicotinovorans levan fructotransferase.

    Science.gov (United States)

    Kikuchi, Hiroto; Sakurai, Hiroaki; Nagura, Taizo; Aritsuka, Tsutomu; Tomita, Fusao; Yokota, Atsushi

    2010-03-01

    The newly established difructose anhydride IV (DFA IV) production system is comprised of the effective production of levan from sucrose by Serratia levanicum NN, the conversion of the levan into DFA IV by levan fructotransferase from Arthrobacter nicotinovorans GS-9, which is highly expressed in an Escherichiacoli transformant, and a practical purification step. The chemical properties of DFA IV were also investigated. PMID:20159571

  8. Transcriptional profiling of Gram-positive Arthrobacter in the phyllosphere: induction of pollutant degradation genes by natural plant phenolic compounds

    NARCIS (Netherlands)

    Scheublin, T.R.; Deusch, S.; Moreno-Forero, S.K.; Müller, J.A.; van der Meer, J.R.; Leveau, J.H.J.

    2014-01-01

    Arthrobacter chlorophenolicus A6 is a Gram-positive, 4-chlorophenol degrading soil bacterium that was recently shown to be an effective colonizer of plant leaf surfaces. The genetic basis for this phyllosphere competency is unknown. In this paper, we describe the genome-wide expression profile of A.

  9. AcEST: BP920928 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ) Value sp|Q87SK0|GLNE_VIBPA Glutamate-ammonia-ligase adenylyltransferas... 32 0.76 sp|Q5SUS0|FBW10_MOUSE F-...20928 - Show BP920928 Clone id YMU001_000143_E03 Library YMU01 Length 333 Definition Adiantum capillus-vener...■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q87SK0 Definition sp|Q87SK0|GLNE_VIBPA Glutamate-am...997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2...box/WD repeat-containing protein 10 OS=M... 29 6.4 >sp|Q87SK0|GLNE_VIBPA Glutamate-am

  10. AcEST: BP914728 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 14728 - Show BP914728 Clone id YMU001_000062_C04 Library YMU01 Length 285 Definition Adiantum capillus-vener...ult : Swiss-Prot sp_hit_id Q00961 Definition sp|Q00961|NMDE3_RAT Glutamate [NMDA] receptor subunit epsilon-3..., Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of prot... Sequences producing significant alignments: (bits) Value sp|Q00961|NMDE3_RAT Glutamate [NMDA] receptor subu...nit epsilon-3 ... 31 2.2 sp|Q01098|NMDE3_MOUSE Glutamate [NMDA] receptor subunit epsilon-... 31 2.2 >sp|Q00961|NMDE3_RAT Glutama

  11. AcEST: BP920290 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_C09 341 Adiantum capillus-veneris mRNA. clone: YMU001_000135_C09. BP920290 - Show ... : Swiss-Prot sp_hit_id Q9U4F3 Definition sp|Q9U4F3|SURF1 _DROME SURF1 -like protein OS=Drosophila melanogaste ... ing significant alignments: (bits) Value sp|Q9U4F3|SURF1 _DROME SURF1 -like protein OS=Drosophila melanogas.. ... . 39 0.006 sp|Q15526|SURF1 _HUMAN Surfeit locus protein 1 OS=Homo sapiens GN.. ... . 33 0.58 sp|Q1RJM4|SURF1 _RICBR SURF1 -like protein OS=Rickettsia bellii (s.. ...

  12. AcEST: BP916792 [AcEST

    Lifescience Database Archive (English)

    Full Text Available KIIFTAPTRPLVAQQIKACLGITG 150 >sp|Q9SAD4|ESR1_ARATH Ethylene-responsive transcription factor ESR1 OS=Arabidopsi...neris mRNA. clone: YMU001_000091_F06. Accession BP916792 Tissue type prothallium Developmental stage ...se MPH1 OS=Candida ... 30 6.5 sp|Q9SAD4|ESR1_ARATH Ethylene-responsive transcription factor ES... 30 6.5 sp|...5B6Y9|A5B6Y9_VITVI Photosystem I P700 chlorophyll A apoprote... 102 9e-21 tr|A4EB58|A4EB58_9ACTN Putative uncharacterized pr...us t... 32 1.0 sp|A0LUZ1|LEXA_ACIC1 LexA repressor OS=Acidothermus cellulolytic... 32 1.0 sp|B1K

  13. AcEST: BP914064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-veneris mRNA, clone...rotein phosphatase V... 32 2.2 sp|Q9QZH6|ECSIT_MOUSE Evolutionarily conserved signaling interme... 31 2.9 sp...|Q5XIC2|ECSIT_RAT Evolutionarily conserved signaling intermedi... 30 5.0 sp|Q9D1H...AVLCLLRWRCLKGPR 1108 >sp|Q9QZH6|ECSIT_MOUSE Evolutionarily conserved signaling intermediate in Toll pathway,... 281 >sp|Q5XIC2|ECSIT_RAT Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial OS=Rattus norve

  14. AcEST: BP912517 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_C08 535 Adiantum capillus-veneris mRNA. clone: YMU001_000019_C08. BP912517 - Show ... : Swiss-Prot sp_hit_id Q29L39 Definition sp|Q29L39|POE _DROPS Protein purity of essence OS=Drosophila pseu ... ing significant alignments: (bits) Value sp|Q29L39|POE _DROPS Protein purity of essence OS=Drosophila pseu ... haracterized protein DDB_G0280... 31 4.3 sp|Q9VLT5|POE _DROME Protein purity of essence OS=Drosophila mela ... ponse protein 2 OS=Sus scrofa... 30 9.7 >sp|Q29L39|POE _DROPS Protein purity of essence OS=Drosophila pseu ...

  15. AcEST: BP915022 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_F01 517 Adiantum capillus-veneris mRNA. clone: YMU001_000065_F01. BP915022 CL4099C ... .0 sp|P0C6T4|R1A_BCHK4 Replicase polyprotein 1a OS=Bat ... coronavirus ... 31 4.0 sp|P0C6F7|R1A_BC133 Replica ... se polyprotein 1a OS=Bat ... coronavirus ... 31 4.0 sp|P0C6W3|R1AB_BCHK4 Replic ... ase polyprotein 1ab OS=Bat ... coronaviru... 31 4.0 sp|P0C6W1|R1AB_BC133 Replicas ... e polyprotein 1ab OS=Bat ... coronaviru... 31 4.0 sp|Q9S3Q5|MQO_PSEFL Probable ...

  16. AcEST: BP920604 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_B08 360 Adiantum capillus-veneris mRNA. clone: YMU001_000139_B08. BP920604 - Show ... 46 sp|P0C6T7|R1A_BCRP3 Replicase polyprotein 1a OS=Bat ... coronavirus ... 35 0.12 sp|P0C6W6|R1AB_BCRP3 Repli ... case polyprotein 1ab OS=Bat ... coronaviru... 35 0.12 sp|P0C6F8|R1A_BCHK3 Replicas ... e polyprotein 1a OS=Bat ... coronavirus ... 33 0.45 sp|P0C6W2|R1AB_BCHK3 Repli ... case polyprotein 1ab OS=Bat ... coronaviru... 33 0.45 sp|Q1IQ76|RECR_ACIBL Recombi ...

  17. AcEST: BP919506 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_H03 387 Adiantum capillus-veneris mRNA. clone: YMU001_000125_H03. BP919506 CL2639C ... SP0|L_ABLVB Large structural protein OS=Australian bat ... lyssavirus (isolate Bat /AUS/1996) Align length 52 ... SP0|L_ABLVB Large structural protein OS=Australian bat ... lys... 31 1.7 sp|Q5KGG4|VPS27_CRYNE Vacuolar prote ... TG9|L_ABLVH Large structural protein OS=Australian bat ... lys... 29 6.5 sp|P41080|GYRA_RICPR DNA gyrase subu ... SP0|L_ABLVB Large structural protein OS=Australian bat ... lyssavirus (isolate Bat /AUS/1996) GN=L PE=3 SV=2 L ...

  18. AcEST: BP911449 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000005_B03 473 Adiantum capillus-veneris mRNA. clone: YMU001_000005_B03. BP911449 - Show ... on sp|P0C6T6|R1A_BCHK9 Replicase polyprotein 1a OS=Bat ... coronavirus HKU9 Align length 41 Score (bit) 30.8 ... ue sp|P0C6T6|R1A_BCHK9 Replicase polyprotein 1a OS=Bat ... coronavirus ... 31 3.2 sp|P0C6W5|R1AB_BCHK9 Replic ... ase polyprotein 1ab OS=Bat ... coronaviru... 31 3.2 sp|Q9Z9G5|PMP1_CHLPN Probable ... 1 >sp|P0C6T6|R1A_BCHK9 Replicase polyprotein 1a OS=Bat ... coronavirus HKU9 GN=1a PE=3 SV=1 Length = 4248 Sco ...

  19. AcEST: BP918750 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_A11 515 Adiantum capillus-veneris mRNA. clone: YMU001_000117_A11. BP918750 CL4099C ... .0 sp|P0C6T4|R1A_BCHK4 Replicase polyprotein 1a OS=Bat ... coronavirus ... 31 3.9 sp|P0C6F7|R1A_BC133 Replica ... se polyprotein 1a OS=Bat ... coronavirus ... 31 3.9 sp|P0C6W3|R1AB_BCHK4 Replic ... ase polyprotein 1ab OS=Bat ... coronaviru... 31 3.9 sp|P0C6W1|R1AB_BC133 Replicas ... e polyprotein 1ab OS=Bat ... coronaviru... 31 3.9 sp|Q9S3Q5|MQO_PSEFL Probable ...

  20. AcEST: BP920099 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_A03 555 Adiantum capillus-veneris mRNA. clone: YMU001_000133_A03. BP920099 CL2639C ... SP0|L_ABLVB Large structural protein OS=Australian bat ... lyssavirus (isolate Bat /AUS/1996) Align length 57 ... SP0|L_ABLVB Large structural protein OS=Australian bat ... lys... 35 0.32 sp|Q8JTG9|L_ABLVH Large structural ... protein OS=Australian bat ... lys... 33 1.2 sp|Q3TT99|GDPD4_MOUSE Glycerophospho ... SP0|L_ABLVB Large structural protein OS=Australian bat ... lyssavirus (isolate Bat /AUS/1996) GN=L PE=3 SV=2 L ...

  1. AcEST: BP913941 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_B03 356 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B03. BP913941 - Show ... n rbsA 1 O... 29 6.5 sp|Q68UT5|MS18A_PANTR Protein Mis 18-alpha OS=Pan troglodytes GN=... 29 6.5 sp|Q9NYP9 ... |MS18A_HUMAN Protein Mis 18-alpha OS=Homo sapiens GN=MIS ... 29 6.5 sp|Q2T8T6 ... RWGTIDRAAMARGCQ 133 >sp|Q68UT5|MS18A_PANTR Protein Mis 18-alpha OS=Pan troglodytes GN=MIS 18A PE=3 SV=1 Len ... -VLETLCCAGCSLNL 147 >sp|Q9NYP9|MS18A_HUMAN Protein Mis 18-alpha OS=Homo sapiens GN=MIS 18A PE=1 SV=1 Length ...

  2. AcEST: BP918402 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B01. BP918402 CL402Co ... ss-Prot sp_hit_id Q09652 Definition sp|Q09652|YS21_CAE EL Uncharacterized GST-like protein ZK1320.1 OS=Cae ... ignificant alignments: (bits) Value sp|Q09652|YS21_CAE EL Uncharacterized GST-like protein ZK1320.1 O... 3 ... lymerase II transcription... 31 3.5 sp|P91428|COQ4_CAE EL Ubiquinone biosynthesis protein coq-4 OS=Ca... 3 ... tein ywbO OS=Bacillus su... 30 7.9 >sp|Q09652|YS21_CAE EL Uncharacterized GST-like protein ZK1320.1 OS=Cae ...

  3. AcEST: BP914236 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000056_F03 511 Adiantum capillus-veneris mRNA. clone: YMU001_000056_F03. BP914236 - Show ... ss-Prot sp_hit_id Q20591 Definition sp|Q20591|VA0E_CAE EL V-type proton ATPase subunit e OS=Cae norhabditis ... ignificant alignments: (bits) Value sp|Q20591|VA0E_CAE EL V-type proton ATPase subunit e OS=Cae norhab... 4 ... aining protein 12 OS=Mus ... 30 6.5 sp|P35449|NHX9_CAE EL Probable Na(+)/H(+) antiporter nhx-9 OS=Cae ... 3 ... 0 6.6 sp|O16452|NHX3_CAE EL Probable Na(+)/H(+) antiporter nhx-3 OS=Cae ... 3 ...

  4. AcEST: BP918348 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D12 438 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D12. BP918348 CL3952C ... : Swiss-Prot sp_hit_id Q9FQY8 Definition sp|Q9FQY8|COMT 1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsi ... ing significant alignments: (bits) Value sp|Q9FQY8|COMT 1_CAPAN Caffeic acid 3-O-methyltransferase OS=Caps. ... methyltransferase OS=Clarkia... 61 2e-09 sp|Q9XGV9|COMT 2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Oc. ... .. 59 7e-09 sp|Q00763|COMT 1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Po. ...

  5. AcEST: BP916139 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_F02 449 Adiantum capillus-veneris mRNA. clone: YMU001_000083_F02. BP916139 CL2906C ... . 30 4.3 sp|P02646|TNNI3_RABIT Troponin I, cardiac muscle ... OS=Oryctolagus ... 29 9.6 sp|P19429|TNNI3_HUMAN Tr ... oponin I, cardiac muscle ... OS=Homo sapiens... 29 9.6 sp|Q863B6|TNNI3_FELCA Tr ... oponin I, cardiac muscle ... OS=Felis silves... 29 9.6 sp|Q8MKD5|TNNI3_CANFA Tr ... oponin I, cardiac muscle ... OS=Canis famili... 29 9.6 sp|P08057|TNNI3_BOVIN Tr ...

  6. AcEST: BP918640 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_G10 498 Adiantum capillus-veneris mRNA. clone: YMU001_000115_G10. BP918640 - Show ... 2.8 sp|Q8JUX5|POLS_CHIKS Structural polyprotein OS=Chikungunya ... virus... 30 6.1 sp|Q5WQY5|POLS_CHIKN Structural po ... lyprotein OS=Chikungunya ... virus... 30 6.1 sp|P49331|GTFD_STRMU Glucosyltrans ... 00 >sp|Q8JUX5|POLS_CHIKS Structural polyprotein OS=Chikungunya ... virus (strain S27-African prototype) PE=3 SV=2 Len ... 68 >sp|Q5WQY5|POLS_CHIKN Structural polyprotein OS=Chikungunya ... virus (strain Nagpur) PE=3 SV=1 Length = 1248 Scor ...

  7. AcEST: BP918980 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2.3 sp|O34607|SDHA_BACSU Probable L-serine dehydratase, alpha chain ... 30 3.0 sp|Q02440|MYO5A_CHICK Myosin...-Va OS=Gallus gallus GN=MYO5A PE=1 SV=1 30 3.9 sp|A7MMD8|RNB_ENTS8 Exoribonuclease 2 OS=Enteroba...LEGLKILSGKIDQCRTIFLNKQPNPRKKLLVPCALDPPNTNCYVCASKPEVTVRLNVH 455 >sp|O34607|SDHA_BACSU Probable L-serine dehyd... 32 +HDP I C L V E +H+LCH+KL Sbjct: 353 KHDPLTIFCDLMGVDYEEMAHWLCHRKL 380 >sp|A7MMD8|RNB_ENTS8 Exoribonuclease 2 OS=Enteroba...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918980|Adiantum

  8. AcEST: BP920559 [AcEST

    Lifescience Database Archive (English)

    Full Text Available se 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q54YG9 Definition sp|Q54YG9|TCEA1_DICDI Transcription elongation factor A pr...= BP920559|Adiantum capillus-veneris mRNA, clone: YMU001_000138_E10. (311 letters) Database: uniprot_sprot.f...............................done Score E Sequences producing significant alignments: (bits) Value sp|Q54YG9|TCEA1_DICDI Transcri...ption elongation factor A protein ... 46 7e-05 sp|Q148K0|TCEA2_BOVIN Transcription elongation factor A pr...otein ... 43 6e-04 sp|Q15560|TCEA2_HUMAN Transcription elongation factor A pr

  9. AcEST: BP915353 [AcEST

    Lifescience Database Archive (English)

    Full Text Available y= BP915353|Adiantum capillus-veneris mRNA, clone: YMU001_000070_E07. (523 letters) Database: uniprot_sprot....07532|IWR1_YEAST Putative transcription factor IWR1 OS=Sacch... 32 2.4 sp|Q5BBK4|ATG13_EMENI Autophagy-related protein 13 OS=Emeri...otein norM OS=Vibrio... 30 5.3 sp|Q9KRU4|NORM_VIBCH Multidrug resistance protein norM OS=Vibrio... 30 5.3 sp...ecific chaperone chz1 OS=As... 30 7.0 sp|Q04870|T2FA_XENLA General transcri...GD----EPYSDEELDEE 361 >sp|Q07532|IWR1_YEAST Putative transcription factor IWR1 OS=Saccharomyces cerevisiae G

  10. AcEST: BP921190 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TCR WRKY3 OS=Petroselinum crispum PE=2 SV=1 148 2e-34 tr|A7QMQ8|A7QMQ8_VITVI Chromosome undetermined scaffol... BP921190|Adiantum capillus-veneris mRNA, clone: YMU001_000146_G05. (296 letters) Database: uniprot_sprot.fa...t (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id O22176 Definition sp|O22176|WRK15_ARATH Probable WRKY transcri...|Q9SI37|WRKY1_ARATH WRKY transcription factor 1 OS=Arabidopsis... 89 5e-18 sp|Q9FLX8|W...actor 20 OS=A... 79 9e-15 sp|Q9C519|WRKY6_ARATH WRKY transcription factor 6 OS=Arabidopsis... 78 1e-14 sp

  11. AcEST: BP921201 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q5RHP9 Definition sp|Q5RHP9|CA173_HUMAN Uncharacterized pr...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921201|Adiantum capillus-veneris...otein FLJ46641 ... 32 1.3 sp|O00268|TAF4_HUMAN Transcription initiation factor TFIID subun... 30 2.9 sp|... CG RAR AQ +GRGG Sbjct: 118 LPGHAGPCGPRARPAQGLAGRGG 140 >sp|O00268|TAF4_HUMAN Transcription initiation facto...otein OS=Brady... 33 9.3 tr|A1YPR7|A1YPR7_PIG Tumor necrosis factor receptor 2 OS=Sus scr... 33 9.3 >tr|Q1DBJ6|Q1DBJ6_MYXXD Transcri

  12. AcEST: BP911734 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ain-containing protein 91 OS=Pongo abelii GN=CCDC91 PE=2 SV=1 Length = 405 Score = 31.6 bits (70), Expect = ...lymerase II p300/CBP-assoc... 48 1e-05 sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-assoc... 46 5e-05 sp|Q5RCA7|CCD91...DSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDY 207 >sp|Q5RCA7|CCD91_PONAB Coiled-coil dom...YMU001_000008_E10 355 Adiantum capillus-veneris mRNA. clone: YMU001_000008_E10. BP91...1734 CL1931Contig1 Show BP911734 Clone id YMU001_000008_E10 Library YMU01 Length 355 Definition Adiantum ca

  13. AcEST: BP919532 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AR1|MADS8_ORYSJ MADS-box transcription factor 8 OS=Oryza s... 32 0.76 sp|Q1RHV1|FENR_RICBR Ferredoxin--NADP reductase OS=Rickettsia...ted muscle OS=Aequipecten irradians PE=1 SV=1 Length = 1938 Score = 32.3 bits (72), Expect = 0.76 Identities = 27/99 (27%), Positi...YMU001_000126_B11 305 Adiantum capillus-veneris CHUP1B mRNA for chloroplast unusual positioning 1B, partia...l cds BP919532 CL3760Contig1 Show BP919532 Clone id YMU001_000126_B11 Library YMU01 Length 305 Definiti...GN=MYH1... 33 0.44 sp|A7HY57|TIG_PARL1 Trigger factor OS=Parvibaculum lavamentivora... 33 0.58 sp|Q0J466|MADS7_ORYSJ MADS-box tran

  14. AcEST: BP915833 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915833|Adiantum capi...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915833|Adia...in cut-like 1 OS=Homo sapiens... 37 0.11 sp|A8L6J3|CNPD_FRASN 2',3'-cyclic-nucleotide 2'-phosphodiestera...beta ... 38 0.048 sp|O76329|ACTNB_DICDI Interaptin OS=Dictyostelium discoideum GN=... 38 0.048 sp|P39880|CUX1_HUMAN Homeobox prote...ntum capillus-veneris mRNA, clone: YMU001_000077_F03. (622 letters) Database: uniprot_sprot

  15. AcEST: BP918399 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |Q8TFG4|YL54_SCHPO Uncharacterized protein PB18E9.04c OS=Schiz... 29 7.8 sp|P58813|APGM_METKA 2,3-bisphosp...|P31362|PO2F3_MOUSE POU domain, class 2, transcription factor ... 30 6.0 sp...KTRVRNRCIFTGRPRSVYKLFRISRIV 81 >sp|P31362|PO2F3_MOUSE POU domain, class 2, transcription factor 3 OS=Mus mus.... Query= BP918399|Adiantum capillus-veneris mRNA, clone: YMU001_000113_A10. (446 letters) Database: unipr...YMU001_000113_A10 464 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A10. BP9

  16. AcEST: BP914783 [AcEST

    Lifescience Database Archive (English)

    Full Text Available subunit alpha-5 OS=Mus musculus GN... 30 5.1 sp|Q9YW29|ETF2_MSEPV Early transcription factor 82 kDa subunit O... 30 6.7 sp... C+C Sbjct: 725 YCEAGSCHPAGLAPANPALPETQAPCMCRAHVEGPSCDRCKPGYWGLSASNPEGCTRCSC 784 >sp|Q9YW29|ETF2_MSEPV Early transcri...402. Query= BP914783|Adiantum capillus-veneris mRNA, clone: YMU001_000062_G12. (463 letters) Database: unipr... OS... 33 7.0 tr|Q7SAU6|Q7SAU6_NEUCR Predicted protein OS=Neurospora crassa GN... 33 7.0 tr|Q6MFW2|Q6MFW2_NE...YMU001_000062_G12 463 Adiantum capillus-veneris mRNA. clone: YMU001_000062_G12. BP9

  17. AcEST: BP913045 [AcEST

    Lifescience Database Archive (English)

    Full Text Available s ... 30 5.0 sp|Q6UXF1|TM108_HUMAN Transmembrane protein 108 OS=Homo sapiens ... 29 6.5 sp|A1S6Z2|HIS8_SHEAM Histidi...nol-phosphate aminotransferase OS=Sh... 29 6.5 sp|Q2HJ75|CL052_BOVIN Uncharacterized...54|P83954_TORCA Postsynaptic membrane protein OS=Torpedo ... 34 4.1 tr|Q91VZ1|Q91VZ1_MOUSE Snx2 protein OS=M...13045 - Show BP913045 Clone id YMU001_000025_G09 Library YMU01 Length 326 Definition Adiantum capillus-vener...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913045|Adiantum capillus-

  18. AcEST: BP921669 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ase OS=Photorhabdus lum... 32 2.3 sp|Q91009|NTRK1_CHICK High affinity nerve growth factor receptor... 31 5.1...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921669|Adiantum capillus-veneris mRNA, clone...y= BP921669|Adiantum capillus-veneris mRNA, clone: YMU001_000152_G06. (579 letters) Database: uniprot_trembl...YMU001_000152_G06 579 Adiantum capillus-veneris mRNA. clone: YMU001_000152_G06. BP9...21669 CL3975Contig1 Show BP921669 Clone id YMU001_000152_G06 Library YMU01 Length 579 Definition Adiantum capillus-vener

  19. AcEST: BP919108 [AcEST

    Lifescience Database Archive (English)

    Full Text Available + Sbjct: 239 LFGIKLPALENAYV 252 >sp|P06440|VP4B_VACCW Major core protein P4b OS=Vaccinia virus (strain Western Reserve...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919108|Adiantum capillus-vener...YMU001_000121_C11 516 Adiantum capillus-veneris mRNA. clone: YMU001_000121_C11. BP9...19108 - Show BP919108 Clone id YMU001_000121_C11 Library YMU01 Length 516 Definition Adiantum capillus-veneris mRNA. clone...y= BP919108|Adiantum capillus-veneris mRNA, clone: YMU001_000121_C11. (516 letters) Database: unipr

  20. AcEST: BP912177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_A09 469 Adiantum capillus-veneris mRNA. clone: YMU001_000016_A09. BP912177 - Show BP912177...is mRNA. clone: YMU001_000016_A09. Accession BP912177 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP912177|Adiantum capillus-veneris mRNA, clone: YMU...rotein 1-3 OS=Homo sapiens GN=KRTAP1-3 PE=2 SV=1 Length = 177 Score = 29.3 bits (64), Expect = 9.1 Identitie... >sp|Q07627|KRA11_HUMAN Keratin-associated protein 1-1 OS=Homo sapiens GN=KRTAP1-1 PE=2 SV=1 Length = 177 Sc

  1. AcEST: BP918618 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_E11 490 Adiantum capillus-veneris mRNA. clone: YMU001_000115_E11. BP918618... CL3774Contig1 Show BP918618 Clone id YMU001_000115_E11 Library YMU01 Length 490 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000115_E11. Accession BP918618 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918618...6WRL0|Y3322_SHEB8 UPF0250 protein Shew185_3322 OS=Shewanella... 32 1.6 sp|A3D7P7|

  2. AcEST: BP918180 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E01 492 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E01. BP91818...0 CL642Contig1 Show BP918180 Clone id YMU001_000110_E01 Library YMU01 Length 492 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000110_E01. Accession BP918180 Tissue type prothallium Developmental stage... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918180|Adiantum capil...otein OS=Bos taurus GN=RRP15 ... 35 0.24 sp|Q8TFG4|YL54_SCHPO Uncharacterized protein PB18E9.04c OS=Schiz...

  3. AcEST: BP918718 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_F12 450 Adiantum capillus-veneris mRNA. clone: YMU001_000116_F12. BP918718 - Show BP918718...is mRNA. clone: YMU001_000116_F12. Accession BP918718 Tissue type prothallium Developmental stage - Contig I...um capillus-veneris Align length 98 Score (bit) 184.0 E-value 2.0e-46 Report BLASTX 2.2.19 [Nov-02-2008] Ref...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918718|Adiantum capillus-veneris ...nificant alignments: (bits) Value sp|Q85FP1|NU2C_ADICA NAD(P)H-quinone oxidoreductase chain 2, chl... 18

  4. AcEST: BP918918 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000119_A05 543 Adiantum capillus-veneris mRNA. clone: YMU001_000119_A05. BP918918 - Show BP918918...is mRNA. clone: YMU001_000119_A05. Accession BP918918 Tissue type prothallium Developmental stage - Contig I...Definition sp|A8ERT9|SYP_ARCB4 Prolyl-tRNA synthetase OS=Arcobacter butzleri (strain RM4018) Align length 62...c Acids Res. 25:3389-3402. Query= BP918918|Adiantum capillus-veneris mRNA, clone: YMU001_000119_A05. (543 le...nthetase OS=Arcobacter butzleri (strain RM4018) GN=proS PE=3 SV=1 Length = 568 Score = 35.8 bits (81), Expec

  5. Identification of a Novel Di-D-Fructofuranose 1,2’:2,3’ Dianhydride (DFA III) Hydrolysis Enzyme from Arthrobacter aurescens SK8.001

    Science.gov (United States)

    Yu, Shuhuai; Wang, Xiao; Zhang, Tao; Stressler, Timo; Fischer, Lutz; Jiang, Bo; Mu, Wanmeng

    2015-01-01

    Previously, a di-D-fructofuranose 1,2’:2,3’ dianhydride (DFA III)-producing strain, Arthrobacter aurescens SK8.001, was isolated from soil, and the gene cloning and characterization of the DFA III-forming enzyme was studied. In this study, a DFA III hydrolysis enzyme (DFA IIIase)-encoding gene was obtained from the same strain, and the DFA IIIase gene was cloned and expressed in Escherichia coli. The SDS-PAGE and gel filtration results indicated that the purified enzyme was a homotrimer holoenzyme of 145 kDa composed of subunits of 49 kDa. The enzyme displayed the highest catalytic activity for DFA III at pH 5.5 and 55°C, with specific activity of 232 U mg-1. Km and Vmax for DFA III were 30.7 ± 4.3 mM and 1.2 ± 0.1 mM min-1, respectively. Interestingly, DFA III-forming enzymes and DFA IIIases are highly homologous in amino acid sequence. The molecular modeling and docking of DFA IIIase were first studied, using DFA III-forming enzyme from Bacillus sp. snu-7 as a template. It was suggested that A. aurescens DFA IIIase shared a similar three-dimensional structure with the reported DFA III-forming enzyme from Bacillus sp. snu-7. Furthermore, their catalytic sites may occupy the same position on the proteins. Based on molecular docking analysis and site-directed mutagenesis, it was shown that D207 and E218 were two potential critical residues for the catalysis of A. aurescens DFA IIIase. PMID:26555784

  6. AcEST: BP918310 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in engA OS=Nitratiruptor s... 30 4.8 sp|Q38419|TEV3_BPR03 Intron-associated endonuclease 3 OS=Ente...is mRNA. clone: YMU001_000112_A07. Accession BP918310 Tissue type prothallium Developmental stage - Contig ID - Sequenc.........................................done Score E Sequences producing significant alignments: (bits) Value ...YEAST Something about silencing protein 10 OS=Saccharomyces cerevisiae GN=SAS10 PE=1 SV=1 Length = 610 Score...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918310|Adiant

  7. AcEST: BP920317 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_F06 423 Adiantum capillus-veneris mRNA. clone: YMU001_000135_F06. BP920317 - Show ... capillus-veneris mRNA. clone: YMU001_000135_F06. Acce ssion BP920317 Tissue type prothallium Developmenta ... SRVEGTYL-PPCCVVSCTPPSC----CQLHHAQASCCRPSYCGQSCCRPVCCCE P 172 Query: 351 T 353 T Sbjct: 173 T 173 >sp|Q921D ... rized protein OS=Cyanothece (strain ATCC 51142) GN=cce _3506 PE=4 SV=1 Length = 275 Score = 33.9 bits (76) ...

  8. EST Table: BP124149 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP124149 epV31958 10/09/28 69 %/169 aa sp|P14296.1|ARYA_MANSE RecName: Full=Arylpho...rylphorin alpha subunit precursor [Manduca sexta] 10/08/29 35 %/167 aa FBpp0072365|Lsp1gamma-PA 10/08/28 n.h...10/09/10 42 %/148 aa gnl|Amel|GB10869-PA 10/09/10 50 %/146 aa gi|270012697|gb|EFA09145.1| hypothetical protein TcasGA2_TC005375 [Tribolium castaneum] BP126555 epV3 ...

  9. EST Table: BP126555 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126555 psV30366 11/12/09 GO hit GO:0005344(oxygen transporter activity)|GO:000681...0(transport) 10/09/28 73 %/168 aa sp|P14296.1|ARYA_MANSE RecName: Full=Arylphorin subunit alpha; Flags: Prec...sor [Manduca sexta] 10/08/29 37 %/184 aa FBpp0073484|Lsp1alpha-PA 10/08/28 n.h 10...GB30362-PA 10/09/10 36 %/167 aa gi|270012699|gb|EFA09147.1| hypothetical protein TcasGA2_TC005377 [Tribolium castaneum] BP126555 psV3 ...

  10. EST Table: BP126508 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126508 psV30291 10/09/28 56 %/172 aa sp|P14296.1|ARYA_MANSE RecName: Full=Arylpho...rylphorin alpha subunit precursor [Manduca sexta] 10/08/29 35 %/109 aa FBpp0073484|Lsp1alpha-PA 10/08/28 n.h... 10/09/10 40 %/103 aa AGAP001345-PA Protein|2R:3362647:3364773:1|gene:AGAP001345 10/09/10 low homology 10/09/10 low homology BP126555 psV3 ...

  11. EST Table: BP123695 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123695 epV31377 10/09/28 73 %/172 aa sp|P14296.1|ARYA_MANSE RecName: Full=Arylpho...rylphorin alpha subunit precursor [Manduca sexta] 10/08/29 39 %/182 aa FBpp0073484|Lsp1alpha-PA 10/08/28 n.h...10/09/10 33 %/159 aa gnl|Amel|GB30362-PA 10/09/10 38 %/171 aa gi|270012699|gb|EFA09147.1| hypothetical protein TcasGA2_TC005377 [Tribolium castaneum] BP126555 epV3 ...

  12. AcEST: BP915680 [AcEST

    Lifescience Database Archive (English)

    Full Text Available jandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997)...eference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Mille...ic Acids Res. 25:3389-3402. Query= BP915680|Adiantum capillus-veneris mRNA, clone: YMU001_000074_E08. (532 le...|Q7YJG1|MATK_ANTLI Maturase K OS=Anthericum liliago GN=matK PE... 30 7.3 >sp|Q55A09|Y9963_DICDI Probable ser... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915680|Adiantum capillus-veneri

  13. AcEST: BP918800 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search pr...997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2...5:3389-3402. Query= BP918800|Adiantum capillus-veneris mRNA, clone: YMU001_000117_F02. (546 letters) Database: uniprot_trembl.fasta...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP918800|Adiantum capillus-veneris mRNA, clone: YMU001_00011...idopsis th... 181 2e-45 sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bak

  14. AcEST: BP919896 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_D10 530 Adiantum capillus-veneris mRNA. clone: YMU001_000130_D10. BP919896 CL11...pillus-veneris mRNA. clone: YMU001_000130_D10. Accession BP919896 Tissue type prothallium Developmental stage - Contig ID CL11...3_ONCMA Cytochrome c oxidase subunit 3 OS=Oncorhync... 171 3e-42 sp|P20684|COX3_ONCCL...72Contig1 Sequence ACCAAACCACGTCCACAAAATACCAGTACCGAGCAGCTGCTTCGAAGCC...AAAGTGATGTA AAGGACTGAAATGGCCCATATATTAACGAATACTGCGTATCATCAAGAGAATAGTTCCTA TAATGACATAGAACCCATAAAACCCAGTAGCTAAAAAAGAAGTAAACCC

  15. AcEST: BP917197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 17197 CL2854Contig1 Show BP917197 Clone id YMU001_000097_E05 Library YMU01 Length 555 Definition Adiantum ca...n (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search program...bidopsi... 119 1e-26 sp|Q5ZJL7|DDB2_CHICK DNA damage-binding protein 2 OS=Gallus gall... 52 2e-06 sp|Q2YDS1|DDB2_DANRE DNA dama...ge-binding protein 2 OS=Danio rerio... 46 1e-04 sp|Q0VBY8|DDB2_BOVIN DNA dama...ge-binding protein 2 OS=Bos taurus ... 45 3e-04 sp|Q66JG1|DDB2_XENTR DNA damage-binding p

  16. AcEST: BP914349 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .0 sp|Q1CMM9|MURD_YERPN UDP-N-acetylmuramoylalanine--D-glutamate li... 30 6.5 sp|...Q8ZIF1|MURD_YERPE UDP-N-acetylmuramoylalanine--D-glutamate li... 30 6.5 sp|Q1C212|MURD_YERPA UDP-N-acetylmuramoylalanine--D-glutama...9|MURD_YERPN UDP-N-acetylmuramoylalanine--D-glutamate ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516...LQVDGTLHLLLGGDGK---SADFSGLTHFLQGDRIKVYCF 370 >sp|Q1C212|MURD_YERPA UDP-N-acetylmuramoylalanine--D-glutamate ...14349 - Show BP914349 Clone id YMU001_000057_H08 Library YMU01 Length 511 Definition Adiantum capillus-vener

  17. AcEST: BP915412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 15412 - Show BP915412 Clone id YMU001_000071_C06 Library YMU01 Length 350 Definition Adiantum capillus-vener...on sp|Q38PU4|GRIK1_MACFA Glutamate receptor, ionotropic kainate 1 OS=Macaca fascicularis Align length 26 Sco...n (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Aci...ts: (bits) Value sp|Q38PU4|GRIK1_MACFA Glutamate receptor, ionotropic kainate 1 O... 30 2.8 sp|P39086|GRIK1_HUMAN Glutama...te receptor, ionotropic kainate 1 O... 30 2.8 >sp|Q38PU4|GRIK1_MACFA Glutama

  18. AcEST: BP912708 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A03 545 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A03. BP912708 - Show ... 9LLL8 Definition sp|Q9LLL8|XSP1_ARATH Xylem serine proteinas e 1 OS=Arabidopsis thaliana Align length 77 Score ( ... ts: (bits) Value sp|Q9LLL8|XSP1_ARATH Xylem serine proteinas e 1 OS=Arabidopsis th... 41 0.003 sp|Q9Z0L3|OC90_MO ... la ab... 30 9.9 >sp|Q9LLL8|XSP1_ARATH Xylem serine proteinas e 1 OS=Arabidopsis thaliana GN=XSP1 PE=2 SV=1 Lengt ... ... 74 4e-12 tr|Q68Q08|Q68Q08_ORYSI Meiotic serine proteinas e-like protein OS... 74 4e-12 tr|Q0JBB7|Q0JBB7_ORYS ...

  19. AcEST: BP914251 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000056_G07 271 Adiantum capillus-veneris mRNA. clone: YMU001_000056_G07. BP914251 - Show ... tion sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi ... Align length 47 Score (bit) 29.6 E-value 4.9 Repor ... alue sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi ... GN=TCNA PE=2... 30 4.9 sp|P18127|ICEN_XANCT Ice nu ... 6.4 >sp|P23253|TCNA_TRYCR Sialidase OS=Trypanosoma cruzi ... GN=TCNA PE=2 SV=1 Length = 1162 Score = 29.6 bits ...

  20. AcEST: BP912797 [AcEST

    Lifescience Database Archive (English)

    Full Text Available neris mRNA. clone: YMU001_000023_A03. Accession BP912797 Tissue type prothallium Developmental stage ...rmitilis ... 30 9.8 sp|Q9SAD4|ESR1_ARATH Ethylene-responsive..._XENTR Zinc finger RNA-binding protein OS=Xenopus t... 32 1.5 sp|O69979|LEXA_STRCO LexA repressor OS=Streptomyces...4U0G1|CLAP1_XENLA CLIP-associating protein 1 OS=Xenopus laev... 31 4.4 sp|A0PT76|LEXA_MYCUA LexA repressor O...p|Q3ABT4|SYFA_CARHZ Phenylalanyl-tRNA synthetase alpha chain OS... 30 9.8 sp|Q82KE0|LEXA_STRAW LexA repressor OS=Streptomyces ave

  1. AcEST: BP915967 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_B08 257 Adiantum capillus-veneris mRNA. clone: YMU001_000081_B08. BP915967 - Show ... s-Prot sp_hit_id O42384 Definition sp|O42384|5H1AB_FU GRU 5-hydroxytryptamine receptor 1A-beta OS=Fu gu ru ... gnificant alignments: (bits) Value sp|O42384|5H1AB_FU GRU 5-hydroxytryptamine receptor 1A-beta OS=Fu ... 3 ... sferase OS=Aspergillus ... 29 8.2 >sp|O42384|5H1AB_FU GRU 5-hydroxytryptamine receptor 1A-beta OS=Fu gu ru ...

  2. AcEST: BP912039 [AcEST

    Lifescience Database Archive (English)

    Full Text Available g pr... 40 0.004 sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/perme... 40 0.004 sp|Q9ZU35|WBC7_ARATH White...r ATP-binding protein MG303 homolog OS=Mycoplasma pneumoniae GN=MPN_432 PE=3 SV=2 Len...12039 CL1986Contig1 Show BP912039 Clone id YMU001_000012_D02 Library YMU01 Length 433 Definition Adiantum capillus-ven...TT 51 >sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=2 SV=1 Len...KTT 115 >sp|Q6KIS8|PSTB_MYCMO Phosphate import ATP-binding protein pstB OS=Mycoplasma mobile GN=pstB PE=3 SV=1 Len

  3. AcEST: BP918283 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_F07 560 Adiantum capillus-veneris mRNA. clone: YMU001_000111_F07. BP918283 - Show ... efinition sp|Q766C3|NEP1_NEPGR Aspartic proteinase nepenthes in-1 OS=Nepenthes ... gracilis Align length 67 Score (b ... ts) Value sp|Q766C3|NEP1_NEPGR Aspartic proteinase nepenthes in-1 OS=Nepent... 39 2e-06 sp|Q6PCT8|DHSD_RAT Succi ... . 30 8.1 >sp|Q766C3|NEP1_NEPGR Aspartic proteinase nepenthes in-1 OS=Nepenthes ... gracilis GN=nep1 PE=1 SV=1 Length ... 6 1e-09 tr|A9ZMF9|A9ZMF9_NEPAL Aspartic proteinase nepenthes in I OS=Nepe... 42 7e-07 tr|A9RF88|A9RF88_PHYPA Pre ...

  4. AcEST: BP913463 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000030_E06 545 Adiantum capillus-veneris mRNA. clone: YMU001_000030_E06. BP913463 - Show ... : Swiss-Prot sp_hit_id Q9VLT5 Definition sp|Q9VLT5|POE _DROME Protein purity of essence OS=Drosophila mela ... ing significant alignments: (bits) Value sp|Q9VLT5|POE _DROME Protein purity of essence OS=Drosophila mela ... ed protein C10orf18 OS=Homo s... 30 7.6 >sp|Q9VLT5|POE _DROME Protein purity of essence OS=Drosophila mela ... nogaster GN=poe ... PE=1 SV=1 Length = 5322 Score = 33.1 bits (74), Ex ...

  5. AcEST: BP914875 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_H01 571 Adiantum capillus-veneris mRNA. clone: YMU001_000063_H01. BP914875 - Show ... ing factor CLF1 OS=Ustilago m... 34 0.59 sp|Q9BZJ0|CRN L1_HUMAN Crooked neck-like protein 1 OS=Homo sapien ... cing factor clf-1 OS=Neurospor... 33 1.3 sp|P63155|CRN L1_RAT Crooked neck-like protein 1 OS=Rattus norveg ... ... 32 1.7 sp|P63154|CRN L1_MOUSE Crooked neck-like protein 1 OS=Mus musculu ... 19B OS=Xenopus tropicalis GN=f... 31 3.8 sp|P17886|CRN _DROME Protein crooked neck OS=Drosophila melanogas ...

  6. AcEST: BP919831 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_F06 376 Adiantum capillus-veneris mRNA. clone: YMU001_000129_F06. BP919831 - Show ... tein 3 OS=Gallus gallu... 217 1e-56 sp|Q23651|ELP3_CAE EL Probable elongator complex protein 3 OS=Cae ... 2 ... 16 2e-56 sp|Q60LW7|ELP3_CAE BR Probable elongator complex protein 3 OS=Cae ... 2 ... : 16 VPHL 5 HL Sbjct: 228 KRHL 231 >sp|Q23651|ELP3_CAE EL Probable elongator complex protein 3 OS=Cae norha ... : 16 VPHL 5 HL Sbjct: 225 PRHL 228 >sp|Q60LW7|ELP3_CAE BR Probable elongator complex protein 3 OS=Cae norha ...

  7. AcEST: BP912634 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000021_B06 377 Adiantum capillus-veneris mRNA. clone: YMU001_000021_B06. BP912634 - Show ... large subunit A OS=Or... 38 0.014 sp|P90978|U2AF2_CAE EL Splicing factor U2AF 65 kDa subunit OS=Cae ... 37 ... 0.023 sp|P90727|U2AF2_CAE BR Splicing factor U2AF 65 kDa subunit OS=Cae ... 37 ... ADVESSTKAKNGMHGRKFANNQVVAVFYP 563 >sp|P90978|U2AF2_CAE EL Splicing factor U2AF 65 kDa subunit OS=Cae norhab ... DCQRAQAALTGRKFANRTVVTSYYDVDKY 491 >sp|P90727|U2AF2_CAE BR Splicing factor U2AF 65 kDa subunit OS=Cae norhab ...

  8. AcEST: BP920295 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_D02 462 Adiantum capillus-veneris mRNA. clone: YMU001_000135_D02. BP920295 - Show ... otein 2 homolog OS=Ory... 60 5e-09 sp|O17580|NOC2L_CAE EL Nucleolar complex protein 2 homolog OS=Cae ... 56 ... otein 2 homolog OS=Ara... 53 7e-07 sp|A8WTM7|NOC2L_CAE BR Nucleolar complex protein 2 homolog OS=Cae ... 52 ... 1 +T +VD+ Sbjct: 96 PITMQMVDS 104 >sp|O17580|NOC2L_CAE EL Nucleolar complex protein 2 homolog OS=Cae norhab ... : 130 ATKMEIAKKVHVQKTITASMVDA 152 >sp|A8WTM7|NOC2L_CAE BR Nucleolar complex protein 2 homolog OS=Cae norhab ...

  9. AcEST: BP916313 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000086_C06 415 Adiantum capillus-veneris mRNA. clone: YMU001_000086_C06. BP916313 - Show ... tase OS=Anaplasma phagocy... 30 2.9 sp|Q23651|ELP3_CAE EL Probable elongator complex protein 3 OS=Cae ... 2 ... 9 6.5 sp|Q60LW7|ELP3_CAE BR Probable elongator complex protein 3 OS=Cae ... 2 ... G ++ GG Sbjct: 64 RFGHKPIVLLGG 75 >sp|Q23651|ELP3_CAE EL Probable elongator complex protein 3 OS=Cae norha ... 39 H MPD Sbjct: 280 -----HMMPD 284 >sp|Q60LW7|ELP3_CAE BR Probable elongator complex protein 3 OS=Cae norha ...

  10. AcEST: BP920763 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000141_C01 312 Adiantum capillus-veneris mRNA. clone: YMU001_000141_C01. BP920763 - Show ... 7 OS=Xenopus tropicalis... 32 0.75 sp|Q09301|YQOC_CAE EL Putative RNA-binding protein EEED8.12 OS=Ca... 3 ... 1 1.7 sp|Q09295|YQO4_CAE EL Putative RNA-binding protein EEED8.4 OS=Cae ... 3 ... T +ER+F Sbjct: 137 NVTHSWIERVF 147 >sp|Q09301|YQOC_CAE EL Putative RNA-binding protein EEED8.12 OS=Cae norh ... EEEQKAIDAKSVFIGNVDFNSTIEEVEEHF 81 >sp|Q09295|YQO4_CAE EL Putative RNA-binding protein EEED8.4 OS=Cae norha ...

  11. AcEST: BP912508 [AcEST

    Lifescience Database Archive (English)

    Full Text Available is mRNA. clone: YMU001_000019_C07. Accession BP912508 Tissue type prothallium Developmental stage - Contig ID - Sequen...ces producing significant alignments: (bits) Value sp|Q6IV56|RN141_DANRE RING finger protein 141 OS=Danio rer...04 >sp|Q6IV57|RN141_RAT RING finger protein 141 OS=Rattus norvegicus GN=Rnf141 PE=2 SV=1 Length = 230 Score ...sp|Q5R7K8|RN141_PONAB RING finger protein 141 OS=Pongo abelii GN=RNF141 PE=2 SV=1 Length = 230 Score = 53.5 ... 207 >sp|Q5ZM74|RN141_CHICK RING finger protein 141 OS=Gallus gallus GN=RNF141 PE=2 SV=1 Length = 230 Score

  12. AcEST: BP917110 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in ring-zinc-finger protein (Fragment)... 36 0.82 tr|Q7X7W8|Q7X7W8_PEA Makor...in ring-zinc-finger protein (Makorin R... 36 0.82 tr|Q7X760|Q7X760_PEA Makorin ring-zinc-finger protein (Fragment...is mRNA. clone: YMU001_000096_B04. Accession BP917110 Tissue type prothallium Developmental stage - Contig ID CL782Cont...otein... 37 0.025 sp|Q6YYC0|C3H55_ORYSJ Zinc finger CCCH domain-containing protein... 37 0.032 sp|Q13434|MKRN4_HUMAN Putative makor... tRNA methyltran... 35 0.094 sp|Q657B3|C3H7_ORYSJ Zinc finger CCCH domain-containing protein ... 35 0.094 sp|Q9QXP6|MKRN1_MOUSE Makor

  13. AcEST: BP918901 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Definition sp|Q0J952|C3H32_ORYSJ Zinc finger CCCH domain-containing protein 32 OS=Oryza sativa subsp. japonica Align len...is mRNA. clone: YMU001_000118_G10. Accession BP918901 Tissue type prothallium Developmental stage - Contig ID - Sequen...K977|C3H19_ORYSJ Zinc finger CCCH domain-containing protein... 32 2.0 sp|Q4PGU6|SLT11_USTMA Pre-mRNA-splicing factor...tion ring formation regulator ezrA OS=... 33 0.68 sp|Q75K81|C3H36_ORYSJ Zinc finger CCCH domain-conta... >sp|Q6Z358|C3H49_ORYSJ Zinc finger CCCH domain-containing protein 49 OS=Oryza sativa subsp. japonica GN=Os07g0281000 PE=2 SV=1 Len

  14. AcEST: BP913928 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Swiss-Prot sp_hit_id O64963 Definition sp|O64963|PAL1_PRUAV Phenylalanine ammonia... to BlastX Result : TrEMBL tr_hit_id Q5EP58 Definition tr|Q5EP58|Q5EP58_PTEAQ Phenylalanine ammonia lyase (F...13928 - Show BP913928 Clone id YMU001_000037_H09 Library YMU01 Length 492 Definition Adiantum capillus-veneris mRNA. clon...-lyase OS=Nicotiana ta... 134 3e-31 sp|P27991|PAL1_SOYBN Phenylalanine ammonia...-lyase 1 OS=Petroselin... 127 3e-29 sp|P35513|PAL2_TOBAC Phenylalanine ammonia-lyase OS=Nicotian

  15. AcEST: BP918145 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_B01 457 Adiantum capillus-veneris mRNA. clone: YMU001_000110_B01. BP918145 CL1571C ... t sp_hit_id Q8CGM1 Definition sp|Q8CGM1|BAI2_MOUSE Brain -specific angiogenesis inhibitor 2 OS=Mus musculus ... cant alignments: (bits) Value sp|Q8CGM1|BAI2_MOUSE Brain -specific angiogenesis inhibitor 2 OS=... 34 0.35 s ... p|O60241|BAI2_HUMAN Brain -specific angiogenesis inhibitor 2 OS=... 34 0.35 s ... rotein 1 OS=Mus mu... 25 8.6 >sp|Q8CGM1|BAI2_MOUSE Brain -specific angiogenesis inhibitor 2 OS=Mus musculus ...

  16. AcEST: BP918321 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B06 529 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B06. BP918321 CL638Co ... '-phosphoadenosine 5'-phosph... 77 5e-14 sp|A9G7W0|SAT C2_SORC5 Probable bifunctional SAT /APS kinase 2 OS= ... ltransferase OS=Ustilago may... 44 5e-04 sp|Q1AXE5|SAT _RUBXD Sulfate adenylyltransferase OS=Rubrobacter x ... ... 43 0.001 sp|B0BZ94|SAT _ACAM1 Sulfate adenylyltransferase OS=Acaryochloris ... ltransferase OS=Penicillium ... 43 0.001 sp|A9BFU2|SAT _PETMO Sulfate adenylyltransferase OS=Petrotoga mob ...

  17. AcEST: BP912739 [AcEST

    Lifescience Database Archive (English)

    Full Text Available e-10 sp|O04195|Y2992_ARATH Uncharacterized protein At2g39920 OS=Arabi... 39 0.014 sp|P26093|HEL_HAEIN Lipoprotein E OS=Haemop...hilus influenzae GN=h... 39 0.014 sp|P42657|RAD25_SCHPO DNA damage checkpoint protein rad25...Sbjct: 246 GVIGNHMDVLRGQWNWQSKRLFKL 269 >sp|P26093|HEL_HAEIN Lipoprotein E OS=Haemophilus influenzae GN=hel ...RAD25_SCHPO DNA damage checkpoint protein rad25 OS=Schizosaccharomyces pombe GN=rad25 PE=1 SV=1 Length = 270...illus-veneris mRNA. clone: YMU001_000022_D01. Accession BP912739 Tissue type prothallium Developmental stage

  18. AcEST: BP917609 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000103_A10 527 Adiantum capillus-veneris mRNA. clone: YMU001_000103_A10. BP917609 CL1240C ... ransferase OS=Plasmodium yoe... 94 4e-19 sp|Q31WW1|PAT _SHIBS Putrescine aminotransferase OS=Shigella boyd ... ransferase OS=Bacillus subti... 92 1e-18 sp|Q83JJ8|PAT _SHIFL Putrescine aminotransferase OS=Shigella flex ... ... 92 2e-18 sp|Q0T0J2|PAT _SHIF8 Putrescine aminotransferase OS=Shigella flex ... ... 92 2e-18 sp|Q8Z3L9|PAT _SALTI Putrescine aminotransferase OS=Salmonella ty ...

  19. AcEST: BP920419 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_H03 554 Adiantum capillus-veneris mRNA. clone: YMU001_000136_H03. BP920419 CL1240C ... ansferase OS=Plasmodium yoe... 100 8e-21 sp|Q31WW1|PAT _SHIBS Putrescine aminotransferase OS=Shigella boyd ... ... 99 1e-20 sp|Q8Z3L9|PAT _SALTI Putrescine aminotransferase OS=Salmonella ty ... aminotransferase OS=Methano... 99 2e-20 sp|Q83JJ8|PAT _SHIFL Putrescine aminotransferase OS=Shigella flex ... ... 98 2e-20 sp|Q0T0J2|PAT _SHIF8 Putrescine aminotransferase OS=Shigella flex ...

  20. Purification and characterization of alpha-L-arabinofuranosidase from Arthrobacter sp. MTCC 5214 in solid-state fermentation

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, R.; Numan, M.T.H.; Mukherjee, B.; Satwekar, A.; Bhosle, N.B.

    -(1,4)- linked xylose or galactose backbones in arabinoxylans and breakdown of heteroxylans [4–7]. Inrecentyears,a-L-AFaseshavereceivedconsiderableattention materials for animal feed, and hydrolysis of grape monoterpenyl glycosides during wine...Z,BrillouetJM,VoirinS,BaumesR,CordonnierR.Purificationandsome properties of an a-L-arabino-furanosidase from Aspergillus niger. Action on grape monoterpenyl arabinofuranosyl glucosides. J Agric Food Chem 1990;38:772–6. [11] Utt EA, Eddy CK, Keshav KF, Ingram LO. Sequencing and expression of the Butyrivibrio fibrisolvens...

  1. Isolation, purification and characterization of xylanase produced by Arthrobacter sp. MTCC 5214 when grown in solid-state fermentation

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, R.; Bhosle, N.B.

    %) fractionation, and purified to homogeneity using size exclusion and ion exchange chromatography. The molecular mass of xylanase was approx. 20 kDa. Enzyme retained 100% activity at pH 7 and 8 for 24 h. It was interesting to note that at higher pH such as 9, 10...

  2. AcEST: BP912766 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_F05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000022_F05. BP912766 - Show ... FGLAEARYYT 427 Query: 299 VVLGVARSIGSLSQLVWDRALCLPIERP SSVNLDWIENFCQR 174 V+ GV+RS+G SQL+WDRAL LP+ERP ... SV L ... DWIE C++ Sbjct: 428 VLFGVSRSLGICSQLIWDRALGLPLERP KSVTLDWIEKNCKK 469 >sp|O80433|CISY_DAUCA Citrate sy ... YGLTEARYYT 428 Query: 299 VVLGVARSIGSLSQLVWDRALCLPIERP SSVNLDWIENFCQRKS 168 V+ GV+R+IG SQLVWDRAL LP+ERP ... SV ... ++W+EN C++ S Sbjct: 429 VLFGVSRAIGICSQLVWDRALGLPLERP KSVTMEWLENHCKKSS 472 >sp|Q9M1D3|CISY5_ARATH Citrate ...

  3. AcEST: BP914037 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GACTTGTTTGATGTCTCAGGAGATGCTCCCCGAGTGTTAAAGCTTCTTGAACAACCTTTG CATTGATTATCATAGGA ■■Homology search results ■■ - Swiss-Prot (release... 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q54DE8 Definition sp|Q54DE8|PSNB_DICDI Presenilin-...prot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching..................................................done Score... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914037|Adia...Q9VWF2|SAYP_DROME Supporter of activation of yellow protein OS=Drosophila melanogaster GN=e(y)3 PE=2 SV=3 Length = 2006 Score

  4. AcEST: BP912519 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nthetase OS=Prochlorococcus ma... 32 2.0 sp|Q821U6|SYK_CHLCV Lysyl-tRNA synthetase OS=Chlamydophila cavia......DHSASDLSKFISGGNKVNFHKVFQEFSFDSKDYLIGD 409 >sp|Q821U6|SYK_CHLCV Lysyl-tRNA synthetase OS=Chlamydophila cavi...12519 - Show BP912519 Clone id YMU001_000019_C10 Library YMU01 Length 539 Definition Adiantum capillus-vener... Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped ...adden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BL

  5. AcEST: BP918119 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_G08 444 Adiantum capillus-veneris mRNA. clone: YMU001_000109_G08. BP918119 - Show ... SLTILLDNLIGSGI 266 Query: 107 VAIILSVTFVLAFGEIIPQAICSR YGLAIGANLV 6 +A+ S ++ FGEI+PQA+CSR +GLA+GAN + Sbjct: ... 267 MAVASSTIGIVIFGEILPQALCSR HGLAVGANTI 300 >sp|A0JPA0|CNNM4_XENTR Metal transpo ... TLTALLDELIGSGL 266 Query: 107 VAIILSVTFVLAFGEIIPQAICSR YGLAIGAN 12 A++ S T ++ GEI+PQA+CSR +GLA+GAN Sbjct: 2 ... 67 AAVLASTTGIVVLGEIVPQALCSR HGLAVGAN 298 >sp|P0C588|CNNM4_RAT Metal transporter ...

  6. AcEST: BP911824 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_F02 597 Adiantum capillus-veneris mRNA. clone: YMU001_000009_F02. BP911824 CL3433C ... KSSMTSPAHSCRVTH*AKARSLYPSTIPRVTNYTQASSPGTLSL 488 +SP S G ... +K RS + SCRV + SL P+ I + + PGT Sbjct: 797 VSPANS ... GRT-SLPPTFIRAQPTFVKVEVPGTFVG 855 Query: 489 PKPILFYPSG ... 518 P + PSG ... Sbjct: 856 PPSM---PSG ... 862 >sp|Q9UKN1|M ... GFSLFGTPS 178 Query: 432 TIPRVTNYTQASSPGTLSLPKPILFYPSG ... 518 + P T + + T S P P LF SG Sbjct: 179 SAPSATTTSSL ...

  7. AcEST: BP919439 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_B04 556 Adiantum capillus-veneris mRNA. clone: YMU001_000125_B04. BP919439 CL592Co ... NAP+TF R M F R F V+ +D LIFSE+ +EH+KHL Sbjct: 708 TPSG KYEYTVMPFGLVNAPSTFARYMADTFRDLR-FVNVYLDDILIFSESPEEHW ... SRIGNAQIFTTLDLHSGYHQIPMEPKD 700 Query: 181 VHKTSLEQPSG ... 213 +KT+ PSG ... Sbjct: 701 RYKTAFVTPSG ... 711 >sp|Q7LHG5 ... NAP+TF R M F R F V+ +D LIFSE+ +EH+KHL Sbjct: 734 TPSG KYEYTVMPFGLVNAPSTFARYMADTFRDLR-FVNVYLDDILIFSESPEEHW ... SRIGNAQIFTTLDLHSGYHQIPMEPKD 726 Query: 181 VHKTSLEQPSG ... 213 +KT+ PSG ... Sbjct: 727 RYKTAFVTPSG ... 737 >sp|P04323 ...

  8. AcEST: BP919071 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000120_H06 591 Adiantum capillus-veneris mRNA. clone: YMU001_000120_H06. BP919071 - Show ... 1e-13 sp|P40900|ISP4_SCHPO Sexual differentiation process ... protein isp4... 71 4e-12 sp|Q06593|OPT2_YEAST Olig ... e-41 tr|Q5VS41|Q5VS41_ORYSJ Sexual differentiation process ... protein is... 170 6e-41 tr|A7QJ80|A7QJ80_VITVI Chr ...

  9. AcEST: BP920021 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_B06 478 Adiantum capillus-veneris mRNA. clone: YMU001_000132_B06. BP920021 - Show ... istone polyprotein OS=T... 37 0.046 sp|P12675|ICAL_PIG ... Calpastatin OS=Sus scrofa GN=CAST PE=2 SV=1 37 0.0 ... RKASSSK-NRKSSKSKDRK-SSSSKGRKSS 325 >sp|P12675|ICAL_PIG ... Calpastatin OS=Sus scrofa GN=CAST PE=2 SV=1 Length ...

  10. AcEST: BP914172 [AcEST

    Lifescience Database Archive (English)

    Full Text Available -9 3-methyltransferase ... 49 1e-05 sp|O82427|SMT2_ORYSJ 24-methylenesterol C-methyltransferas...ANC5 3-demethylubiquinone-9 3-methyltransferase ... 49 2e-05 sp|P94298|UBIE_BACPF Menaquinone biosynthesis methyltr.... 25:3389-3402. Query= BP914172|Adiantum capillus-veneris mRNA, clone: YMU001_000042_G09. (546 letters) Database: uniprot_tre...|A9SAH0|A9SAH0_PHYPA Predicted protein OS=Physcomitrella paten... 263 6e-69 tr...ults ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi

  11. AcEST: BP918423 [AcEST

    Lifescience Database Archive (English)

    Full Text Available HUMAN Mucin-17 OS=Homo sapiens GN=MUC17 PE=1 SV=1 32 2.4 sp|Q9LG11|HAC4_ARATH Histone acetyltransferase HAC4...: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching.........................+ N G +C + Sbjct: 4130 PRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEE 4171 >sp|Q9LG11|HAC4_ARATH His...2. Query= BP918423|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C11. (525 letters) Database: uniprot... 95 ASVQIAFNGAFAGPNGIGGVTVDGTVGEVKTTTDKKGNVTCN 136 >tr|A1WQY5|A1WQY5_VEREI Putative uncharacterized protein OS=Verminephrobacter eise

  12. AcEST: BP916257 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000085_C05 485 Adiantum capillus-veneris mRNA. clone: YMU001_000085_C05. BP916257 CL1911C ... lone id YMU001_000085_C05 Library YMU01 Length 485 Def inition Adiantum capillus-veneris mRNA. clone: YMU0 ... ink to BlastX Result : Swiss-Prot sp_hit_id Q2R637 Def inition sp|Q2R637|P2C75_ORYSJ Probable protein phos ...

  13. AcEST: BP919573 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_F09 365 Adiantum capillus-veneris mRNA. clone: YMU001_000126_F09. BP919573 CL1911C ... lone id YMU001_000126_F09 Library YMU01 Length 365 Def inition Adiantum capillus-veneris mRNA. clone: YMU0 ... ink to BlastX Result : Swiss-Prot sp_hit_id Q2R637 Def inition sp|Q2R637|P2C75_ORYSJ Probable protein phos ...

  14. AcEST: BP919937 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_H05 362 Adiantum capillus-veneris mRNA. clone: YMU001_000130_H05. BP919937 - Show ... US10 homolog (Fragment) OS=Ce... 30 2.9 sp|Q9VLT5|POE _DROME Protein purity of essence OS=Drosophila mela ... + Sbjct: 62 GATVALLYPLCDQPSAHLQTLPLE 85 >sp|Q9VLT5|POE _DROME Protein purity of essence OS=Drosophila mela ... nogaster GN=poe ... PE=1 SV=1 Length = 5322 Score = 29.3 bits (64), Ex ...

  15. AcEST: BP920565 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000138_F04 413 Adiantum capillus-veneris mRNA. clone: YMU001_000138_F04. BP920565 - Show ... OS=Psilotum nudum GN=ycf2 PE=3... 30 4.9 sp|P0C213|TAX _HTL1F Protein Tax -1 OS=Human T-cell leukemia virus ... ... 30 4.9 sp|P14079|TAX _HTL1C Protein Tax -1 OS=Human T-cell leukemia virus ...

  16. AcEST: BP911905 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000010_F08 509 Adiantum capillus-veneris mRNA. clone: YMU001_000010_F08. BP911905 - Show ... in OS=Mus musculus GN=Sox13 PE... 30 6.6 sp|Q02158|PIPA _DICDI 1-phosphatidylinositol-4,5-bisphosphate pho. ... 321 PC H C+L Sbjct: 863 CPCSHHTRCIL 873 >sp|Q02158|PIPA _DICDI 1-phosphatidylinositol-4,5-bisphosphate phos ... phodiesterase OS=Dictyostelium discoideum GN=pipA ... PE=2 SV=1 Length = 801 Score = 29.6 bits (65), Exp ...

  17. AcEST: BP912902 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000024_B06 477 Adiantum capillus-veneris mRNA. clone: YMU001_000024_B06. BP912902 - Show ... in LEUM_0496 OS=Leuconostoc me... 30 7.2 sp|P27106|MIS _MOUSE Muellerian-inhibiting factor OS=Mus musculus ... HLRRTT 60 Query: 241 WSNFGVCVLMLPQKRGVSLMCR------EPMIS YMFSQI*RCFPSRTNVMHSRSRRLQRM 80 ++ V P KRG ++ E + + ... 20 Query: 79 IR 74 +R Sbjct: 121 VR 122 >sp|P27106|MIS _MOUSE Muellerian-inhibiting factor OS=Mus musculus ... 4%) Frame = -3 Query: 244 AWSNFGVCVLMLPQKRGVSLMCREPMIS YMFSQI*RCFPSRT 119 AWS FG+ + + P + G +L + + +++F RC ...

  18. AcEST: BP916774 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000091_D10 507 Adiantum capillus-veneris mRNA. clone: YMU001_000091_D10. BP916774 - Show ... Query: 43 CVPVILSDEMELPFQNVIDYREFSIKWPSS*ISKELLDYLESIP DIDIERMLARGR 210 CVPV+++D LPF V+D++ S+ P +S ++ L+SI ... bjct: 339 CVPVVIADSYILPFSEVLDWKRASVVVPEEKMS-DVYSILQSIP QRQIEEMQRQAR 393 >sp|O77783|EXT2_BOVIN Exostosin-2 ... Query: 43 CVPVILSDEMELPFQNVIDYREFSIKWPSS*ISKELLDYLESIP DIDIERMLARGR 210 CVPVI++D LPF V+D++ S+ P +S ++ L+SI ... bjct: 339 CVPVIIADSYVLPFSEVLDWKRASVVVPEEKMS-DVYSILQSIP RRQIEEMQRQAR 393 >sp|P70428|EXT2_MOUSE Exostosin-2 ...

  19. AcEST: BP918363 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F04 517 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F04. BP918363 CL888Co ... tein kinase Kist OS=Ho... 54 4e-07 sp|P90978|U2AF2_CAE EL Splicing factor U2AF 65 kDa subunit OS=Cae ... 51 ... 3e-06 sp|P90727|U2AF2_CAE BR Splicing factor U2AF 65 kDa subunit OS=Cae ... 51 ...

  20. AcEST: BP912056 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E08 538 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E08. BP912056 - Show ... g protein IPI3 OS=Candida... 30 5.7 sp|P34611|NCL1_CAE EL B-box type zinc finger protein ncl-1 OS=Cae ... 3 ... ESIGG-MNKIITVDADQNLKETFVAHQQKT 316 >sp|P34611|NCL1_CAE EL B-box type zinc finger protein ncl-1 OS=Cae norha ...

  1. AcEST: BP913299 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_G03 370 Adiantum capillus-veneris mRNA. clone: YMU001_000028_G03. BP913299 - Show ... se 1 OS=Xenopus laevis ... 35 0.089 sp|Q09568|YR86_CAE EL Uncharacterized ribonuclease F48E8.6 OS=Cae ... 3 ... 872 RTNGVLLFIPRYGIKGAAYLKNTDGL 897 >sp|Q09568|YR86_CAE EL Uncharacterized ribonuclease F48E8.6 OS=Cae norha ... +V Sbjct: 25 GQLTCERCFTGVCLNKDAIGSPEAQEALLAAASKHKVPCAE RLAGVAAHCNERKLASRHV 84 Query: 189 RDASDKVYLWAMLKKKE ... FPNWCITRKDAAESKERSEALSAAAKKFKLPSSENLGEIAEHCNERKCAGHCAE EAG 178 Query: 177 DKVYLWAMLKKKEGMFSEARVLAVGSKFVSLY ...

  2. AcEST: BP917488 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_D10 357 Adiantum capillus-veneris mRNA. clone: YMU001_000101_D10. BP917488 CL27Con ... n 771 OS=Homo sapiens GN... 32 1.00 sp|O76743|GLH4_CAE EL ATP-dependent RNA helicase glh-4 OS=Cae norh... 3 ... roplastic OS=Chlamydomona... 30 4.9 sp|P34307|YKR1_CAE EL KH domain-containing protein C06G4.1 OS=Cae ... 2 ...

  3. AcEST: BP915887 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_B02 523 Adiantum capillus-veneris mRNA. clone: YMU001_000079_B02. BP915887 - Show ... tein 3 OS=Homo sapiens... 174 3e-43 sp|Q60LW7|ELP3_CAE BR Probable elongator complex protein 3 OS=Cae ... 1 ... tein 3 OS=Bos taurus G... 173 4e-43 sp|Q23651|ELP3_CAE EL Probable elongator complex protein 3 OS=Cae ... 1 ...

  4. AcEST: BP919491 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000125_F10 313 Adiantum capillus-veneris mRNA. clone: YMU001_000125_F10. BP919491 CL888Co ... tein kinase Kist OS=Ho... 53 4e-07 sp|P90978|U2AF2_CAE EL Splicing factor U2AF 65 kDa subunit OS=Cae ... 50 ... 3e-06 sp|P90727|U2AF2_CAE BR Splicing factor U2AF 65 kDa subunit OS=Cae ... 50 ...

  5. AcEST: BP915034 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_G02 383 Adiantum capillus-veneris mRNA. clone: YMU001_000065_G02. BP915034 CL3621C ... e = -3 Query: 378 SPVQWETTLKTILGKGLQNGYELGPGKVIAGLVKRI ... 271 +PVQW +++ I +G+++ YE+GPGKV+ GL KRI ... Sbjct: 253 ... NPVQWTKSVEFIAAQGVEHLYEVGPGKVLTGLTKRI ... 288 >sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier ... e = -3 Query: 378 SPVQWETTLKTILGKGLQNGYELGPGKVIAGLVKRI ... 271 +PVQW +++ + +G+++ YE+GPGKV+ GL KRI ... Sbjct: 253 ... NPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRI ... 288 >sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier ...

  6. AcEST: BP917280 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000098_F11 515 Adiantum capillus-veneris mRNA. clone: YMU001_000098_F11. BP917280 - Show ... led receptor 182 OS=Homo sap... 36 0.093 sp|Q96CP7|TLC D1_HUMAN TLC ... domain-containing protein 1 OS=Homo sa ... tor 1 OS=Rattus norvegicus GN=... 31 3.0 sp|Q99JT6|TLC D1_MOUSE TLC ... domain-containing protein 1 OS=Mus mus ...

  7. AcEST: BP915227 [AcEST

    Lifescience Database Archive (English)

    Full Text Available RKWGRVGNEK 558 >sp|P31669|PARP1_XENLA Poly [ADP-ribose] polymerase (Fragment) OS=Xenopus laevis GN=parp1 PE=...+G Sbjct: 183 IQALESDAG-GNFMVYSRWGRVG 204 >sp|O88554|PARP2_MOUSE Poly [ADP-ribose] polymerase 2 OS=Mus musculus GN=Parp...15227 CL802Contig1 Show BP915227 Clone id YMU001_000069_A06 Library YMU01 Length 513 Definition Adiantum cap...CCTTAATGGACTCATCCTCTTTTGATTCCTCGTCAA GATCTTCTTTTTCCTCTCGATTATCACCTGATT ■■Homology search results ■■ - Swiss-...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-

  8. AcEST: BP918963 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000119_E09 538 Adiantum capillus-veneris mRNA. clone: YMU001_000119_E09. BP918963 - Show ... FSVGEVGRIGSPGRREIGHG 403 Query: 98 VLAEKALEYALPSEEVFPY TIRLESTITESNG 3 LAEKAL +ALP FPY TIR+ES ITESNG Sbjct: ... 404 KLAEKALSHALPDPAKFPY TIRIESNITESNG 435 >sp|Q822C1|PNP_CHLCV Polyribonucl ... SVGEVGRIG 393 Query: 128 APSRREIGHGVLAEKALEYALPSEEVFPY TIRLESTITESNG 3 +P RREIGHG LAEKAL + LP FPY TIR+ES IT ... ESNG Sbjct: 394 SPGRREIGHGKLAEKALSHTLPDPAKFPY TIRIESNITESNG 435 >sp|Q6MDI2|PNP_PARUW Polyribonucl ...

  9. AcEST: BP921088 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000145_D11 466 Adiantum capillus-veneris mRNA. clone: YMU001_000145_D11. BP921088 - Show ... 3 ARSGKLRIGRYVRSAKCVQSKKSPLAVYAEVIKA--NKGSRIMETIKCTPVT ... 152 ARSGKL IG + S PLA +IK N+ + + C PVT ... Sbjct: 608 ... ARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVT ... 659 >sp|Q5RD33|APBA2_PONAB Amyloid beta A4 precurs ... 3 ARSGKLRIGRYVRSAKCVQSKKSPLAVYAEVIKA--NKGSRIMETIKCTPVT ... 152 ARSGKL IG + S PLA +IK N+ + + C PVT ... Sbjct: 607 ... ARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVT ... 658 >sp|P98084|APBA2_MOUSE Amyloid beta A4 precurs ...

  10. AcEST: BP921284 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_H06 271 Adiantum capillus-veneris mRNA. clone: YMU001_000147_H06. BP921284 CL2003C ... |VP3_BTV1S Core protein VP3 OS=Bluetongue virus 1 (iso l... 30 4.9 sp|P20608|VP3_BTV1A Core protein VP3 OS ... =Bluetongue virus 1 (iso l... 30 4.9 sp|P03539|VP3_BTV17 Core protein VP3 OS ...

  11. Application of zeolite-Arthrobacter viscosus system for the removal of heavy metal and dye : chromium and azure B

    OpenAIRE

    Rosales, E.; Pazos, M.; Sanromán, M. A.; Tavares, M. T.

    2012-01-01

    A hybrid system combining the ion-exchange properties of a NaY zeolite and the characteristics of the bacterium Arthrobacter viscosus was investigated to treat polluted effluents with dye and toxic metals. In this study, the dye and the metal ion employed were a thiazine dye, Azure B, and chromium (VI), respectively. Initially, the removal of dye by the zeolite was tested. The analysis of dye equilibrium isotherms data was done using Langmuir, Freundlich, Sips and Redlich–Peterson models. Red...

  12. Characterization of the in vitro assembly of FtsZ in Arthrobacter strain A3 using light scattering.

    Science.gov (United States)

    Yang, Fan; Zhang, Shanshan; Ding, Shenglong; Hou, Yannan; Yu, Linghui; Chen, Ximing; Xiao, Jianxi

    2016-10-01

    The self-assembly of FtsZ, the bacterial homolog of tubulin, plays an essential role in cell division. Light scattering technique is applied to real-time monitor the in vitro assembly of FtsZ in Arthrobacter strain A3, a newly isolated psychrotrophic bacterium. The critical concentration needed for the assembly is estimated as 6.7μM. The polymerization of FtsZ in Arthrobacter strain A3 requires both GTP and divalent metal ions, while salt is an unfavorable condition for the assembly. The FtsZ polymerizes under a wide range of pHs, with the fastest rate around pH 6.0. The FtsZ from Arthrobacter strain A3 resembles Mycobacterium tuberculosis FtsZ in terms of the dependence on divalent metal ions and the slow polymerization rate, while it is different from M. tuberculosis FtsZ considering the sensitivity to salt and pH. The comparison of FtsZ from different organisms will greatly advance our understanding of the biological role of the key cell division protein. PMID:27164494

  13. AcEST: BP916291 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P28824|NRP1_XENLA Neuropilin-1 OS=Xenopus laevis GN=nrp1 PE=2... 32 0.93 sp|Q9VKH0|COG8_DROME Conserve...>sp|Q9VKH0|COG8_DROME Conserved oligomeric Golgi complex subunit 8 OS=Drosophila melanogaster...YMU001_000086_A06 448 Adiantum capillus-veneris mRNA. clone: YMU001_000086_A06. BP9...16291 CL648Contig1 Show BP916291 Clone id YMU001_000086_A06 Library YMU01 Length 448 Definition Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Quer

  14. AcEST: BP920067 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and...ignments: (bits) Value sp|Q9VBQ9|MED28_DROME Mediator of RNA polymerase II transcriptio... 30 6.4 sp|Q3YVP9|VIAA_SHISS Protein via...ro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and...YMU001_000132_F06 502 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F06. BP9...20067 CL596Contig1 Show BP920067 Clone id YMU001_000132_F06 Library YMU01 Length 502 Definition Adiantum cap

  15. AcEST: BP921178 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN dom... 29 6.4 sp|A2BHJ4|CNO6L_DANRE CCR4-NOT transcri...SSGKGKCPK 57 >tr|B0EPA7|B0EPA7_ENTDI Putative uncharacterized protein OS=Entamoeba dispar SAW760 GN=EDI_2282...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921178|Adiantum capillus-veneris... + +H Sbjct: 283 EDIAQIPTCAEAGEQEGRLQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIH 336 >sp|A2BHJ4|CNO6L_DANRE CCR4-NOT transcri...YMU001_000146_F05 435 Adiantum capillus-veneris mRNA. clone: YMU001_000146_F05. BP9

  16. AcEST: BP918215 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GSSRRSKSSSASK 168 >tr|A5E7E2|A5E7E2_LODEL Putative uncharacterized protein OS=Lodderomyces elongisporus GN=L...|P29374|ARI4A_HUMAN AT-rich interactive domain-containing prot... 31 2.1 sp|A4R0R0|MSH3_MAGGR DNA mis...|Q9UGU0|TCF20_HUMAN Transcription factor 20 OS=Homo sapiens GN... 30 3.5 sp|Q2HDJ0|LMBD1_CHAGB Probable lysosomal cobalamin transp...YMU001_000110_H02 447 Adiantum capillus-veneris mRNA. clone: YMU001_000110_H02. BP9...18215 CL1538Contig1 Show BP918215 Clone id YMU001_000110_H02 Library YMU01 Length 447 Definition Adiantum capillus-veneris

  17. AcEST: BP921333 [AcEST

    Lifescience Database Archive (English)

    Full Text Available onsive transcription factor E... 29 8.4 >sp|Q9SRR1|FBL12_ARATH F-box/LRR-repeat protein 12 OS=Arabidopsis...tr|B0EC65|B0EC65_ENTDI Caldesmon, putative OS=Entamoeba dispar S... 33 7.1 >tr|Q552I0|Q552I0_DICDI Putative uncharacterized pr...PR V+ MCI Sbjct: 645 SQFNG--FVYDTSFLLVDQQMTTVYNVIVDVVSAILTMLSICVLMVPRPVSAMCI 697 >sp|Q9FZ90|ERF87_ARATH Ethylene-responsive transcri...YMU001_000148_E12 468 Adiantum capillus-veneris mRNA. clone: YMU001_000148_E12. BP9...21333 - Show BP921333 Clone id YMU001_000148_E12 Library YMU01 Length 468 Definition Adiantum capillus-veneris

  18. AcEST: BP915359 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |P42781|XPR6_YARLI Dibasic-processing endoprotease OS=Yarrowia... 33 1.2 sp|Q9V460|SPT5H_DROME Transcri...R Sbjct: 687 AFDHENITRTTVFSEDLHEGR 707 >tr|B0ERD4|B0ERD4_ENTDI Putative uncharacterized protein OS=Entamoeba disp...KPVDNSDSSSDSSDSHTSWWPDLS--SKKSAW 856 >sp|Q9V460|SPT5H_DROME Transcription elongation factor SPT5 OS=Drosophi...YMU001_000070_F02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000070_F02. BP9...15359 CL1037Contig1 Show BP915359 Clone id YMU001_000070_F02 Library YMU01 Length 555 Definition Adiantum capillus-veneris

  19. AcEST: BP913337 [AcEST

    Lifescience Database Archive (English)

    Full Text Available is mRNA. clone: YMU001_000029_B06. Accession BP913337 Tissue type prothallium Developmental stage - Contig ID CL2828Cont..... 34 0.30 sp|Q84ZT0|C3H51_ORYSJ Putative zinc finger CCCH domain-containin... 34 0.30 sp|Q9QXP6|MKRN1_MOUSE Makor...in... 43 7e-04 sp|Q338N2|C3H62_ORYSJ Zinc finger CCCH domain-containing protein... 38 0.028 sp|Q6FNR8|CWC2_CANGA Pre...-mRNA-splicing factor CWC2 OS=Candida gl... 36 0.080 sp|Q5NAV3|C3H5_ORYSJ Zinc finger CCCH domain-conta....23 sp|Q9JJ48|ZC3H8_MOUSE Zinc finger CCCH domain-containing protein... 34 0.30 sp|Q6C007|CWC2_YARLI Pre

  20. AcEST: BP913167 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_C04 566 Adiantum capillus-veneris mRNA. clone: YMU001_000027_C04. BP913167 CL1125C ... |P03315|POLS_SFV Structural polyprotein OS=Semliki forest ... viru... 32 1.5 sp|P25386|USO1_YEAST Intracellular ... |P03315|POLS_SFV Structural polyprotein OS=Semliki forest ... virus PE=1 SV=1 Length = 1253 Score = 32.3 bits (7 ...

  1. AcEST: BP912285 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_C06 554 Adiantum capillus-veneris mRNA. clone: YMU001_000017_C06. BP912285 - Show ... 411|POLN_SFV Non-structural polyprotein OS=Semliki forest ... ... 30 7.9 sp|P34802|GGPP1_ARATH Geranylgeranyl py ... 411|POLN_SFV Non-structural polyprotein OS=Semliki forest ... virus PE=1 SV=2 Length = 2432 Score = 30.0 bits (6 ...

  2. AcEST: BP916713 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000090_F11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000090_F11. BP916713 CL1125C ... |P03315|POLS_SFV Structural polyprotein OS=Semliki forest ... viru... 32 1.5 sp|P25386|USO1_YEAST Intracellular ... |P03315|POLS_SFV Structural polyprotein OS=Semliki forest ... virus PE=1 SV=1 Length = 1253 Score = 32.3 bits (7 ...

  3. AcEST: BP918385 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_H05 417 Adiantum capillus-veneris mRNA. clone: YMU001_000112_H05. BP918385 - Show ... 7515|POLN_BFV Non-structural polyprotein OS=Barmah forest ... v... 30 4.9 sp|O43482|MS18B_HUMAN Protein Mis18-be ... 7515|POLN_BFV Non-structural polyprotein OS=Barmah forest ... virus PE=2 SV=2 Length = 2410 Score = 29.6 bits (6 ...

  4. AcEST: BP917399 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D02 518 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D02. BP917399 - Show ... s = 20/43 (46%) Frame = -3 Query: 432 CYGY*DATQRGRLCSR KCCLGVLLNVHIMLESITDCEDLMRFV 304 C G D T CSR ... CC+ L N ... ++ E D + + ++ Sbjct: 384 CVGSRDKTVGNEYCSR VCCMAALKNSQMVKERYPDTDVTIHYI 426 >sp|A2RRX6|NPAT_XEN ...

  5. AcEST: BP914683 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000061_G03 550 Adiantum capillus-veneris mRNA. clone: YMU001_000061_G03. BP914683 CL2571C ... *TFSPHHSSKTQGCGVPSKTAFNAACSFAFDLPMLNPRIHFEFSTQPLNKEPSG T 506 + +NS T +P + GVPSK + + S + P + + ST LN++PSG + ... PTGTPQQAQPDSMLGVPSKCVLDHSLSTVCNPPSAACQTPLDPSTDFLNQDPSG S 840 >sp|Q10199|IMP2_SCHPO Septation protein imp2 ... y: 378 GCGVPSKTAFNAACSFAFDLPMLNPRIHFEFS-----TQPLNKEPSG T 506 K++++ A +F P L+P E S Q LN EP G+ Sbjct: 1553 S ...

  6. AcEST: BP914352 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_H11 536 Adiantum capillus-veneris mRNA. clone: YMU001_000057_H11. BP914352 - Show ... /47 (53%), Gaps = 5/47 (10%) Frame = -2 Query: 505 PSG ESGRLRAQGCYTRSRVGRFEDYS-----DYNSGHIDYTSGHTGY 380 PS ... G+ G QG Y G +++YS +YN G+ +Y G+ GY Sbjct: 53 PSG QQGGY--QGGYQGGYQGGYQNYSQGGYQNYNQGYQNYNQGYQGY 97 >sp ... (45%), Gaps = 8/62 (12%) Frame = -2 Query: 517 REPNPSG ESGRLRAQGCYTRSRVGRFE----DYSDYNSGHIDYTS----GHTGYIRQG ...

  7. AcEST: BP914784 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000062_H01 525 Adiantum capillus-veneris mRNA. clone: YMU001_000062_H01. BP914784 - Show ... 4|SYR_DEIRA Arginyl-tRNA synthetase OS=Deinococcus radio durans Align length 174 Score (bit) 38.1 E-value 0. ... 4|SYR_DEIRA Arginyl-tRNA synthetase OS=Deinococcus radio ... 38 0.026 sp|Q9CAA8|PP108_ARATH Putative pentatr ...

  8. AcEST: BP916645 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000090_A01 525 Adiantum capillus-veneris mRNA. clone: YMU001_000090_A01. BP916645 CL2524C ... RSPEACHNWV---SARKGTIAGDSFLSDNCSQAFQ- 410 STETTH + ST S H ... SP+A V + + GDS S S + + Sbjct: 561 STETTHFRDSSTIS ... ISSGSMET 620 Query: 411 -SCPSLLLLPRFCERSSLVGTLYQNP*TSH ... 497 + P P E+S+ + ++P T+H Sbjct: 621 TALPGSTTKPGLSE ...

  9. AcEST: BP918089 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_E01 517 Adiantum capillus-veneris mRNA. clone: YMU001_000109_E01. BP918089 - Show ... 9U1|EFG_HERAR Elongation factor G OS=Herminiimonas arsenic ... 32 1.6 sp|A4SEF9|SECA_PROVI Protein translocase ... 9U1|EFG_HERAR Elongation factor G OS=Herminiimonas arsenic oxydans GN=fusA PE=3 SV=1 Length = 702 Score = 32.0 ...

  10. AcEST: BP912609 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H04 400 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H04. BP912609 CL1957C ... ) Frame = +2 Query: 227 DPILIAVETLLWRLWIW*GKPLVNLDWDRG EWQWPSLKADGVPLSFF 367 D +L AV+ + W W L N+ DRG +W +A ... GVPL F Sbjct: 419 DDLLAAVKGVNWTP-AWGETRLFNMVRDRG DWVISRQRAWGVPLPIF 464 >sp|Q71Y01|SYI_LISMF Isoleucy ...

  11. AcEST: BP916855 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000092_F07 488 Adiantum capillus-veneris mRNA. clone: YMU001_000092_F07. BP916855 CL436Co ... H Putative pyrophosphate-energized membrane proton pump ... 3 OS=Arabidopsis thaliana Align length 162 Score ( ... p|Q8RCX1|HPPA_THETN Pyrophosphate-energized proton pump ... OS=Ther... 178 1e-44 sp|Q8TJA8|HPPA2_METAC Pyropho ...

  12. AcEST: BP921672 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000152_G09 441 Adiantum capillus-veneris mRNA. clone: YMU001_000152_G09. BP921672 CL436Co ... AVP2_ARATH Pyrophosphate-energized membrane proton pump ... 2 OS=Arabidopsis thaliana Align length 146 Score ( ... p|Q8RCX1|HPPA_THETN Pyrophosphate-energized proton pump ... OS=Ther... 120 2e-27 sp|Q8PYZ8|HPPA1_METMA Pyropho ...

  13. AcEST: BP916377 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_A08 472 Adiantum capillus-veneris mRNA. clone: YMU001_000087_A08. BP916377 CL436Co ... AVP2_ARATH Pyrophosphate-energized membrane proton pump ... 2 OS=Arabidopsis thaliana Align length 157 Score ( ... p|Q8RCX1|HPPA_THETN Pyrophosphate-energized proton pump ... OS=Ther... 132 1e-30 sp|Q8TJA8|HPPA2_METAC Pyropho ...

  14. AcEST: BP912221 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E09 556 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E09. BP912221 CL436Co ... AVP2_ARATH Pyrophosphate-energized membrane proton pump ... 2 OS=Arabidopsis thaliana Align length 183 Score ( ... p|Q8RCX1|HPPA_THETN Pyrophosphate-energized proton pump ... OS=Ther... 159 9e-39 sp|Q82TF3|HPPA_NITEU Pyrophos ...

  15. AcEST: BP917107 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000096_A12 545 Adiantum capillus-veneris mRNA. clone: YMU001_000096_A12. BP917107 CL1370C ... VGLLATFSMILGNLIAVTQRS 302 Query: 134 VKRMLAYPSISQIGYI MIGVLSADSGNGYASMITYTFIYI LMNL 3 VKRMLA+ SISQIGYI MIGV ... LSADSGNGYASMITYTFIYI LMNL Sbjct: 303 VKRMLAFSSISQIGYI MIGVLSADSGNGYASMITY ... TFIYI LMNL 346 >sp|Q8W848|NU2C_PSINU NAD(P)H-quinone oxid ... LEILAILSMILGNLIAVTQTS 303 Query: 134 VKRMLAYPSISQIGYI MIGVLSADSGNGYASMITYTFIYI LMNL 3 +KRMLAY SISQIGYI +IG+ ...

  16. AcEST: BP917845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000106_C05 456 Adiantum capillus-veneris mRNA. clone: YMU001_000106_C05. BP917845 - Show ... ry: 96 MKYXXXXXXXXXXXXXXXTASSIGVVLKACGLHVTSIKIDPYLNTDA GTMSPFEHXXXXX 275 MKY ASS+G +LK+CGLHVT+IKIDPY+N DAG ... XXXXXXNYERFLDVTLTKDNNITRGKIYQSVISKERRGDYLGKTVQVVSHITDA ... 455 NYERFLD+ LTKDNN+T GKIYQSVI+KERRGDYLGKTVQVV HIT ... VDLDLGNYERFLDIRLTKDNNLTTGKIYQSVINKERRGDYLGKTVQVVPHITDA ... 120 >sp|P70698|PYRG1_MOUSE CTP synthase 1 OS=Mus m ... ry: 96 MKYXXXXXXXXXXXXXXXTASSIGVVLKACGLHVTSIKIDPYLNTDA GTMSPFEHXXXXX 275 MKY ASS+G +LK+CGLHVTSIKIDPY+N DAG ...

  17. AcEST: BP919977 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_E04 495 Adiantum capillus-veneris mRNA. clone: YMU001_000131_E04. BP919977 - Show ... 3KQ62|MORG1_XENLA Mitogen-activated protein kinase organize r 1 OS=Xenopus laevis Align length 75 Score (bit) 8 ... 3KQ62|MORG1_XENLA Mitogen-activated protein kinase organize r... 83 6e-16 sp|Q9BRX9|MORG1_HUMAN Mitogen-activat ...

  18. AcEST: BP920922 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000143_D08 599 Adiantum capillus-veneris mRNA. clone: YMU001_000143_D08. BP920922 - Show ... .....................done Score E Sequences producing s ignificant alignments: (bits) Value sp|P20973|UBE1 ... ositives = 161/195 (82%) Frame = -2 Query: 598 AMSSNGS PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAG ... ositives = 159/195 (81%) Frame = -2 Query: 598 AMSSNGS PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAG ... Positives = 123/192 (64%) Frame = -2 Query: 595 MSSNGS PSEMDIDEDLHSRQLAVYGRETMRRLFGANVLISGIQGLGVEIAKNIILAG ...

  19. AcEST: BP918931 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000119_B11 344 Adiantum capillus-veneris mRNA. clone: YMU001_000119_B11. BP918931 - Show ... .....................done Score E Sequences producing s ignificant alignments: (bits) Value sp|Q85FJ1|RPOA ... ), Positives = 111/114 (97%) Frame = -2 Query: 343 NGS PTPHEALRKASEKLMDLPTTFLYVRGGDVSLFENGEDSLDLTKSPSLQPQF ... GDTNNL 164 NGS ... TPHEALRKASEKLMDL TTFLYVRGGDVSLFENGEDSLDLTKSPSLQPQF ... GDTNNL Sbjct: 207 NGS LTPHEALRKASEKLMDLLTTFLYVRGGDVSLFENGEDSLDLTKSPSLQPQF ...

  20. AcEST: BP913706 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_D03 582 Adiantum capillus-veneris mRNA. clone: YMU001_000033_D03. BP913706 CL485Co ... .....................done Score E Sequences producing s ignificant alignments: (bits) Value sp|P10978|POLX ... = 118/191 (61%) Frame = -2 Query: 581 ILGVGDVQLKFQNGS SLWLKSVRHVPAIRKSLISTGKLDDAGYVTVFGNSAWKISKGSMT 402 I ... (46%), Gaps = 8/191 (4%) Frame = -2 Query: 557 LKFQNGS SLWLKSVRHVPAIRKSLISTGKLDDAGYVTVFGNSAWKISKGSMTVAHGSK ... s = 24/216 (11%) Frame = -2 Query: 581 ILGVGDVQLKFQNGS SLWLKSVRHVPAIRKSLISTGKLDDAGYVTVFGNSAWKISKGSMT 402 I ...

  1. AcEST: BP912963 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000024_H01 584 Adiantum capillus-veneris mRNA. clone: YMU001_000024_H01. BP912963 CL485Co ... .....................done Score E Sequences producing s ignificant alignments: (bits) Value sp|P10978|POLX ... = 118/191 (61%) Frame = -1 Query: 581 ILGVGDVQLKFQNGS SLWLKSVRHVPAIRKSLISTGKLDDAGYVTVFGNSAWKISKGSMT 402 I ... (46%), Gaps = 8/191 (4%) Frame = -1 Query: 557 LKFQNGS SLWLKSVRHVPAIRKSLISTGKLDDAGYVTVFGNSAWKISKGSMTVAHGSK ... s = 24/216 (11%) Frame = -1 Query: 581 ILGVGDVQLKFQNGS SLWLKSVRHVPAIRKSLISTGKLDDAGYVTVFGNSAWKISKGSMT 402 I ...

  2. AcEST: BP916242 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000085_A03 359 Adiantum capillus-veneris mRNA. clone: YMU001_000085_A03. BP916242 CL74Con ... .....................done Score E Sequences producing s ignificant alignments: (bits) Value sp|P17801|KPRO ... 98 VEMLSQGQKEFLAEIATIGGISHVNIVNLYGFCLEKKHRLLVYEYMENGS VDKWFFCKEG 277 +E + QG++ F AE++ IG I+H+N+V ++GFC E ... HRLLV EY+ENGS + F + G Sbjct: 564 LENVRQGKEVFQAELSVIGRINHMNLVRIWGF ... CSEGSHRLLVSEYVENGS LANILFSEGG 623 Query: 278 EQRQQVMSWETRYNVALGTARGLAY ...

  3. AcEST: BP914381 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_C06 430 Adiantum capillus-veneris mRNA. clone: YMU001_000058_C06. BP914381 CL1977C ... one Score E Sequences producing significant alignments : (bits) Value sp|Q9FYE4|CML50_ARATH Probable calci ... 4 GGSPSPPSQSYTAG---PAYG-AVVSSPFGTASGGSYGQ-SSQPAQTFNNTS FGQSASPX 80 G P PP Y++G P YG + SSP+ G S Q SS A T+ + ...

  4. AcEST: BP914487 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_D12 521 Adiantum capillus-veneris mRNA. clone: YMU001_000059_D12. BP914487 - Show ... one Score E Sequences producing significant alignments : (bits) Value sp|Q8BXJ9|TMM62_MOUSE Transmembrane ... one Score E Sequences producing significant alignments : (bits) Value tr|A7P4G0|A7P4G0_VITVI Chromosome ch ...

  5. AcEST: BP913199 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_F03 562 Adiantum capillus-veneris mRNA. clone: YMU001_000027_F03. BP913199 - Show ... one Score E Sequences producing significant alignments : (bits) Value sp|Q37145|ACA1_ARATH Calcium-transpo ... 472 Query: 317 AGEGIQEPH------KMTSSLSEKALEVLLEGIFQNTS GD-VVEYNDQRELLGSPTETAI 159 E +E + K S + E A+++LL+ I ...

  6. AcEST: BP916383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_B02 519 Adiantum capillus-veneris mRNA. clone: YMU001_000087_B02. BP916383 CL4106C ... one Score E Sequences producing significant alignments : (bits) Value sp|O22218|ACA4_ARATH Calcium-transpo ... y: 161 TNHMTVVKVCCFGFVEAADKVAR-----KLSDESRGLFCEGIFLNTS GE-ISERDGH 9 TNHM V KV V+ + ++ +LS+E + +GIF NT E + ...

  7. AcEST: BP914008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G11 577 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G11. BP914008 CL685Co ... Frame = +2 Query: 326 FFNRMQQLRTFSYQGTLFSNLLLSILAFFLY GWPKSTGISCISSG 460 +F L+TF+ G++F LSIL+ FLY ... +P + + C ... + SG Sbjct: 104 YFTTYIFLQTFAIPGSIF----LSILSGFLY PFPLALFLVCLCSG 144 >sp|Q5U4K5|TM41B_XENLA Transmemb ...

  8. AcEST: BP915509 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_E01 586 Adiantum capillus-veneris mRNA. clone: YMU001_000072_E01. BP915509 CL685Co ... Frame = +2 Query: 344 FFNRMQQLRTFSYQGTLFSNLLLSILAFFLY GWPKSTGISCISSG 478 +F L+TF+ G++F LSIL+ FLY ... +P + + C ... + SG Sbjct: 104 YFTTYIFLQTFAIPGSIF----LSILSGFLY PFPLALFLVCLCSG 144 >sp|Q5U4K5|TM41B_XENLA Transmemb ...

  9. AcEST: BP915637 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_H09 572 Adiantum capillus-veneris mRNA. clone: YMU001_000073_H09. BP915637 CL685Co ... Frame = +2 Query: 341 FFNRMQQLRTFSYQGTLFSNLLLSILAFFLY GWPKSTGISCISSG 475 +F L+TF+ G++F LSIL+ FLY ... +P + + C ... + SG Sbjct: 104 YFTTYIFLQTFAIPGSIF----LSILSGFLY PFPLALFLVCLCSG 144 >sp|Q5U4K5|TM41B_XENLA Transmemb ...

  10. AcEST: BP916258 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000085_C06 431 Adiantum capillus-veneris mRNA. clone: YMU001_000085_C06. BP916258 - Show ... = +2 Query: 122 PCT--------DPLLCASQP-TIVHNLLRTSDQLEPA SGT 214 PCT D AS P TIVHN RT + EPA ... G+ Sbjct: 45 PCTG ... RASSLARDSAAAASDPGTIVHNFSRTEPRTEPA GGS 84 >sp|Q474E1|SYV_RALEJ Valyl-tRNA synthetase O ...

  11. AcEST: BP919148 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_G06 472 Adiantum capillus-veneris mRNA. clone: YMU001_000121_G06. BP919148 CL741Co ... QDLNYCTHHKPCLNGATCSNTGQGSYTCSCRPGFSGASCEIEVNECTGNP-CRN ... 341 >sp|Q6H3X3|RET1G_HUMAN Retinoic acid early tra ... + QG+Y SCRP ++ +L + C P CR+ Sbjct: 285 NQDLNYCTHHKPCRN GATCTNTGQGSYTCSCRPGYTGANCELEVDECAPSP-CRN ... 338 TrEMBL ...

  12. AcEST: BP914339 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_G10 562 Adiantum capillus-veneris mRNA. clone: YMU001_000057_G10. BP914339 - Show ... ), Gaps = 2/37 (5%) Frame = +1 Query: 301 CLVKFRNHSTIN VIWIEEGEL--VDLVTVATLSRGLL 405 CLV TIN + W+E+G++ VDL ... T +T G L Sbjct: 135 CLVSGYTPGTIN ITWLEDGQVMDVDLSTASTTQEGEL 171 >sp|Q8NWQ6|EBH_STAAW ...

  13. AcEST: BP913732 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_F06 480 Adiantum capillus-veneris mRNA. clone: YMU001_000033_F06. BP913732 - Show ... EDGSLQLDSGTFNLHAVFREVLNL 429 Query: 361 VKPIASVKKLAVTL QLAPDLPEYAVGDNKRLMQTTLNVVG 480 +KPIASVKKL + L LAPDL ... EDGSLQLDIATFNLHAVFRQVFNL 429 Query: 361 VKPIASVKKLAVTL QLAPDLPEYAVGDNKRLMQTTLNVVG 480 +KPIASVKKL +TL ++PDL ... EDGSLQLDIGTFNLHALFREVHSL 443 Query: 361 VKPIASVKKLAVTL QLAPDLPEYAVGDNKRLMQTTLNVVG 480 +KPIASVKKL VTL ... L+ DL ... PEY +GD KRLMQ LNVVG Sbjct: 444 IKPIASVKKLFVTL SLSSDLPEYVIGDEKRLMQILLNVVG 483 >sp|O82436|ETR1_CUCM ...

  14. AcEST: BP918366 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F08 562 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F08. BP918366 CL1626C ... rame = +3 Query: 222 SFSRISLRDPFLLCCVVLVHLSGLFLTS-QMRI FSFFWLMTRMSSI 356 + SRI L LL C +LV ++ T +MRI ... FFW++T ... SI Sbjct: 52 AISRICLLCVILLDCFILVLYPDVYATGKEMRI IDFFWILTNHLSI 97 >sp|Q646F6|TA2R7_PAPHA Taste recep ...

  15. AcEST: BP914062 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D10 340 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D10. BP914062 - Show ... |Q08179|MDM38_YEAST Mitochondrial distribution and morphology ... ... 37 0.023 sp|Q5M5Q8|CNPD_STRT2 2',3'-cyclic-nuc ... |Q08179|MDM38_YEAST Mitochondrial distribution and morphology ... protein 38 OS=Saccharomyces cerevisiae GN=MDM38 PE ...

  16. AcEST: BP918600 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_D05 441 Adiantum capillus-veneris mRNA. clone: YMU001_000115_D05. BP918600 - Show ... |Q05930|MDM30_YEAST Mitochondrial distribution and morphology ... ... 29 9.8 >sp|P87293|YDN1_SCHPO Uncharacterized p ... |Q05930|MDM30_YEAST Mitochondrial distribution and morphology ... protein 30 OS=Saccharomyces cerevisiae GN=MDM30 PE ...

  17. AcEST: BP919627 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_C11 446 Adiantum capillus-veneris mRNA. clone: YMU001_000127_C11. BP919627 - Show ... |O60200|MDM35_YEAST Mitochondrial distribution and morphology ... ... 60 5e-09 sp|Q9D8Z2|TRIA1_MOUSE TP53-regulated ... |O60200|MDM35_YEAST Mitochondrial distribution and morphology ... protein 35 OS=Saccharomyces cerevisiae GN=MDM35 PE ...

  18. AcEST: BP921614 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000152_B05 584 Adiantum capillus-veneris mRNA. clone: YMU001_000152_B05. BP921614 CL3523C ... |Q06820|MDM36_YEAST Mitochondrial distribution and morphology ... ... 30 6.7 sp|A9NF23|RF2_ACHLI Peptide chain relea ... |Q06820|MDM36_YEAST Mitochondrial distribution and morphology ... protein 36 OS=Saccharomyces cerevisiae GN=MDM36 PE ...

  19. AcEST: BP914589 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000060_F12 590 Adiantum capillus-veneris mRNA. clone: YMU001_000060_F12. BP914589 - Show ... IPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYIEAFE KLKAL 492 Query: 316 XXXXXXXXXXNVCSPFEVQSNACGDCLELF ... (65%) Frame = +2 Query: 242 ICCPLHDLTKKNVKYSWTAKVQEAFE ... 319 + PL+ LTK++ ++W + Q AFE ... Sbjct: 438 LAAPLYALTKE ... STPFTWQTEHQLAFE ... 463 >sp|P31792|POL_FENV1 Pol polyprotein (Fragment ... (65%) Frame = +2 Query: 242 ICCPLHDLTKKNVKYSWTAKVQEAFE ... 319 + PL+ LTK++ ++W K Q AFE ... Sbjct: 295 LAAPLYALTKE ...

  20. AcEST: BP918060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_B08 474 Adiantum capillus-veneris mRNA. clone: YMU001_000109_B08. BP918060 CL1202C ... QLLFGIEKGTELLDVVRPAGSPLVDNWDCLK 431 Query: 172 AMVQAFE DHCGLLTSYGLKHMRAFANICNAGVDVCKMERVCSDVC 306 MV+ FE H ... VLLYGPGKGSSVLQSVRAPGSSLVDDWTCLK 433 Query: 172 AMVQAFE DHCGLLTSYGLKHMRAFANICNAGVDVCKMERVCSDVCD 309 +MV+ FE ... KILFGISRGPEVLNKVRSAGQPLVDDWNCLK 432 Query: 172 AMVQAFE DHCGLLTSYGLKHMRAFANICNAGVDVCKMERVCSDVC 306 V+AFE ... HC ... G L+ YG+KHMR+FANICNAG+ + +ME S C Sbjct: 433 NQVRAFE RHCGSLSQYGIKHMRSFANICNAGIQMEQMEEAASQAC 477 >sp|O243 ...