WorldWideScience

Sample records for arthrobacter sp bp

  1. Uptake of Glyphosate by an Arthrobacter sp

    OpenAIRE

    Pipke, Rüdiger; Schulz, Arno; Amrhein, Nikolaus

    1987-01-01

    The uptake of glyphosate (N-[phosphonomethyl]glycine) by an Arthrobacter sp. which can utilize this herbicide as its sole source of phosphorus was investigated. Orthophosphate suppressed the expression of the uptake system for glyphosate and also competed with glyphosate for uptake. The Km for glyphosate uptake was 125 μM, and the Ki for orthophosphate was 24 μM. Organophosphonates as well as organophosphates inhibited glyphosate uptake, but only organophosphates and orthophosphate suppressed...

  2. Complete genome sequence and metabolic potential of the quinaldine-degrading bacterium Arthrobacter sp. Rue61a

    Directory of Open Access Journals (Sweden)

    Niewerth Heiko

    2012-10-01

    Full Text Available Abstract Background Bacteria of the genus Arthrobacter are ubiquitous in soil environments and can be considered as true survivalists. Arthrobacter sp. strain Rue61a is an isolate from sewage sludge able to utilize quinaldine (2-methylquinoline as sole carbon and energy source. The genome provides insight into the molecular basis of the versatility and robustness of this environmental Arthrobacter strain. Results The genome of Arthrobacter sp. Rue61a consists of a single circular chromosome of 4,736,495 bp with an average G + C content of 62.32%, the circular 231,551-bp plasmid pARUE232, and the linear 112,992-bp plasmid pARUE113 that was already published. Plasmid pARUE232 is proposed to contribute to the resistance of Arthrobacter sp. Rue61a to arsenate and Pb2+, whereas the linear plasmid confers the ability to convert quinaldine to anthranilate. Remarkably, degradation of anthranilate exclusively proceeds via a CoA-thioester pathway. Apart from quinaldine utilization, strain Rue61a has a limited set of aromatic degradation pathways, enabling the utilization of 4-hydroxy-substituted aromatic carboxylic acids, which are characteristic products of lignin depolymerization, via ortho cleavage of protocatechuate. However, 4-hydroxyphenylacetate degradation likely proceeds via meta cleavage of homoprotocatechuate. The genome of strain Rue61a contains numerous genes associated with osmoprotection, and a high number of genes coding for transporters. It encodes a broad spectrum of enzymes for the uptake and utilization of various sugars and organic nitrogen compounds. A. aurescens TC-1 is the closest sequenced relative of strain Rue61a. Conclusions The genome of Arthrobacter sp. Rue61a reflects the saprophytic lifestyle and nutritional versatility of the organism and a strong adaptive potential to environmental stress. The circular plasmid pARUE232 and the linear plasmid pARUE113 contribute to heavy metal resistance and to the ability to degrade

  3. 2,3-Dihydroxybiphenyl dioxygenase gene was first discovered in Arthrobacter sp. strain P J3

    Institute of Scientific and Technical Information of China (English)

    YANG MeiYing; MA PengDa; LI WenMing; LIU JinYing; LI Liang; ZHU XiaoJuan; WANG XingZhi

    2007-01-01

    Bacterium strain PJ3, isolated from wastewater and identified as Arthrobacter sp. bacterium based on its 16S rDNA gene, could use carbazole as the sole carbon, nitrogen and energy source. The genomic libraryof strain PJ3 was constructed and a positive clone JM109 (pUCW402) was screened out for the expression of dioxygenase by the ability to form yellow ring-fission product. A 2,3-dihydroxybiphenyl dioxygenase (23DHBD) gene of 933 bp was found in the 3360 bp exogenous fragment of pUCW402 by GenSCAN software and BLAST analysis. The phylogenetic analysis showed that 23DHBD from strain PJ3 formed a deep branch separate from a cluster containing most known 23DHBD in GenBank.Southern hybridization confirmed for the first time that the 23DHBD gene was from the genomic DNA of Arthrobacter sp. PJ3. In order to test the gene function, recombinant bacterium BL21 (pETW-8) was constructed to express 23DHBD. The expression level in BL21 (pETW-8) was highest compared with the recombinant bacteria JM109 (pUCW402) and strain PJ3. We observed that 23DHBD was not absolute specific. The enzyme activity was higher with 2,3-dihydroxybiphenyl as a substrate than with catechol.The substrate specificity assay suggested that 23DHBD was essential for cleavage of bi-cyclic aromatic compounds during the course of aromatic compound biodegradation in Arthrobacter sp. strain PJ3.

  4. Adhesion of an Amylolytic Arthrobacter sp. to Starch-Containing Plastic Films

    OpenAIRE

    Imam, Syed H.; Gould, J. Michael

    1990-01-01

    Cells of the amylolytic bacterium KB-1 (thought to be an Arthrobacter sp.) adhered (∼70%) to the surface of plastic films composed of starch-poly (methylacrylate) graft copolymer (starch-PMA), but did not adhere (

  5. Plant compounds that induce polychlorinated biphenyl biodegradation by Arthrobacter sp. strain B1B.

    OpenAIRE

    Gilbert, E S; Crowley, D. E.

    1997-01-01

    Plant compounds that induced Arthrobacter sp. strain B1B to cometabolize polychlorinated biphenyls (PCBs) were identified by a screening assay based on the formation of a 4,4'-dichlorobiphenyl ring fission product. A chemical component of spearmint (Mentha spicata), l-carvone, induced Arthrobacter sp. strain B1B to cometabolize Aroclor 1242, resulting in significant degradation of 26 peaks in the mixture, including selected tetra- and pentachlorobiphenyls. Evidence for PCB biodegradation incl...

  6. Potential Degradation of Swainsonine by Intracellular Enzymes of Arthrobacter sp. HW08

    Directory of Open Access Journals (Sweden)

    Haili Li

    2013-11-01

    Full Text Available Swainsonine (SW is a toxin produced by locoweeds and harmful to the livestock industry. Degrading SW by Arthrobacter sp. HW08 was demonstrated as a promising way to deal with SW poisoning. However, it is unknown which part of the subcellular enzymes in Arthrobacter sp. HW08 is responsible for biodegrading SW and whether the metabolites are atoxic. In this study, intracellular and extracellular enzymes of Arthrobacter sp. HW08 were isolated and their enzyme activity was evaluated. The metabolites were fed to mice, and physiological and histological properties of the treated mice were investigated. The results showed that only intracellular enzyme of Arthrobacter sp. HW08 (IEHW08 could degrade SW efficiently. Compared with mice in SW treatment group, mice in SW + IEHW08 treatment group (1 increased their body weights; (2 showed higher number of platelets and lower number of white blood cells; (3 decreased the levels of creatinine, urea nitrogen, alanine transaminase and aspartate aminotransferase in serum; (4 reduced the number of vacuolated cells in cerebellum, liver and kidney. All these data demonstrate that IEHW08 was potentially safe for mice, while keeping the capacity of degrading SW. This study indicates a possible application of IEHW08 as an additive in the livestock industry to protect animals from SW poisoning.

  7. Isolation of Indole Utilizing Bacteria Arthrobacter sp. and Alcaligenes sp. From Livestock Waste.

    Science.gov (United States)

    Kim, Minsu; Lee, Jin-Hyung; Kim, Eonmi; Choi, Hyukjae; Kim, Younghoon; Lee, Jintae

    2016-06-01

    Indole is an interspecies and interkingdom signaling molecule widespread in different environmental compartment. Although multifaceted roles of indole in different biological systems have been established, little information is available on the microbial utilization of indole in the context of combating odor emissions from different types of waste. The present study was aimed at identifying novel bacteria capable of utilizing indole as the sole carbon and energy source. From the selective enrichment of swine waste and cattle feces, we identified Gram-positive and Gram-negative bacteria belonging to the genera Arthrobacter and Alcaligenes. Bacteria belonging to the genus Alcaligenes showed higher rates of indole utilization than Arthrobacter. Indole at 1.0 mM for growth was completely utilized by Alcaligenes sp. in 16 h. Both strains produced two intermediates, anthranilic acid and isatin, during aerobic indole metabolism. These isolates were also able to grow on several indole derivatives. Interestingly, an adaptive response in terms of a decrease in cell size was observed in both strains in the presence of indole. The present study will help to explain the degradation of indole by different bacteria and also the pathways through which it is catabolized. Furthermore, these novel bacterial isolates could be potentially useful for the in situ attenuation of odorant indole and its derivatives emitted from different types of livestock waste. PMID:27570307

  8. Isolation and characteristics of Arthrobacter sp. strain CW-1 for biodegradation of PAEs

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Isolation of new bacterial strains and recognition of their metabolic activities are highly desirable for sustainability of natural ecosystems. Biodegradation of dimethyl phthalate (DMP) under anoxic conditions has been shown to occur as a series of sequential steps using strain CW-1 isolated from digested sludge of Sibao Wastewater Treatment Plant in Hangzhou, China. The microbial colony on LB medium was yellowish, 3~5 mm in diameter, convex in the center, and embedded in mucous externally.The individual cells of strain CW-1 are irregular rods, measuring (0.6~0.7)×(0.9~1.0) μm, V-shaped, with clubbed ends, Gram positive and without any filaments. 16S rDNA (1438 bp) sequence analysis showed that the strain was related to Arthrobacter sp.CW-1 and can degrade PAEs utilizing nitrate as electron acceptor, but cannot mineralize DMP completely. The degradation pathway was recommended as: dimethyl phthalate (DMP)→monomethyl phthalate (MMP)→phthalic acid (PA). DMP biodegradation was a first order reaction with degradation rate constant of 0.3033 d-1 and half-life 2.25 d. The DMP conversion to PA by CW-1 could be described by using sequential kinetic model.

  9. Isolation, purification and characterization of xylanase produced by Arthrobacter sp. MTCC 5214 when grown in solid-state fermentation

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, R.; Bhosle, N.B.

    Thermoalkalophilic Arthrobacter sp. produced extracellular xylanase, when wheat bran, rice husk, rice bran and bagassae were used as carbon source under solid-state fermentation (SSF). The xylanase enzyme was isolated by ammonium sulfate (80...

  10. Improving the Survival of Arthrobacter sp., CW9 during Spray Drying Monitored by Scan Electric Microscope

    OpenAIRE

    Zhenqiang Xia; Ming Zhu; Yanqiu Zhang

    2014-01-01

    The culture of an aquaculture probiotic, i.e., Arthrobacter sp., CW9, was spray dried with different carriers/protectants, in which Scan Electric Microscope (SEM) was used to analyze the surface of micro-paticles produced by spray-drying. Matrix of protectants, inlet temperature and feed rate were optimized according to the survival rate after spray drying. Scanning electron micrographs showed that cracks formed on the particle surface were a key factor in enhancing bacteria survival during s...

  11. New metabolic pathway for degradation of 2-nitrobenzoate by Arthrobacter sp. SPG

    Science.gov (United States)

    Arora, Pankaj K.; Sharma, Ashutosh

    2015-01-01

    Arthrobacter sp. SPG utilized 2-nitrobenzoate as its sole source of carbon and energy and degraded it with accumulation of stoichiometric amounts of nitrite ions. Salicylate and catechol were detected as metabolites of the 2-nitrobenzoate degradation using high performance liquid chromatography and gas chromatography–mass spectrometry. Enzyme activities for 2-nitrobenzoate-2-monooxygenase, salicylate hydroxylase, and catechol-1,2-dioxygenase were detected in the crude extracts of the 2-nitrobenzoate-induced cells of strain SPG. The 2-nitrobenzoate-monooxygenase activity resulted in formation of salicylate and nitrite from 2-nitrobenzoate, whereas salicylate hydroxylase catalyzed the conversion of salicylate to catechol. The ring-cleaving enzyme, catechol-1,2-dioxygenase cleaved catechol to cis,cis-muconic acid. Cells of strain SPG were able to degrade 2-nitrobenzoate in sterile as well as non-sterile soil microcosms. The results of microcosm studies showed that strain SPG degraded more than 90% of 2-nitrobenzoate within 10–12 days. This study clearly shows that Arthrobacter sp. SPG degraded 2-nitrobenzoate via a new pathway with formation of salicylate and catechol as metabolites. Arthrobacter sp. SPG may be used for bioremediation of 2-nitrobenzoate-contaminated sites due to its ability to degrade 2-nitrobenzoate in soil. PMID:26082768

  12. New metabolic pathway for degradation of 2-nitrobenzoate by Arthrobacter sp. SPG

    Directory of Open Access Journals (Sweden)

    Pankaj Kumar Arora

    2015-06-01

    Full Text Available Arthrobacter sp. SPG utilized 2-nitrobenzoate as its sole source of carbon and energy and degraded it with accumulation of stoichiometric amounts of nitrite ions. Salicylate and catechol were detected as metabolites of the 2-nitrobenzoate degradation using high performance liquid chromatography and gas chromatography-mass spectrometry. Enzyme activities for 2-nitrobenzoate-2-monooxygenase, salicylate hydroxylase, and catechol-1,2-dioxygenase were detected in the crude extracts of the 2-nitrobenzoate-induced cells of strain SPG. The 2-nitrobenzoate-monooxygenase activity resulted in formation of salicylate and nitrite from 2-nitrobenzoate whereas salicylate hydroxylase catalyzed the conversion of salicylate to catechol. The ring-cleaving enzyme, catechol-1,2-dioxygenase cleaved catechol to cis, cis-muconic acid. Cells of strain SPG were able to degrade 2-nitrobenzoate in sterile as well as non-sterile soil microcosms. The results of microcosm studies showed that strain SPG degraded more than 90% of 2-nitrobenzoate within 10-12 days. This study clearly shows that Arthrobacter sp. SPG degraded 2-nitrobenzoate via a new pathway with formation of salicylate and catechol as metabolites. Arthrobacter sp. SPG may be used for bioremediation of 2-nitrobenzoate-contaminated sites due to its ability to degrade 2-nitrobenzoate in soil.

  13. Biosorption of Lead(II) by Arthrobacter sp. 25: Process Optimization and Mechanism.

    Science.gov (United States)

    Jin, Yu; Wang, Xin; Zang, Tingting; Hu, Yang; Hu, Xiaojing; Ren, Guangming; Xu, Xiuhong; Qu, Juanjuan

    2016-08-28

    In the present work, Arthrobacter sp. 25, a lead-tolerant bacterium, was assayed to remove lead(II) from aqueous solution. The biosorption process was optimized by response surface methodology (RSM) based on the Box-Behnken design. The relationships between dependent and independent variables were quantitatively determined by second-order polynomial equation and 3D response surface plots. The biosorption mechanism was explored by characterization of the biosorbent before and after biosorption using atomic force microscopy (AFM), scanning electron microscopy, energy dispersive X-ray spectroscopy, X-ray diffraction, and Fourier transform infrared spectroscopy. The results showed that the maximum adsorption capacity of 9.6 mg/g was obtained at the initial lead ion concentration of 108.79 mg/l, pH value of 5.75, and biosorbent dosage of 9.9 g/l (fresh weight), which was close to the theoretically expected value of 9.88 mg/g. Arthrobacter sp. 25 is an ellipsoidalshaped bacterium covered with extracellular polymeric substances. The biosorption mechanism involved physical adsorption and microprecipitation as well as ion exchange, and functional groups such as phosphoryl, hydroxyl, amino, amide, carbonyl, and phosphate groups played vital roles in adsorption. The results indicate that Arthrobacter sp. 25 may be potentially used as a biosorbent for low-concentration lead(II) removal from wastewater. PMID:27197671

  14. Cesium and strontium tolerant Arthrobacter sp. strain KMSZP6 isolated from a pristine uranium ore deposit.

    Science.gov (United States)

    Swer, Pynskhem Bok; Joshi, Santa Ram; Acharya, Celin

    2016-12-01

    Arthrobacter sp. KMSZP6 isolated from a pristine uranium ore deposit at Domiasiat located in North-East India exhibited noteworthy tolerance for cesium (Cs) and strontium (Sr). The strain displayed a high minimum inhibitory concentration (MIC) of 400 mM for CsCl and for SrCl2. Flow cytometric analysis employing membrane integrity indicators like propidium iodide (PI) and thiazole orange (TO) indicated a greater sensitivity of Arthrobacter cells to cesium than to strontium. On being challenged with 75 mM of Cs, the cells sequestered 9612 mg Cs g(-1) dry weight of cells in 12 h. On being challenged with 75 mM of Sr, the cells sequestered 9989 mg Sr g(-1) dry weight of cells in 18 h. Heat killed cells exhibited limited Cs and Sr binding as compared to live cells highlighting the importance of cell viability for optimal binding. The association of the metals with Arthrobacter sp. KMSZP6 was further substantiated by Field Emission-Scanning Electron Microscopy (FE-SEM) coupled with Energy dispersive X-ray (EDX) spectroscopy. This organism tolerated up to 1 kGy (60)Co-gamma rays without loss of survival. The present report highlights the superior tolerance and binding capacity of the KMSZP6 strain for cesium and strontium over other earlier reported strains and reveals its potential for bioremediation of nuclear waste. PMID:27620733

  15. Growth of Arthrobacter sp. strain JBH1 on nitroglycerin as the sole source of carbon and nitrogen.

    Science.gov (United States)

    Husserl, Johana; Spain, Jim C; Hughes, Joseph B

    2010-03-01

    Arthrobacter sp. strain JBH1 was isolated from nitroglycerin-contaminated soil by selective enrichment. Detection of transient intermediates and simultaneous adaptation studies with potential intermediates indicated that the degradation pathway involves the conversion of nitroglycerin to glycerol via 1,2-dinitroglycerin and 1-mononitroglycerin, with concomitant release of nitrite. Glycerol then serves as the source of carbon and energy.

  16. Draft Genome Sequence of a Papaverine-Degrading, Gram-positive Arthrobacter sp., Isolated from Soil Near Hohenheim, Germany

    OpenAIRE

    Reznicek, Ondrej; Facey, Sandra J; Hauer, Bernhard

    2015-01-01

    We present the 4.8-Mb draft genome of a soil bacterium identified as Arthrobacter sp. This Gram-positive soil bacterium is able to use the aromatic compound papaverine as sole carbon source and will be examined for novel oxygenases.

  17. Biodegradation of p-nitrophenol via 1,2,4-benzenetriol by an Arthrobacter sp.

    Energy Technology Data Exchange (ETDEWEB)

    Jain, R.K.; Spain, J.C. [Armstrong Lab., Tyndall Air Force Base, FL (United States); Dreisbach, J.H. [Univ. of Scranton, PA (United States)

    1994-08-01

    The degradation of p-nitrophenol (PNP) by Moraxella and Pseudomonas spp. involves an initial monooxygenase-catalyzed removal of the nitro group. The resultant hydroquinone is subject to ring fission catalyzed by a dioxygenase enzyme. A strain of an Arthrobacter sp. JS443, capable of degrading PNP with stoichiometric release of nitrite has been isolated. During induction of the enzymes required for growth on PNP, 1,2,4-benzenetriol was identified as an intermediate by gas chromatography-mass spectroscopy and radiotracer studies. 1,2,4-Benzenetriol was converted to maleylacetic acid, which was further degraded by the beta-ketoadipate pathway. Conversion of PNP to 1,2,4-benzenetriol is catalyzed by a monooxygenase system in strain JS443 through the formation of 4-nitrocatechol, 4-nitroresorcinol, or both. Results clearly indicate the existence of an alternative pathway for the biodegradation of PNP. 15 refs, 2 figs., 2 tabs.

  18. Purification and characterization of alpha-L-arabinofuranosidase from Arthrobacter sp. MTCC 5214 in solid-state fermentation

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, R.; Numan, M.T.H.; Mukherjee, B.; Satwekar, A.; Bhosle, N.B.

    protein following the method of bicinchoninic acid with bovine serum albumin as the standard [27]. The protein content of the chromatographic eluents was measured by monitoring the absorbance at 280 nm. 2.6. Preparation of enzyme Erlenmeyer flask (500 ml... cellulose [31] and Aspergillus kawachii [32]. This may indicate the constitutive nature of a-L-AFase production in Arthrobacter sp. 3.2. Growth and enzyme production Aswheatbraninducesoptimalexpressionofa-L-AFaseinSSF,it was used for further studies...

  19. High-level chromate resistance in Arthrobacter sp. strain FB24 requires previously uncharacterized accessory genes

    Directory of Open Access Journals (Sweden)

    Thompson Dorothea K

    2009-09-01

    Full Text Available Abstract Background The genome of Arthrobacter sp. strain FB24 contains a chromate resistance determinant (CRD, consisting of a cluster of 8 genes located on a 10.6 kb fragment of a 96 kb plasmid. The CRD includes chrA, which encodes a putative chromate efflux protein, and three genes with amino acid similarities to the amino and carboxy termini of ChrB, a putative regulatory protein. There are also three novel genes that have not been previously associated with chromate resistance in other bacteria; they encode an oxidoreductase (most similar to malate:quinone oxidoreductase, a functionally unknown protein with a WD40 repeat domain and a lipoprotein. To delineate the contribution of the CRD genes to the FB24 chromate [Cr(VI] response, we evaluated the growth of mutant strains bearing regions of the CRD and transcript expression levels in response to Cr(VI challenge. Results A chromate-sensitive mutant (strain D11 was generated by curing FB24 of its 96-kb plasmid. Elemental analysis indicated that chromate-exposed cells of strain D11 accumulated three times more chromium than strain FB24. Introduction of the CRD into strain D11 conferred chromate resistance comparable to wild-type levels, whereas deletion of specific regions of the CRD led to decreased resistance. Using real-time reverse transcriptase PCR, we show that expression of each gene within the CRD is specifically induced in response to chromate but not by lead, hydrogen peroxide or arsenate. Higher levels of chrA expression were achieved when the chrB orthologs and the WD40 repeat domain genes were present, suggesting their possible regulatory roles. Conclusion Our findings indicate that chromate resistance in Arthrobacter sp. strain FB24 is due to chromate efflux through the ChrA transport protein. More importantly, new genes have been identified as having significant roles in chromate resistance. Collectively, the functional predictions of these additional genes suggest the

  20. Biodegradation of nitroglycerin in porous media and potential for bioaugmentation with Arthrobacter sp. strain JBH1.

    Science.gov (United States)

    Husserl, Johana; Hughes, Joseph B

    2013-07-01

    Nitroglycerin (NG) is a toxic explosive found as a contaminant of soil and groundwater. Several microbial strains are capable of partially reducing the NG molecule to dinitro or mononitroesters. Recently, a strain capable of growing on NG as the sole source of carbon and nitrogen (Arthrobacter sp. strain JBH1) was isolated from contaminated soil. Despite the widespread presence of microbial strains capable of transforming NG in contaminated soils and sediments, the extent of NG biodegradation at contaminated sites is still unknown. In this study column experiments were conducted to investigate the extent of microbial degradation of NG in saturated porous media, specifically after bioaugmentation with JBH1. Initial experiments using sterile, low sorptivity sand, showed mineralization of NG after bioaugmentation with JBH1 in the absence of sources of carbon and nitrogen other than NG. Results could be modeled using a first order degradation rate of 0.14d(-1). Further experiments conducted using contaminated soil with high organic carbon content (highly sorptive) resulted in column effluents that did not contain NG although high dinitroester concentrations were observed. Bioaugmentation with JBH1 in sediments containing strains capable of partial transformation of NG resulted in complete mineralization of NG and faster degradation rates.

  1. Combined bioremediation of atrazine-contaminated soil by Pennisetum and Arthrobacter sp. strain DNS10.

    Science.gov (United States)

    Zhang, Ying; Ge, Shijie; Jiang, Mingyue; Jiang, Zhao; Wang, Zhigang; Ma, Bingbing

    2014-05-01

    Strain DNS10 was isolated from the black soil collected from the northeast of China which had been cultivated with atrazine as the sole nitrogen source. Pennisetum is a common plant in Heilongjiang Province of China. The main objective of this paper was to evaluate the efficiency of plant-microbe joint interactions (Arthrobacter sp. DNS10 + Pennisetum) in atrazine degradation compared with single-strain and single-plant effects. Plant-microbe joint interactions degraded 98.10 % of the atrazine, while single strain and single plant only degraded 87.38 and 66.71 % after a 30-day experimental period, respectively. The results indicated that plant-microbe joint interactions had a better degradation effect. Meanwhile, we found that plant-microbe joint interactions showed a higher microbial diversity. The results of microbial diversity illustrated that the positive effects of cropping could improve soil microbial growth and activity. In addition, we planted atrazine-sensitive plants (soybean) in the soil after repair. The results showed that soybean growth in soil previously treated with the plant-microbe joint interactions treatment was better compared with other treatments after 20 days of growth. This was further proved that the soil is more conducive for crop cultivation. Hence, plant-microbe joint interactions are considered to be a potential tool in the remediation of atrazine-contaminated soil.

  2. s-triazine degrading bacterial isolate Arthrobacter sp. AK-YN10, a candidate for bioaugmentation of atrazine contaminated soil.

    Science.gov (United States)

    Sagarkar, Sneha; Bhardwaj, Pooja; Storck, Veronika; Devers-Lamrani, Marion; Martin-Laurent, Fabrice; Kapley, Atya

    2016-01-01

    The Arthrobacter sp. strain AK-YN10 is an s-triazine pesticide degrading bacterium isolated from a sugarcane field in Central India with history of repeated atrazine use. AK-YN10 was shown to degrade 99 % of atrazine in 30 h from media supplemented with 1000 mg L(-1) of the herbicide. Draft genome sequencing revealed similarity to pAO1, TC1, and TC2 catabolic plasmids of the Arthrobacter taxon. Plasmid profiling analyses revealed the presence of four catabolic plasmids. The trzN, atzB, and atzC atrazine-degrading genes were located on a plasmid of approximately 113 kb.The flagellar operon found in the AK-YN10 draft genome suggests motility, an interesting trait for a bioremediation agent, and was homologous to that of Arthrobacter chlorophenolicus. The multiple s-triazines degradation property of this isolate makes it a good candidate for bioremediation of soils contaminated by s-triazine pesticides. PMID:26403923

  3. s-triazine degrading bacterial isolate Arthrobacter sp. AK-YN10, a candidate for bioaugmentation of atrazine contaminated soil.

    Science.gov (United States)

    Sagarkar, Sneha; Bhardwaj, Pooja; Storck, Veronika; Devers-Lamrani, Marion; Martin-Laurent, Fabrice; Kapley, Atya

    2016-01-01

    The Arthrobacter sp. strain AK-YN10 is an s-triazine pesticide degrading bacterium isolated from a sugarcane field in Central India with history of repeated atrazine use. AK-YN10 was shown to degrade 99 % of atrazine in 30 h from media supplemented with 1000 mg L(-1) of the herbicide. Draft genome sequencing revealed similarity to pAO1, TC1, and TC2 catabolic plasmids of the Arthrobacter taxon. Plasmid profiling analyses revealed the presence of four catabolic plasmids. The trzN, atzB, and atzC atrazine-degrading genes were located on a plasmid of approximately 113 kb.The flagellar operon found in the AK-YN10 draft genome suggests motility, an interesting trait for a bioremediation agent, and was homologous to that of Arthrobacter chlorophenolicus. The multiple s-triazines degradation property of this isolate makes it a good candidate for bioremediation of soils contaminated by s-triazine pesticides.

  4. Optimization of Endoglucanase Production from a Novel Bacterial Isolate, Arthrobacter sp. HPG166 and Characterization of Its Properties

    Directory of Open Access Journals (Sweden)

    Shengwei Huang

    2015-10-01

    Full Text Available ABSTRACTIn this study, a potential novel cellulolytic bacteriumArthrobacter sp. HPG166 was isolated from the hindgut of root-feeding larvaeHolotrichia parallela. Optimization of fermentation factors for endoglucanase production byArthrobacter sp. HPG166 was carried out via response surface methodology. Sodium carboxymethylcellulose 1.19% (w/v and beef extract 0.35% (w/v were the ideal combination of carbon and nitrogen sources for enzyme production; the optimum temperature and pH for cellulase production were 34°C and pH 8.0 respectively. Under the optimized fermentation conditions, the maximum endoglucanase activity of 1.411 U mL-1 was obtained. The crude endoglucanase was thermotolerant as it retained 50.31% of its activity after incubation at 70°C for an hour. Metal profile of the enzyme indicated that Mg2+ and Na+ were strong stimulators while Mn2+ and Co+ drastically inhibited its activity. Due to its particular characteristics, this enzyme could have potential for industrial applications.

  5. A method for the production of D-tagatose using a recombinant Pichia pastoris strain secreting β-D-galactosidase from Arthrobacter chlorophenolicus and a recombinant L-arabinose isomerase from Arthrobacter sp. 22c

    Directory of Open Access Journals (Sweden)

    Wanarska Marta

    2012-08-01

    Full Text Available Abstract Background D-Tagatose is a natural monosaccharide which can be used as a low-calorie sugar substitute in food, beverages and pharmaceutical products. It is also currently being tested as an anti-diabetic and obesity control drug. D-Tagatose is a rare sugar, but it can be manufactured by the chemical or enzymatic isomerization of D-galactose obtained by a β-D-galactosidase-catalyzed hydrolysis of milk sugar lactose and the separation of D-glucose and D-galactose. L-Arabinose isomerases catalyze in vitro the conversion of D-galactose to D-tagatose and are the most promising enzymes for the large-scale production of D-tagatose. Results In this study, the araA gene from psychrotolerant Antarctic bacterium Arthrobacter sp. 22c was isolated, cloned and expressed in Escherichia coli. The active form of recombinant Arthrobacter sp. 22c L-arabinose isomerase consists of six subunits with a combined molecular weight of approximately 335 kDa. The maximum activity of this enzyme towards D-galactose was determined as occurring at 52°C; however, it exhibited over 60% of maximum activity at 30°C. The recombinant Arthrobacter sp. 22c L-arabinose isomerase was optimally active at a broad pH range of 5 to 9. This enzyme is not dependent on divalent metal ions, since it was only marginally activated by Mg2+, Mn2+ or Ca2+ and slightly inhibited by Co2+ or Ni2+. The bioconversion yield of D-galactose to D-tagatose by the purified L-arabinose isomerase reached 30% after 36 h at 50°C. In this study, a recombinant Pichia pastoris yeast strain secreting β-D-galactosidase Arthrobacter chlorophenolicus was also constructed. During cultivation of this strain in a whey permeate, lactose was hydrolyzed and D-glucose was metabolized, whereas D-galactose was accumulated in the medium. Moreover, cultivation of the P. pastoris strain secreting β-D-galactosidase in a whey permeate supplemented with Arthrobacter sp. 22c L-arabinose isomerase resulted in a 90% yield

  6. Effects of Cd (Ⅱ) on the physico-biochemical behaviors of Arthrobacter sp.and Bacillus sp.%镉胁迫对节杆菌(Arthrobacter sp.)和芽孢杆菌(Bacillus sp.)生理生化特性的影响

    Institute of Scientific and Technical Information of China (English)

    杜瑞英

    2012-01-01

    将节杆菌和芽孢杆菌分别暴露于不同质量比的镉溶液中,进行不同暴露时间的急性毒性试验.结果表明,20 mg/kg的Cd(Ⅱ)处理会使节杆菌中还原型谷胱甘肽(GSH)质量浓度显著降低,细胞膜脂质过氧化产物——硫代巴比妥酸活性物质(TBARS)浓度显著升高;0.2mg/kg的Cd(Ⅱ)处理会使芽孢杆菌中GSH质量浓度、过氧化氢酶(CAT)活性显著降低.节杆菌的可溶性蛋白、可溶性糖质量浓度随暴露时间延长而减少,GSH质量浓度、CAT和超氧化物歧化酶(SOD)活性随暴露时间延长而增加,TBARS浓度呈先减后增的变化趋势;芽孢杆菌的可溶性蛋白质量浓度、CAT活性和TBARS浓度呈先增后减的变化趋势,可溶性糖、GSH质量浓度和SOD活性呈先减后增的变化趋势.镉处理对节杆菌和芽孢杆菌具有一定的胁迫作用,两种菌通过启动不同的抗性系统来抵抗外界胁迫.%This paper is engaged in the study of the effects of Cd(II) on the physico-biochemical behaviors of Arthrobacter sp. through tox-icity testing. The toxicity test has been arranged by putting the an-tioxidant system of Arthrobacter sp. and Bacillus sp. under the exposure to different concentrations of Cd(II) for different lengths of testing time. The results of our testing show that Cd(II) has a strong impact on the antioxidant system of Arthrobacter sp. and Bacillus sp. . However, it is possible to reduce GSH content and increase TBARS content of Arthrobacter sp. significantly by letting Cd(II) treated with 20 mg/kg. Our testing proves that it is possible to reduce the GSH content and CAT activity of Bacillus sp. significantly by treating Cd(II) with 0.2 mg/kg, for the Arthrobacter sp. , the soluble protein and soluble sugar content can be reduced through prolonging the time of exposure. On the contrary, it is also possible to increase the GSH content and the CAT & SOD activity by means of prolonging the exposure, with the TBARS content

  7. Production of Xylanase from Arthrobacter sp. MTCC 6915 Using Saw Dust As Substrate under Solid State Fermentation

    Directory of Open Access Journals (Sweden)

    Sevanan Murugan

    2011-01-01

    Full Text Available Saw dust was used as substrate for xylanase production from Arthrobacter sp. MTCC 6915. The study of period of incubation, temperature, pH, carbon, and nitrogen sources for xylanase production was optimized. Xylanase production was found to be optimum at an incubation period of 96 hrs (117.0 U/mL, temperature 30°C (105.0 U/mL, and pH 9.0 (102.9 U/mL. The results showed that the xylanase production was found to be higher in the presence of carboxymethylcellulose (176.4 U/mL and dextrose (126.0 U/mL. It was also observed that peptone (170.1 U/mL and beef extract (161.7 U/mL supported maximum xylanase production.The enzyme was characterized and found to be fairly active at pH 9 (764.4 U/mL and temperature 60°C (819 U/mL. Even in the present study, a major difference in the production temperature (30°C and optimal temperature (60°C of the enzyme activity was observed. However, the pH of the production media and the enzyme activity were found to be the same (pH 9.

  8. Proizvodnja β-fruktofuranozidaze s pomoću bakterije Arthrobacter sp. i primjena tog enzima u pretvorbi steviozida i rebaudiozida A

    OpenAIRE

    Xu, Zhong-Wei; Li, Yu-Qiang; Wang, Yong-Hua; Yang, Bo; Ning, Zheng-Xiang

    2009-01-01

    U proizvodnji enzima β-fruktofuranozidaze upotrijebljen je soj bakterije Arthrobacter sp. 10137. Kao najbolji izvori ugljika i dušika za proizvodnju enzima u pokusu na tresilici upotrijebljeni su saharoza i kukuruzni ekstrakt u omjeru 10:1. Maksimalna aktivnost β-fruktofuranozidaze od 26,69 U/mL postignuta je šaržnim uzgojem nakon 22,5 h. Sirovi enzim β-fruktofuranozidaza, dobiven ultrafiltracijom i frakcioniranjem s (NH4)2SO4, pročišćen je 7 puta, što je potvrđeno usporedbom specifične aktiv...

  9. Isolation and characterization of atrazine-degrading Arthrobacter sp. AD26 and use of this strain in bioremediation of contaminated soil

    Institute of Scientific and Technical Information of China (English)

    LI Qingyan; LI Ying; ZHU Xikun; CAI Baoli

    2008-01-01

    A bacterial strain (AD26) capable of utilizing atrazine as a sole nitrogen source for growth was isolated from an industrial wastewatersample by enrichment culture. The 16S rRNA gene sequencing identified AD26 as anArthrobacter sp. PCR assays indicated that AD26contained atrazine-degrading genes trzN and atzBC. The trzN gene of AD26 only differs from the trzN ofArthrobacter aurescens TC1by one base (A→T at 907) and one amino acid (Met→Leu at 303). The specific activity of trzN of AD26 in crude cell extract was0.28 U/mg, which was 1.2 times that of TC 1. This strain has shown faster growth and atrazine-degradation rates in atrazine-containingminimal media than two well characterized atrazine-degrading bacteria, Pseudomonas sp. ADP and Arthrobacter aurescens TC 1. Afterincubating for 48 h at 30℃, the OD600 of AD26 reached 2.6 compared with 1.33 of ADP. AD26 was capable of degrading 500 mg/Lof atrazine in minimal medium at 95% in 72 h, while the degradative rates by TC1 and ADP were only 90% and 86%, respectively. Abioremediation trial of contaminated soil has indicated that AD26 can degrade as high as 98% of atrazine contained in soil (300 mg/kg)after incubating for 20 d at 26℃, nominating this strain as a good candidate for use in bioremediation programs.

  10. Identification of a recombinant inulin fructotransferase (difructose dianhydride III forming) from Arthrobacter sp. 161MFSha2.1 with high specific activity and remarkable thermostability.

    Science.gov (United States)

    Wang, Xiao; Yu, Shuhuai; Zhang, Tao; Jiang, Bo; Mu, Wanmeng

    2015-04-01

    Difructose dianhydride III (DFA III) is a functional carbohydrate produced from inulin by inulin fructotransferase (IFTase, EC 4.2.2.18). In this work, an IFTase gene from Arthrobacter sp. 161MFSha2.1 was cloned and expressed in Escherachia coli. The recombinant enzyme was purified by metal affinity chromatography. It showed significant inulin hydrolysis activity, and the produced main product from inulin was determined as DFA III by nuclear magnetic resonance analysis. The molecular mass of the purified protein was calculated to be 43 and 125 kDa by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and gel filtration, respectively, suggesting the native enzyme might be a homotrimer. The recombinant enzyme showed maximal activity as 2391 units/mg at pH 6.5 and 55 °C. It displayed the highest thermostability among previously reported IFTases (DFA III forming) and was stable up to 80 °C for 4 h of incubation. The smallest substrate was determined as nystose. The conversion ratio of inulin to DFA III reached 81% when 100 g/L inulin was catalyzed by 80 nM recombinant enzyme for 20 min at pH 6.5 and 55 °C. All of these data indicated that the IFTase (DFA III forming) from Arthrobacter sp. 161MFSha2.1 had great potential for industrial DFA III production.

  11. Evaluation of chromate reductase activity in the cell-free culture filtrate of Arthrobacter sp. SUK 1201 isolated from chromite mine overburden.

    Science.gov (United States)

    Dey, Satarupa; Paul, A K

    2016-08-01

    Arthrobacter sp. SUK 1201, a chromate resistant and reducing bacterium isolated from chromite mine overburden of Sukinda valley, Odisha, India has been evaluated for its hexavalent chromium [Cr(VI)] reduction potential using cell-free culture filtrate as extracellular chromate reductase enzyme. Production of the enzyme was enhanced in presence of Cr(VI) and its reducing efficiency was increased with increasing concentration of Cr(VI). The Michaelis-Menten constant (Km) and the maximum specific velocity (Vmax) of the extracellular Cr(VI) reductase were calculated to be 54.03 μM Cr(VI) and 5.803 U mg(-1) of protein respectively showing high affinity towards Cr(VI). The reducing activity of the enzyme was maximum at pH 6.5-7.5 and at a temperature of 35 °C and was dependent on NADH. The enzyme was tolerant to different metals such as Mn(II), Mg(II) and Fe(III) and was able to reduce Cr(VI) present in chromite mine seepage. These findings suggest that the extracellular chromate reductase of Arthrobacter sp. SUK 1201 has a great promise for use in Cr(VI) detoxification under different environmental conditions, particularly in the mining waste water treatment systems. PMID:27176938

  12. A new cold-adapted β-D-galactosidase from the Antarctic Arthrobacter sp. 32c – gene cloning, overexpression, purification and properties

    Directory of Open Access Journals (Sweden)

    Kur Józef

    2009-07-01

    Full Text Available Abstract Background The development of a new cold-active β-D-galactosidases and microorganisms that efficiently ferment lactose is of high biotechnological interest, particularly for lactose removal in milk and dairy products at low temperatures and for cheese whey bioremediation processes with simultaneous bio-ethanol production. Results In this article, we present a new β-D-galactosidase as a candidate to be applied in the above mentioned biotechnological processes. The gene encoding this β-D-galactosidase has been isolated from the genomic DNA library of Antarctic bacterium Arthrobacter sp. 32c, sequenced, cloned, expressed in Escherichia coli and Pichia pastoris, purified and characterized. 27 mg of β-D-galactosidase was purified from 1 L of culture with the use of an intracellular E. coli expression system. The protein was also produced extracellularly by P. pastoris in high amounts giving approximately 137 mg and 97 mg of purified enzyme from 1 L of P. pastoris culture for the AOX1 and a constitutive system, respectively. The enzyme was purified to electrophoretic homogeneity by using either one step- or a fast two step- procedure including protein precipitation and affinity chromatography. The enzyme was found to be active as a homotrimeric protein consisting of 695 amino acid residues in each monomer. Although, the maximum activity of the enzyme was determined at pH 6.5 and 50°C, 60% of the maximum activity of the enzyme was determined at 25°C and 15% of the maximum activity was detected at 0°C. Conclusion The properties of Arthrobacter sp. 32cβ-D-galactosidase suggest that this enzyme could be useful for low-cost, industrial conversion of lactose into galactose and glucose in milk products and could be an interesting alternative for the production of ethanol from lactose-based feedstock.

  13. Probing the Role of Two Critical Residues in Inulin Fructotransferase (DFA III-Producing) Thermostability from Arthrobacter sp. 161MFSha2.1.

    Science.gov (United States)

    Yu, Shuhuai; Wang, Xiao; Zhang, Tao; Jiang, Bo; Mu, Wanmeng

    2016-08-10

    Inulin fructotransferase (IFTase) is an important enzyme that produces di-d-fructofuranose 1,2':2,3' dianhydride (DAF III), which is beneficial for human health. Present investigations mainly focus on screening and characterizing IFTase, including catalytic efficiency and thermostability, which are two important factors for enzymatic industrial applications. However, few reports aimed to improve these two characteristics based on the structure of IFTase. In this work, a structural model of IFTase (DFA III-producing) from Arthrobacter sp. 161MFSha2.1 was constructed through homology modeling. Analysis of this model reveals that two residues, Ser-309 and Ser-333, may play key roles in the structural stability. Therefore, the functions of the two residues were probed by site-directed mutagenesis combined with the Nano-DSC method and assays for residual activity. In contrast to other mutations, single mutation of serine 309 (or serine 333) to threonine did not decrease the enzymatic stability, whereas double mutation (serine 309 and serine 333 to threonine) can enhance thermostability (by approximately 5 °C). The probable mechanisms for this enhancement were investigated.

  14. Enhanced U(VI) release from autunite mineral by aerobic Arthrobacter sp. in the presence of aqueous bicarbonate

    Energy Technology Data Exchange (ETDEWEB)

    Katsenovich, Yelena; Carvajal, Denny A.; Wellman, Dawn M.; Lagos, Leonel

    2012-04-20

    The bacterial effect on U(VI) leaching from the autunite mineral (Ca[(UO{sub 2})(PO{sub 4})]{sub 2} {center_dot} 3H{sub 2}O) was investigated to provide a more comprehensive understanding into important microbiological processes affecting autunite stability within subsurface bicarbonate-bearing environments. Experiments were performed in a culture of G975 Arthrobacter oxydans strain, herein referred to as G975, a soil bacterium previously isolated from Hanford Site soil. 91 mg of autunite powder and 50 mL of phosphorus-limiting sterile media were amended with bicarbonate ranging between 1-10 mM in glass reactor bottles and inoculated with G975 strain after the dissolution of autunite was at steady state. SEM observations indicated G975 formed a biofilm on the autunite surface and penetrated the mineral cleavages. The mineral surface colonization by bacteria tended to increase concomitantly with bicarbonate concentrations. Additionally, a sterile cultureware with inserts was used in non-contact bioleaching experiments where autunite and bacteria cells were kept separately. The data suggest the G975 bacteria is able to enhance U(VI) leaching from autunite without the direct contact with the mineral. In the presence of bicarbonate, the damage to bacterial cells caused by U(VI) toxicity was reduced, yielding similar values for total organic carbon (TOC) degradation and cell density compared to U(VI)-free controls. The presence of active bacterial cells greatly enhanced the U(VI) bioleaching from autunite in bicarbonate-amended media.

  15. Enhanced U(VI) release from autunite mineral by aerobic Arthrobacter sp. in the presence of aqueous bicarbonate

    Energy Technology Data Exchange (ETDEWEB)

    Katsenovich, Yelena P.; Carvajal, Denny A.; Wellman, Dawn M.; Lagos, Leonel E.

    2012-05-01

    The bacterial effect on U(VI) release from the autunite mineral (Ca[(UO2)(PO4)]2•3H2O) was investigated to provide a more comprehensive understanding of the important microbiological processes affecting autunite stability within subsurface bicarbonate-bearing environments. Experiments were performed in a culture of the Arthrobacter oxydans G975 strain, herein referred to as G975, a soil bacterium previously isolated from Hanford Site soil. 91 mg of autunite powder and 50 mL of phosphorous-limiting sterile media were amended with bicarbonate (ranging between 1 and 10 mM) in glass reactor bottles and inoculated with the G975 strain after the dissolution of autunite was at steady state. SEM observations indicated that G975 formed a biofilm on the autunite surface and penetrated the mineral cleavages. The mineral surface colonization by bacteria tended to increase concomitantly with bicarbonate concentrations. Additionally, a sterile culture-ware with inserts was used in non-contact dissolution experiments where autunite and bacteria cells were kept separately. The data suggest that G975 bacteria is able to enhance the release of U(VI) from autunite without direct contact with the mineral. In the presence of bicarbonate, the damage to bacterial cells caused by U(VI) toxicity was reduced, yielding similar values for total organic carbon (TOC) degradation and cell density compared to U(VI)-free controls. The presence of active bacterial cells greatly enhanced the release of U(VI) from autunite in bicarbonate-amended media.

  16. The arthrobacter arilaitensis Re117 genome sequence reveals its genetic adaptation to the surface of cheese.

    Directory of Open Access Journals (Sweden)

    Christophe Monnet

    Full Text Available Arthrobacter arilaitensis is one of the major bacterial species found at the surface of cheeses, especially in smear-ripened cheeses, where it contributes to the typical colour, flavour and texture properties of the final product. The A. arilaitensis Re117 genome is composed of a 3,859,257 bp chromosome and two plasmids of 50,407 and 8,528 bp. The chromosome shares large regions of synteny with the chromosomes of three environmental Arthrobacter strains for which genome sequences are available: A. aurescens TC1, A. chlorophenolicus A6 and Arthrobacter sp. FB24. In contrast however, 4.92% of the A. arilaitensis chromosome is composed of ISs elements, a portion that is at least 15 fold higher than for the other Arthrobacter strains. Comparative genomic analyses reveal an extensive loss of genes associated with catabolic activities, presumably as a result of adaptation to the properties of the cheese surface habitat. Like the environmental Arthrobacter strains, A. arilaitensis Re117 is well-equipped with enzymes required for the catabolism of major carbon substrates present at cheese surfaces such as fatty acids, amino acids and lactic acid. However, A. arilaitensis has several specificities which seem to be linked to its adaptation to its particular niche. These include the ability to catabolize D-galactonate, a high number of glycine betaine and related osmolyte transporters, two siderophore biosynthesis gene clusters and a high number of Fe(3+/siderophore transport systems. In model cheese experiments, addition of small amounts of iron strongly stimulated the growth of A. arilaitensis, indicating that cheese is a highly iron-restricted medium. We suggest that there is a strong selective pressure at the surface of cheese for strains with efficient iron acquisition and salt-tolerance systems together with abilities to catabolize substrates such as lactic acid, lipids and amino acids.

  17. In Silico Approach to Support that p-Nitrophenol Monooxygenase from Arthrobacter sp. Strain JS443 Catalyzes the Initial Two Sequential Monooxygenations.

    Science.gov (United States)

    Kallubai, Monika; Amineni, Umamaheswari; Mallavarapu, Megharaj; Kadiyala, Venkateswarlu

    2015-06-01

    p-Nitrophenol (PNP), used primarily for manufacturing pesticides and dyes, has been recognized as a priority environmental pollutant. It is therefore important to reduce the input of this toxicant into the environment and to establish approaches for its removal from the contaminated sites. PNP monooxygenase, a novel enzyme from Gram-positive bacteria like Arthrobacter sp. and Bacillus sp., that comprises two components, a flavoprotein reductase and an oxygenase, catalyzes the initial two sequential monooxygenations to convert PNP to trihydroxybenzene. Accurate and reliable prediction of this enzyme-substrate interactions and binding affinity are of vital importance in understanding these catalytic mechanisms of the two sequential reactions. As crystal structure of the enzyme has not yet been published, we built a homology model for PNP monooxygenase using crystallized chlorophenol 4-monooxygenase from Burkholderia cepacia AC1100 (3HWC) as the template. The model was assessed for its reliability using PROCHECK, ERRAT and ProSA. Molecular docking of the physiological substrates, PNP and 4-nitrocatechol (4-NC), was carried out using Glide v5.7 implemented in Maestro v9.2, and the binding energies were calculated to substantiate the prediction. Docking complexes formed by molecular level interactions of PNP monooxygenase-PNP/4-NC without or with the cofactors, FAD and NADH, showed good correlation with the established experimental evidence that the two-component PNP monooxygenase catalyzes both the hydroxylation of PNP and the oxidative release of nitrite from 4-NC in B. sphaericus JS905. Furthermore, molecular dynamics simulations performed for docking complexes using Desmond v3.0 showed stable nature of the interactions as well.

  18. Complete Genome Sequencing of Protease-Producing Novel Arthrobacter sp. Strain IHBB 11108 Using PacBio Single-Molecule Real-Time Sequencing Technology

    OpenAIRE

    Kiran, Shashi; Swarnkar, Mohit K.; Pal, Mohinder; Thakur, Rishu; Tewari, Rupinder; Singh, Anil Kumar; Gulati, Arvind

    2015-01-01

    A previously uncharacterized species of the genus Arthrobacter, strain IHBB 11108 (MCC 2780), is a Gram-positive, strictly aerobic, nonmotile, cold-adapted, and protease-producing alkaliphilic actinobacterium, isolated from shallow undersurface water from Chandra Tal Lake, Lahaul-Spiti, India. The complete genome of the strain is 3.6 Mb in size with an average 58.97% G+C content.

  19. 阿特拉津降解茵FM326(Arthrobacter sp.)的分离筛选、鉴定和生物学特性%Isolation, Screening and Identification of Atrazine-degrading Bacterium FM326(Arthrobacter sp.)

    Institute of Scientific and Technical Information of China (English)

    李明锐; 祖艳群; 陈建军; 湛方栋; 何永美; 李元

    2011-01-01

    采集除草剂阿特拉津污染的土壤,通过直接涂布法和富集驯化培养分离法,分别获得6株和5株能够降解阿特拉津的细菌.通过降解效率和降解动态试验,筛选到1株高效降解阿特拉津的菌株FM326,该菌株能以阿特拉津为唯一的碳源和氮源生长,培养96 h后对1000 mg· L-1阿特拉津降解效率达到97%.通过生理生化鉴定和16S rDNA序列分析,菌株FM326鉴定为节杆菌属(Arthrobacter sp.)细菌.该菌株表现出最适生长温度30~35℃,最适生长pH值5~9,好氧生长的生长特性.%The Iriazine herbicide atrazine(2-chloro-4-ethylamino-6-isopropyl-amino-s-triazine) is one of the most used pesticides. Atrazine is principally used for control of certain annual broadleaf and grass weeds, primarily in com but also in sorghum, sugarcane, and other crops. Although atrazine has relatively low persistency in soil, its remanets have been found in many higher concentrations even years after application due to widespread use. Microbial remediation is an effective and economic method to control the environment that has been polluted by atrazine. From herbicide contaminated soil, 5 atrazine degrading bacterial strains were isolated by enrichment culture, and 6 a- trazine-degrading bacterial strains were isolated by direct coating method. In the 11 strains, FM326 was screened out as the most highly efficient degradation bacteria by degradation test and could use atrazine as the sole carbon and nitrogen sources for growth. The degradation efficiency of strain FM326 was up to 97% within 96 hours while atrazine concentration was 1 000 mg-L"'. Strain FM326 was identified as Arthrobacter sp. According to physiological and biochemical tests and the phylogenic tree established by means of 16S rDNA sequencing. Moreover, strain FM326 was aerobic bacteria, its optimum temperature and pH value for growth was 30-35 t and 5~9, respectively. Strain of highly efficient degrading atrazine was found from soils

  20. Influence of single-walled carbon nanotubes on the growth and phenol biodegradation characteristics of Arthrobacter sp.W1%单壁碳纳米管对Arthrobacter sp.W1生长及苯酚降解功能的影响

    Institute of Scientific and Technical Information of China (English)

    李端行; 王经伟; 沈文丽; 张照婧; 厉舒祯; 李会杰; 刘紫嫣; 马桥; 曲媛媛

    2015-01-01

    单壁碳纳米管(SWCNTs)对大肠杆菌等模式菌株的生长抑制作用明显,为了解SWCNTs对具有环境功能的菌株的作用,以苯酚降解菌Arthrobacter sp.Wl为对象,考察不同浓度SWCNTs下菌株W1的生长曲线和苯酚降解曲线,并通过扫描电镜观察、细胞凋亡检测、DNA泄漏量分析和活性氧产量分析考察作用机制.结果表明,特定浓度范围的SWCNTs (0.5-5.0 mg/L)会加快W1的苯酚降解速率,且1.5-2.0 mg/L SWCNTs不抑制Wl的生长.SWCNTs在溶液中形成团簇并吸附Wl细胞,且对Wl产生以物理穿刺为主的毒性作用,但在特定浓度范围的SWCNTS条件下,SWCNTs-菌株-苯酚体系增加了菌体与苯酚的接触机会,从而对Wl生长和苯酚降解产生明显的促进作用.本研究结果可为进一步揭示SWCNTs的环境微生物效应提供理论依据.

  1. Key enzymes enabling the growth of Arthrobacter sp. strain JBH1 with nitroglycerin as the sole source of carbon and nitrogen.

    Science.gov (United States)

    Husserl, Johana; Hughes, Joseph B; Spain, Jim C

    2012-05-01

    Flavoprotein reductases that catalyze the transformation of nitroglycerin (NG) to dinitro- or mononitroglycerols enable bacteria containing such enzymes to use NG as the nitrogen source. The inability to use the resulting mononitroglycerols limits most strains to incomplete denitration of NG. Recently, Arthrobacter strain JBH1 was isolated for the ability to grow on NG as the sole source of carbon and nitrogen, but the enzymes and mechanisms involved were not established. Here, the enzymes that enable the Arthrobacter strain to incorporate NG into a productive pathway were identified. Enzyme assays indicated that the transformation of nitroglycerin to mononitroglycerol is NADPH dependent and that the subsequent transformation of mononitroglycerol is ATP dependent. Cloning and heterologous expression revealed that a flavoprotein catalyzes selective denitration of NG to 1-mononitroglycerol (1-MNG) and that 1-MNG is transformed to 1-nitro-3-phosphoglycerol by a glycerol kinase homolog. Phosphorylation of the nitroester intermediate enables the subsequent denitration of 1-MNG in a productive pathway that supports the growth of the isolate and mineralization of NG.

  2. Purification and properties of xylanase A from alkali-tolerant Bacillus sp. strain BP-23.

    OpenAIRE

    A. Blanco; Vidal, T; Colom, J F; Pastor, F I

    1995-01-01

    Xylanase A from the recently isolated Bacillus sp. strain BP-23 was purified to homogeneity. The enzyme shows a molecular mass of 32 kDa and an isoelectric point of 9.3. Optimum temperature and pH for xylanase activity were 50 degrees C and 5.5 respectively. Xylanase A was completely inhibited by N-bromosuccinimide. The main products of birchwood xylan hydrolysis were xylotetraose and xylobiose. The enzyme was shown to facilitate chemical bleaching of pulp, generating savings of 38% in terms ...

  3. Bioavailability of Ag(I) with Arthrobacter oxidas and Arthrobacter globiformis

    CERN Document Server

    Gelagutashvili, E; Ginturi, E; Bagdavadze, N; Kuchava, N; Tsakadze, K; Janjalia, M

    2012-01-01

    The biosorption of Ag(I)_ Arthrobacter species (Arthrobacter globiformis 151B and Arthrobacter oxidas 61B) was studied at simultaneous application of dialysis and atomic absorption analysis. The biosorption constants and nature of interaction for Ag(I) -Arthrobacter oxidas and Ag(I) -Arthrobacter globiformis were determined. The biosorption constants for Ag(I)- -Arthrobacter globiformis and for Ag(I) -Arthrobacter oxidas equal to 65.0 x10-4 and 35.0 x10-4 respectively.

  4. Cloning and sequencing of the trpE gene from Arthrobacter globiformis ATCC 8010 and several related subsurface Arthrobacter isolates

    Energy Technology Data Exchange (ETDEWEB)

    Chernova, T.; Viswanathan, V.K.; Austria, N.; Nichols, B.P.

    1998-09-01

    Tryptophan dependent mutants of Arthrobacter globiformis ATCC 8010 were isolated and trp genes were cloned by complementation and marker rescue of the auxotrophic strains. Rescue studies and preliminary sequence analysis reveal that at least the genes trpE, trpC, and trpB are clustered together in this organism. In addition, sequence analysis of the entire trpE gene, which encodes component I of anthranilate synthase, is described. Segments of the trpE gene from 17 subsurface isolates of Arthrobacter sp. were amplified by PCR and sequenced. The partial trpE sequences from the various strains were aligned and subjected to phylogenetic analysis. The data suggest that in addition to single base changes, recombination and genetic exchange play a major role in the evolution of the Arthrobacter genome.

  5. Degradation of the Phosphonate Herbicide Glyphosate by Arthrobacter atrocyaneus ATCC 13752

    OpenAIRE

    Pipke, Rüdiger; Amrhein, Nikolaus

    1988-01-01

    Of nine authentic Arthrobacter strains tested, only A. atrocyaneus ATCC 13752 was capable of using the herbicide glyphosate [N-(phosphonomethyl)glycine] as its sole source of phosphorus. Contrary to the previously isolated Arthrobacter sp. strain GLP-1, which degrades glyphosate via sarcosine, A. atrocyaneus metabolized glyphosate to aminomethylphosphonic acid. The carbon of aminomethylphosphonic acid was entirely converted to CO2. This is the first report on glyphosate degradation by a bacte...

  6. Preliminary separation and qualitative analysis of carotenoids in Arthrobacter sp.%一株节杆菌发酵产物中类胡萝卜素的分离及组分分析的初探

    Institute of Scientific and Technical Information of China (English)

    翟玉贵; 张伟国; 钱和

    2014-01-01

    [目的]对实验室保存的一株红色球菌进行菌株鉴定,并对色素提取液的组分进行定性分析.[方法]采取形态学观察、16S rDNA序列同源性分析和生理生化分析相结合的方法确定菌株的分类地位.使用乙醇-丙酮混合液提取胞内色素,采用硅胶G薄板层析法对色素提取液进行初步分离纯化,并结合其光谱吸收特性、质谱结果进行定性分析.[结果]实验结果表明此菌株属于节杆菌属(Arthrobacter sp.).薄板层析结果显示该菌株内主要有4种色素组分,且靠近溶剂前沿组分为黄色,其它组分皆为橘红色.吸收光谱特性、质谱结果显示黄色组分可能为β-胡萝卜素,橘红色组分可能为螺菌黄质系类胡萝卜素.[结论]此株节杆菌以较为廉价的糖蜜和玉米浆作为营养物质用于满足自身生长需要,并且积累胞内类胡萝卜素,因此该菌的进一步研究有一定的价值.

  7. Pb2 + Tolerance and Adsorption of Arthrobacter sp. 12-1 Isolated from Lead-zinc Mine Tailing Dam%铅锌矿尾矿坝分离节杆菌12-1对Pb2+的耐受和吸附性能研究

    Institute of Scientific and Technical Information of China (English)

    陈志; 邹情雅; 潘晓鸿; 林璋; 关雄

    2014-01-01

    The extensive exploitation and usage of lead resources have caused serious environmental pollution problems currently. Bioremediation of Pb2 + contaminated water and soil environments using microbes is regarded as a promising technology due to the advantages of its cost-effective, easy operation and environmental-friendly properties. In order to understand Pb2+ biosorption characterization of microbes, an indigenous lead-resistant bacterium-Arthrobacter sp. 12-1(GenBank No. KM362724) was isolated from lead-zinc mine tailing dam, and the process and mechanism of Pb2+ biosorption by Arthrobacter sp. 12-1 were furtherly investigated in this study. Study on the growth of Arthrobacter sp. 12-1 in LB medium containing different concentration of Pb2+suggested that the highest Pb2+tolerant concentration of Arthrobacter sp. 12-1 was 800 mg/L. In water solution, 105 mg/L of Pb2+could be reduced to 2.17 mg/L by Arthrobacter sp. 12-1 within 24 h with biosorption rate of 97.93%. Microscopic investigation (atomic force microscopy and scanning electronic microscopy) combined with energy dispersive X-ray spectroscopy analysis showed that lead containing mineral was formed on the surface of cell after Pb2+sorption by Arthrobacter sp. 12-1. Further fourier transform infrared (FT- IR) analysis revealed that carboxyl, amide and phosphate groups of Arthrobacter sp. 12-1 might be involved in Pb2 + biosorption process. The results demonstrated that the Arthrobacter sp. 12-1 isolated from lead-zinc mine tailing dam had strong ability of Pb2 + resistance and biosorption, indicating an attractive prospect of practical applications in bioremediation Pb2+ contaminated water and soil environments. The present work provides much fundamental information for help in constructing feasible strategies for Pb2+bioremediation in the environment.%当前铅资源的粗放式开采和使用对环境造成了严重的污染。利用微生物修复铅污染具有费用低、易操作、环境友好等优

  8. Human (Clovis)-gomphothere (Cuvieronius sp.) association ∼13,390 calibrated yBP in Sonora, Mexico

    Science.gov (United States)

    Sanchez, Guadalupe; Holliday, Vance T.; Gaines, Edmund P.; Arroyo-Cabrales, Joaquín; Martínez-Tagüeña, Natalia; Kowler, Andrew; Lange, Todd; Hodgins, Gregory W. L.; Mentzer, Susan M.; Sanchez-Morales, Ismael

    2014-07-01

    The earliest known foragers to populate most of North America south of the glaciers [∼11,500 to ≥ ∼10,800 14C yBP; ∼13,300 to ∼12,800 calibrated (Cal) years] made distinctive "Clovis" artifacts. They are stereotypically characterized as hunters of Pleistocene megamammals (mostly mammoth) who entered the continent via Beringia and an ice-free corridor in Canada. The origins of Clovis technology are unclear, however, with no obvious evidence of a predecessor to the north. Here we present evidence for Clovis hunting and habitation ∼11,550 yBP (∼13,390 Cal years) at "El Fin del Mundo," an archaeological site in Sonora, northwestern Mexico. The site also includes the first evidence to our knowledge for gomphothere (Cuvieronius sp.) as Clovis prey, otherwise unknown in the North American archaeological record and terminal Pleistocene paleontological record. These data (i) broaden the age and geographic range for Clovis, establishing El Fin del Mundo as one of the oldest and southernmost in situ Clovis sites, supporting the hypothesis that Clovis had its origins well south of the gateways into the continent, and (ii) expand the make-up of the North American megafauna community just before extinction.

  9. Isolation of Arthrobacter Bacteriophage from Soil †

    OpenAIRE

    Germida, James J.; Casida, L. E.

    1981-01-01

    Soil was percolated with water and various nutrient solutions, and then the percolates were analyzed for bacteriophages which produced plaques on various Arthrobacter strains. The water percolates did not contain detectable phage. In contrast, phages for A. globiformis strains ATCC 8010 and 4336, and for several recent Arthrobacter species soil isolates, were easily detected in nutrient broth, soil extract, and cation-complete medium percolates. These percolates did not contain phage that pro...

  10. Effect of NaCl and Na2SO4 on the biodecolourization of K-2BP by Halomonas sp. GYW

    Science.gov (United States)

    Lian, Jing; Xu, Zhifang; Guo, Jianbo; Yue, Lin; Guo, Yankai; Zhang, Chenxiao; Yang, Jingliang

    2014-01-01

    In this paper, the effect of NaCl and Na2SO4 on the biodecolourization of reactive brilliant red K-2BP by a Halomonas sp. GYW (EF188281) was investigated in details. The decolourisation efficiency and the oxidation–reduction potential (ORP) change were explored during the decolourization process. The results from sequencing batch tests showed that Na2SO4 influenced the decolourization efficiency more slightly than NaCl in different synthetic dye solutions with different mixtures of Na2SO4 and NaCl. In the dye solutions with the same salt concentration or the same Na+ concentration, high Na2SO4 concentration did not inhibit the decolourization process and even stimulated the decolourization efficiency of reactive brilliant red K-2BP. Compared to NaCl system, the addition of Na2SO4 increased the ORP values about 35 mV, which agreed with the theoretic analysis of Gibbs function. This study improved our knowledge of azo dye decolourization under high salinity conditions and provided efficient option for the treatment of azo dye wastewater.

  11. Arthrobacter enclensis sp. nov., isolated from sediment sample

    Digital Repository Service at National Institute of Oceanography (India)

    Dastager, S.G.; Qin, L.; Tang, S.K.; Krishnamurthi, S.; Lee, J.C.; Li, W.J.

    ,000 replicates. The DNA G+C content (mol%) was estimated accord- ing to Gonzalez and Saiz-Jimenez (2002). ΔTm values between homologous and hybrid DNA are analysed by real-time PCR (Gonzalez and Saiz-Jimenez 2005). For DNA–DNA hybridization experiments...:228–230 Gillis M, De Ley J, De Cleene M (1970) The determination of molec- ular weight of bacterial genome DNA from renaturation rates. Eur J Biochem 12:143–153 Gonzalez JM, Saiz-Jimenez C (2002) A fluorimetric method for the estimation of G+C mol% content...

  12. Genetic differentiation of Arthrobacter population from heavy metal-contaminated environment

    Institute of Scientific and Technical Information of China (English)

    ZHANG Hanbo; REN Weimin; SHAO Qiyong; DUAN Changqun

    2007-01-01

    Six samples containing extremely high concentration of Pb,Zn,and Cd were obtained from the layers of 5-10 cm and 25-30 cm three tailing piles,with ages of about 10,20 and more than 80 years,respectively.Then,48 bacterial strains were obtained from these samples,and subsequently their phylogenetic positions were determined by analysis on the partial sequence of 16S rRNA gene (fragment length ranging from 474 to 708 bp).These isolates were members of the Arthrobacter genus,phylogenetically close to A.keyseri and A.ureafaciens,with sequence ranging from 99.1%to 100%.Furthermore,genetic variation between subpopulations from different samples was revealed by analysis on their randomly amplified polymorphic DNA profile.Nei genetic distance showed that the greatest differentiation occurred between subpopulation A and C.Notably,either genetic distance between subpopulations from the layers of 5-10 cm and 25-30 cm of each tailing pile or between same layers of different tailing pile increased with the history of tailings.Moreover,correlation analysis showed that soluble Pb has a significantly negative relationship with Nei'gene diversity of subpopulation.It was assumed that soluble Pb may be responsible for the reduced genetic diversity of the Arthrobacter population.Our data provided evidence that genetic differentiation of microbial populations was consistent with the changes of environmental factors,particularly heavy metals.

  13. Heavy metal resistance in Arthrobacter ramosus strain G2 isolated from mercuric salt-contaminated soil

    International Nuclear Information System (INIS)

    Present study describes isolation of a multiple metal-resistant Arthrobacter ramosus strain from mercuric salt-contaminated soil. The isolate was found to resist and bioaccumulate several metals, such as cadmium, cobalt, zinc, chromium and mercury. Maximum tolerated concentrations for above metals were found to be 37, 525, 348, 1530 and 369 μM, respectively. The isolate could also reduce and detoxify redox-active metals like chromium and mercury, indicating that it has great potential in bioremediation of heavy metal-contaminated sites. Chromate reductase and mercuric reductase (MerA) activities in protein extract of the culture were found to be 2.3 and 0.17 units mg-1 protein, respectively. MerA enzyme was isolated from the culture by (NH4)2SO4 precipitation followed by dye affinity chromatography and its identity was confirmed by nano-LC-MS/MS. Its monomeric molecular weight, and optimum pH and temperature were 57 kDa, 7.4 and 55 deg. C, respectively. Thus, the enzyme was mildly thermophilic as compared to other MerA enzymes. Km and Vmax of the enzyme were 16.9 μM HgCl2 and 6.2 μmol min-1 mg-1 enzyme, respectively. The enzyme was found to be NADPH-specific. To our knowledge this is the first report on characterization of MerA enzyme from an Arthrobacter sp.

  14. Biosorption of Cr(VI)_ and Cr(III)_Arthrobacter species

    OpenAIRE

    Gelagutashvili, E.; Pataraia, E. Ginturi D.; Gurielidze, M.

    2011-01-01

    The biosorption of Cr(VI)_ and Cr(III)_ Arthrobacter species (Arthrobacter globiformis and Arthrobacter oxidas) was studied simultaneous application dialysis and atomic absorption analysis. Also biosorption of Cr(VI) in the presence of Zn(II) during growth of Arthrobacter species and Cr(III) in the presence of Mn(II) were discussed. Comparative Cr(VI)_ and Cr(III)_ Arthrobacter species shown, that Cr(III) was more effectively adsorbed by both bacterium than Cr(VI). The adsorption capacity is ...

  15. Isolation of Arthrobacter species from the phyllosphere and demonstration of their epiphytic fitness

    OpenAIRE

    Scheublin, T.R.; Leveau, J.H.J.

    2013-01-01

    Bacteria of the genus Arthrobacter are common inhabitants of the soil environment, but can also be recovered from leaf surfaces (the phyllosphere). Using enrichment cultures on 4-chlorophenol, we succeeded in specifically isolating Arthrobacter bacteria from ground cover vegetation in an apple orchard. Based on 16S rRNA gene sequencing, the isolates were found to belong to at least three different species of Arthrobacter. Compared to the model bacterial epiphyte Pantoea agglomerans, the Arthr...

  16. Draft Genome Sequence of Arthrobacter chlorophenolicus Strain Mor30.16, Isolated from the Bean Rhizosphere

    OpenAIRE

    Miranda-Ríos, José Antonio; Ramírez-Trujillo, José Augusto; Nova-Franco, Bárbara; Lozano-Aguirre Beltrán, Luis Fernando; Iturriaga, Gabriel; Suárez-Rodríguez, Ramón

    2015-01-01

    Bacteria of the genus Arthrobacter are commonly found in the soil and plant rhizosphere. In this study we report the draft genome of Arthrobacter chlorophenolicus strain Mor30.16 that was isolated from rhizosphere of beans grown in Cuernavaca Morelos, Mexico. This strain promotes growth and ameliorates drought stress in bean plants.

  17. Wide Distribution of Closely Related, Antibiotic-Producing Arthrobacter Strains throughout the Arctic Ocean

    DEFF Research Database (Denmark)

    Wietz, Matthias; Månsson, Maria; Bowman, Jeff S.;

    2012-01-01

    We isolated 16 antibiotic-producing bacterial strains throughout the central Arctic Ocean, including seven Arthrobacter spp. with almost identical 16S rRNA gene sequences. These strains were numerically rare, as revealed using 454 pyrosequencing libraries. Arthrobacter spp. produced arthrobacilin...

  18. Ability of Cyanobacteria and Arthrobacter Species to Remove Gold Ions from Solution

    CERN Document Server

    Gelagutashvili, E; Rcheulichvili, A; Tsakadze, K; Bagdavadze, N; Kuchava, N; Djandjalia, M

    2012-01-01

    The biosorption of Au(III) - Spirulina platensis and Au(III) - Arthrobacter species (Arthrobacter globiformis and Arthrobacter oxidas) were studied at simultaneous application of dialysis and atomic absorption analysis. Also biosorption of Au(III) - Spirulina platensis at various pH were discussed. Biosorption constants for Au-cyanobacteris Spirulina platensis at different pH, and for Arthrobacter oxidas and Arthrobacter globiformis at pH=7.1 are : 1. K=3.91 x 10-4 (Au- Arthrobacter oxidas 61B, pH=7.1) 2. K=14.17 x 10-4 . (Au- Arthrobacter globiformis 151B, pH=7.1). 3. K=2.07x10-4 (Au- Spirulina platensis, pH=7.1) 4. K= 4.87x10-4 (Au- Spirulina platensis, pH=6.2) 5. K=8.7x10-4 (Au- Spirulina platensis, pH=8.4)

  19. Biosorption of Cr(VI)_ and Cr(III)_Arthrobacter species

    CERN Document Server

    Gelagutashvili, E; Gurielidze, M

    2011-01-01

    The biosorption of Cr(VI)_ and Cr(III)_ Arthrobacter species (Arthrobacter globiformis and Arthrobacter oxidas) was studied simultaneous application dialysis and atomic absorption analysis. Also biosorption of Cr(VI) in the presence of Zn(II) during growth of Arthrobacter species and Cr(III) in the presence of Mn(II) were discussed. Comparative Cr(VI)_ and Cr(III)_ Arthrobacter species shown, that Cr(III) was more effectively adsorbed by both bacterium than Cr(VI). The adsorption capacity is the same for both the Chromium-Arthrobacter systems. The biosorption constants for Cr(III) is higher than for Cr(VI) 5.7-5.9- fold for both species. Comparative Freundlich biosorption characteristics Cr(VI) Arthrobacter species of living and dry cells shown, that capacity(n) is in both cases the same(1.25,1.35). Dry cells have larger biosorption constant for both species, than living cells. Biosorption characteristics (K) and (n) for A. oxidas are without Mn(II) and in the presence of Mn(II) 2.6 x 10-4 (K), 1.37 (n) and 2...

  20. Genome sequence of Arthrobacter antarcticus strain W2, isolated from a slaughterhouse

    DEFF Research Database (Denmark)

    Herschend, Jakob; Raghupathi, Prem Krishnan; Røder, Henriette Lyng;

    2016-01-01

    We report the draft genome sequence ofArthrobacter antarcticusstrain W2, which was isolated from a wall of a small slaughterhouse in Denmark. The 4.43-Mb genome sequence was assembled into 170 contigs.......We report the draft genome sequence ofArthrobacter antarcticusstrain W2, which was isolated from a wall of a small slaughterhouse in Denmark. The 4.43-Mb genome sequence was assembled into 170 contigs....

  1. Characterization of an exo-inulinase from Arthrobacter: a novel NaCl-tolerant exo-inulinase with high molecular mass.

    Science.gov (United States)

    Shen, Jidong; Zhang, Rui; Li, Junjun; Tang, Xianghua; Li, Ruixian; Wang, Min; Huang, Zunxi; Zhou, Junpei

    2015-01-01

    A glycoside hydrolase family 32 exo-inulinase gene was cloned from Arthrobacter sp. HJ7 isolated from saline soil located in Heijing town. The gene encodes an 892-residue polypeptide with a calculated mass of 95.1 kDa and a high total frequency of amino acid residues G, A, and V (30.0%). Escherichia coli BL21 (DE3) cells were used as hosts to express the exo-inulinase gene. The recombinant exo-inulinase (rInuAHJ7) showed an apparently maximal activity at pH 5.0-5.5 and 40-45°C. The addition of 1.0 and 10.0 mM Zn(2+) and Pb(2+) had little or no effect on the enzyme activity. rInuAHJ7 exhibited good salt tolerance, retaining more than 98% inulinase activity at a concentration of 3.0%-20.0% (w/v) NaCl. Fructose was the main product of inulin, levan, and Jerusalem artichoke tubers hydrolyzed by the enzyme. The present study is the first to report the identification and characterization of an Arthrobacter sp exo-inulinase showing a high molecular mass of 95.1 kDa and NaCl tolerance. These results suggest that the exo-inulinase might be an alternative material for potential applications in processing seafood and other foods with high saline contents, such as marine algae, pickles, and sauces. PMID:25695343

  2. Evaluation of 4-bromophenol biodegradation in mixed pollutants system by Arthrobacter chlorophenolicus A6 in an upflow packed bed reactor.

    Science.gov (United States)

    Sahoo, Naresh Kumar; Pakshirajan, Kannan; Ghosh, Pranab Kumar

    2014-09-01

    Bromophenol is listed as priority pollutant by U.S. EPA, however, there is no report so far on its removal in mixed pollutants system by any biological reactor operated in continuous mode. Furthermore, bromophenol along with chlorophenol and nitrophenol are usually the major constituents of paper pulp and pesticide industrial effluent. The present study investigated simultaneous biodegradation of these three pollutants with specially emphasis on substrate competition and crossed inhibition by Arthrobacter chlorophenolicus A6 in an upflow packed bed reactor (UPBR). A 2(3) full factorial design was employed with these pollutants at two different levels by varying their influent concentration in the range of 250-450 mg l(-1). Almost complete removal of all these pollutants and 97 % effluent toxicity removal were achieved in the UPBR at a pollutant loading rate of 1707 mg l(-1) day(-1) or lesser. However, at higher loading rates, the reactor performance deteriorated due to transient accumulation of toxic intermediates. Statistical analysis of the results revealed a strong negative interaction of 4-CP on 4-NP biodegradation. On the other hand, interaction effect between 4-CP and 4-BP was found to be insignificant. Among these three pollutants 4-NP preferentially degraded, however, 4-CP exerted more inhibitory effect on 4-NP biodegradation. This study demonstrated the potential of A. chlorophenolicus A6 for biodegradation of 4-BP in mixed pollutants system by a flow through UPBR system. PMID:24934870

  3. Erythema caused by a localised skin infection with Arthrobacter mysorens

    Directory of Open Access Journals (Sweden)

    Chakraborty Trinad

    2010-12-01

    Full Text Available Abstract Background Skin erythemas of unknown origin are a frequent reason for consulting the general practitioner or dermatologist. Case presentation Here we report a case of an erythema resembling the erythema migrans manifestation of Lyme disease, but with atypical symptoms like persistent pruritus. The patient had no history of a recent tick-bite but displayed a positive serology for an advanced stage of Lyme borreliosis, which stood in contrast to the clinical manifestation of erythema migrans as a symptom of early Lyme disease. Three skin swabs and soil samples, collected in the area where the patient possibly acquired the infection, were examined by bacterial and fungal culture methods. Microorganisms were identified by using 16 S rRNA gene sequencing and bioinformatics. The patient and soil isolates were compared by employing RAPD analysis. The serum samples of the patient were examined by immunoblotting. Arthrobacter mysorens, a soil bacterium, was isolated from the collected skin and soil samples. The identity of both isolates was determined by molecular fingerprinting methods. A. mysorens was proven to be causative for the erythema by direct isolation from the affected skin and a positive serology, thus explaining the atypical appearance of the erythema compared to erythema migrans caused by Borrelia infection. Conclusions Infections with A.mysorens might be underreported and microbiological diagnostic techniques should be applied in cases of patients with unclear erythemas, resembling erythema migrans, without a history of tick bites.

  4. AcEST: BP921217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B03 574 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B03. BP921217 - Show BP92121...is mRNA. clone: YMU001_000147_B03. Accession BP921217 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121...containing protei... 100 5e-21 sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-con...... 89 2e-17 sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei...

  5. AcEST: BP918182 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E03. BP918182 - Show BP91818...is mRNA. clone: YMU001_000110_E03. Accession BP918182 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918... protei... 140 4e-33 sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 139 6e-33 sp|P93011|PP18...RPTDARRVFDEMDVRDSVSYNT 278 Query: 314 IIXXXXXXXXXXXALQLFHEMQKKCVKPDEVTYITVLNACSH 18

  6. Application of NAA Method to Study Chromium Uptake by Arthrobacter oxydans

    CERN Document Server

    Tsibakhashvili, N Ya; Kalabegishvili, T L; Kirkesali, E I; Frontasyeva, M V; Pomyakushina, E V; Pavlov, S S

    2002-01-01

    To study chromium uptake by Arthrobacter oxydans (Cr(VI)-reducer bacteria isolated from Columbia basalt rocks, USA) instrumental neutron activation analysis method was applied. It was established that chromate accumulation is dose-dependent and it is more intesive in the interval of concentrations of Cr(VI) (10-50 mg/l). At low concentrations of Cr(VI) (up to 50 mg/l) the most intensive formation of Cr(V) was also found (using ESR method). Besides, it was estimated that reduction from Cr(VI) to Cr(V) is faster process than the uptake of Cr(VI). According to ENAA measurements Cr(III), in constant to Cr(VI), is not accumulated in Arthrobacter oxydans cells up to concentration of 200 mg/l. Using epithermal neutron activation analysis the background levels of 17 major, minor and trace elements were determined in Arthrobacter oxydans.

  7. AcEST: BP913432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000030_B10 512 Adiantum capillus-veneris mRNA. clone: YMU001_000030_B10. BP913432 - Show BP913432...is mRNA. clone: YMU001_000030_B10. Accession BP913432 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913432|Adiantum ... TY A +T+C Sbjct: 1417 TTVSPKTYTTATVTQC 1432 >sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ4620...ucleic Acids Res. 25:3389-3402. Query= BP913432|Adiantum capillus-veneris mRNA, clone: YMU001_000030_B10. (5

  8. Arthrobacter luteus restriction endonuclease cleavage map of X174 RF DNA

    NARCIS (Netherlands)

    Vereijken, J.M.; Mansfeld, A.D.M. van; Baas, P.D.; Jansz, H.S.

    1975-01-01

    Cleavage of X174 RF DNA with the restriction endonuclease from Arthrobacter luteus (Alu I) produces 23 fragments of approximately 24–1100 base pairs in length. The order of most of these fragments has been established by digestion of Haemophilus influenzae Rd (Hind II) and Haemophilus aegyptius (Hae

  9. [Heterotrophic Nitrification and Aerobic Denitrification of the Hypothermia Aerobic Denitrification Bacterium: Arthrobacter arilaitensis].

    Science.gov (United States)

    He, Teng-xia; Ni, Jiu-pai; Li, Zhen-lun; Sun, Quan; Ye Qing; Xu, Yi

    2016-03-15

    High concentrations of ammonium, nitrate and nitrite nitrogen were employed to clarify the abilities of heterotrophic nitrification and aerobic denitrification of Arthrobacter arilaitensis strain Y-10. Meanwhile, by means of inoculating the strain suspension into the mixed ammonium and nitrate, ammonium and nitrite nitrogen simulated wastewater, we studied the simultaneous nitrification and denitrification ability of Arthrobacter arilaitensis strain Y-10. In addition, cell optical density was assayed in each nitrogen removal process to analyze the relationship of cell growth and nitrogen removal efficiency. The results showed that the hypothermia denitrification strain Arthrobacter arilaitensis Y-10 exhibited high nitrogen removal efficiency during heterotrophic nitrification and aerobic denitrification. The ammonium, nitrate and nitrite removal rates were 65.0%, 100% and 61.2% respectively when strain Y-10 was cultivated for 4 d at 15°C with initial ammonium, nitrate and nitrite nitrogen concentrations of 208.43 mg · L⁻¹, 201.16 mg · L⁻¹ and 194.33 mg · L⁻¹ and initial pH of 7.2. Nitrite nitrogen could only be accumulated in the medium containing nitrate nitrogen during heterotrophic nitrification and aerobic denitrification process. Additionally, the ammonium nitrogen was mainly removed in the inorganic nitrogen mixed synthetic wastewater. In short, Arthrobacter arilaitensis Y-10 could conduct nitrification and denitrification effectively under aerobic condition and the ammonium nitrogen removal rate was more than 80.0% in the inorganic nitrogen mixed synthetic wastewater. PMID:27337904

  10. Application of thermoalkalophilic xylanase from Arthrobacter sp. MTCC 5214 in biobleaching of kraft pulp

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, R.; Bhosle, N.B.

    released by enzyme treatment showed a characteristic peak at 280 nm indicating the presence of lignin in the released coloring matter. Enzymatic prebleaching of kraft pulp showed 20 % reduction in kappa number of the pulp without much change in viscosity...

  11. Electrochemical sensor based on Arthrobacter globiformis for cholinesterase activity determination.

    Science.gov (United States)

    Stoytcheva, Margarita; Zlatev, Roumen; Valdez, Benjamin; Magnin, Jean-Pierre; Velkova, Zdravka

    2006-07-15

    The sensors applied recently for determination of cholinesterase activity are mostly enzymatic amperometric sensors, in spite of their disadvantages: short life-time at ambient temperature, instability of the response, interferences, as well as passivation of the electrode surface. In the present paper a new approach for determination of cholinesterase activity was proposed, overcoming the main drawbacks of the analysis performed with amperometric enzymatic sensors. Instead of the immobilization of enzymes on a conducting electrode surface, whole cells of Arthrobacter globiformis, containing choline oxidase were fixed on a Clark type oxygen probe. Current proportional to bacteria respiration is registered as a sensor response. The application of whole cells of bacteria as a sensing element permits to achieve high stability of the response and long life-time of the sensor at ambient temperature, due to the conservation of the enzyme in its natural micro-environment inside the immobilized cells. The proposed sensor keeps its functionality more than 7 weeks stored in deionized water at ambient temperature. For the first 2 weeks the amplitude of the response decreases with only 10% and at the end of the studied 7 weeks period the response was 50% of the initial. The other advantages of the proposed sensor are: the dissolved oxygen is used as a mediator which concentration can be reliably and interferences free measured by the aim of a Clark type oxygen probe applied as a transducer; reproducible bacterial membranes can be elaborated by filtration of resuspended bacterial culture after preliminary determination of its activity; application of membranes containing lyophilized bacteria capable to be conserved infinitely long time and activated just before their application; negligible cost compared with the sensors based on immobilized enzymes. The steady-state response of the proposed bacterial sensor to choline obtained in 200 s is linear in the investigated

  12. AcEST: BP921221 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B07 534 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B07. BP921221 - Show BP921221...is mRNA. clone: YMU001_000147_B07. Accession BP921221 Tissue type prothallium Developmental stage - Contig I... sp|Q944L7|Y1480_ARATH Uncharacterized protein At1g18480 OS=Arabidopsis thaliana Align length 90 Score (bit) 102.0 E-value 2.0e-21...Res. 25:3389-3402. Query= BP921221|Adiantum capillus-veneris mRNA, clone: YMU001_000147_B07. (534 letters) D... (bits) Value sp|Q944L7|Y1480_ARATH Uncharacterized protein At1g18480 OS=Arabi... 102 2e-21 sp|Q4R970|TRAD1_

  13. AcEST: BP918177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_D10 560 Adiantum capillus-veneris mRNA. clone: YMU001_000110_D10. BP918177 - Show BP918177...is mRNA. clone: YMU001_000110_D10. Accession BP918177 Tissue type prothallium Developmental stage - Contig I...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP918177|Adiantum capillus-veneris mRNA, clone: YMU001_0001...o sapiens GN=... 31 4.7 sp|P17765|POLG_BYMV Genome polyprotein OS=Bean yellow mosaic vir... 31 4.7 sp|Q06248...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918177|Adiantum capillus-veneris mRNA, clone

  14. AcEST: BP917173 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_B11 482 Adiantum capillus-veneris mRNA. clone: YMU001_000097_B11. BP91717...3 CL2027Contig1 Show BP917173 Clone id YMU001_000097_B11 Library YMU01 Length 482 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000097_B11. Accession BP917173 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91717...GVYGIIMAGWASNS 144 >sp|Q2RU33|NUOH_RHORT NADH-quinone oxidoreductase subunit H OS=Rhodospirillum rubrum (strain ATCC 1117

  15. AcEST: BP914814 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_B08 487 Adiantum capillus-veneris mRNA. clone: YMU001_000063_B08. BP914814 - Show BP914814...is mRNA. clone: YMU001_000063_B08. Accession BP914814 Tissue type prothallium Developmental stage - Contig I...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914814...|Adiantum capillus-veneris mRNA, clone: YMU001_000063_B08. (487 letters) Database: uniprot_sprot.f...-trehalose-phosphate sy... 60 7e-15 sp|O14081|TPSX_SCHPO Putative alpha,alpha-trehalose-phosphate sy... 79 1e-14

  16. AcEST: BP914014 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_H06 438 Adiantum capillus-veneris mRNA. clone: YMU001_000038_H06. BP914014 - Show BP914014...is mRNA. clone: YMU001_000038_H06. Accession BP914014 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914014|Adiantum ...sprot.fasta 412,525 sequences; 148,809,765 total letters Searching.............................................ed protein C17orf74 OS=Homo s... 32 0.76 sp|O14255|GCS1_SCHPO Probable mannosyl-oligosaccharide glucosida...

  17. AcEST: BP917754 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A06 425 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A06. BP91775...4 CL28Contig1 Show BP917754 Clone id YMU001_000105_A06 Library YMU01 Length 425 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000105_A06. Accession BP917754 Tissue type prothallium Developmental stage ...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91775...H R H + S SERR + Sbjct: 1722 ARRSHRSPSERSHHSPSERSHHSPSERRHHSPSERSHCSPSERSHCSPSERRHR 1775 >sp|Q9JIG7|CCD22_MO

  18. AcEST: BP914451 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A11 386 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A11. BP914451 - Show BP9144...is mRNA. clone: YMU001_000059_A11. Accession BP914451 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914451|Adiantum capill...jct: 88 MYSKLGDFPSAVAVYGRMRKKNYMSSNILINGYVRAGDLVNARKVFDEMPDRKLTTW 144 Score = 30....HFFKVAPVRGVVAW 220 >sp|Q9M9R6|PPR43_ARATH Pentatricopeptide repeat-containing protein At1g14470 OS=Arabidops

  19. AcEST: BP912205 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D02 475 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D02. BP91220...5 CL3776Contig1 Show BP912205 Clone id YMU001_000016_D02 Library YMU01 Length 475 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D02. Accession BP912205 Tissue type prothallium Developmental stag...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912205|Adiantum capi...peat-containing protein 3 OS=Homo sapi... 38 0.020 sp|Q12220|UTP12_YEAST U3 small

  20. AcEST: BP911818 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_E07 537 Adiantum capillus-veneris mRNA. clone: YMU001_000009_E07. BP911818... CL3769Contig1 Show BP911818 Clone id YMU001_000009_E07 Library YMU01 Length 537 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000009_E07. Accession BP911818 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911818|Adiantum c...MQ1|PP376_ARATH Pentatricopeptide repeat-containing protei... 47 6e-05 sp|Q9SFV9|PP218_ARATH Pentatricopepti

  1. An Arthrobacter spp. bacteremia leading to fetal death and maternal disseminated intravascular coagulation.

    Science.gov (United States)

    Shigeta, Naoya; Ozaki, Kimiaki; Hori, Kensuke; Ito, Kimihiko; Nakayama, Masahiro; Nakahira, Kumiko; Yanagihara, Itaru

    2013-02-01

    A 34-year-old parous woman developed high fever and threatened preterm labor after a 1-day trip, for which she was receiving prenatal care at a hospital. Three days after onset, at 24 4/7 weeks of gestation, she was transferred to our hospital in an emergency. Soon after the woman's arrival at our hospital, the infant was spontaneously stillborn via a transvaginal delivery. Laboratory tests revealed severe maternal disseminated intravascular coagulation with renal and liver insufficiency. Histopathologic examination of the placenta revealed vast fibrin deposition and remarkable neutrophilic infiltration in the intervillous space, suggesting a rare bacterial infection caused by Arthrobacter spp. The bacteria were predominantly detected in the placenta and maternal blood serum by common bacterial 16S rRNA sequencing after polymerase chain reaction amplification. We report the first case, to our knowledge, of bacteremia with Arthrobacter spp., which may lead to maternal disseminated intravascular coagulation and intrauterine fetal death.

  2. Improved biosorption for Cr(VI) reduction and removal by Arthrobacter viscosus using zeolite

    OpenAIRE

    Silva, Bruna Andreia Nogueira Airosa; Figueiredo, Hugo; Quintelas, C.; Neves, Isabel C.; Tavares, M.T.

    2012-01-01

    The aim of the present work was to optimize the reduction and removal of chromium from aqueous solutions by a biosorption system consisting of a bacteria supported on a zeolite. The system proposed combines the biosorption properties of Arthrobacter viscosus, with the ion exchange capacity of NaY zeolite. Experiments were also performed without the zeolite for comparison purposes. Experimental parameters such as solution pH, biomass concentration and initial Cr(VI) concentration were investig...

  3. Isolation and Preliminary Characterization of Twenty Bacteriophages Infecting Either Brevibacterium or Arthrobacter Strains

    OpenAIRE

    Trautwetter, Annie; Blanco, Carlos

    1988-01-01

    Thirty-seven bacteriophages plaquing on Corynebacterium, Brevibacterium, or Arthrobacter strains were isolated from soil or vegetation samples. Restriction analysis of phage DNA indicated that 20 phages were unique; one of them produced entirely turbid plaques on Brevibacterium ketoglutamicum and was characterized as temperate. All these phages were assigned to group B of the classification of Bradley (Bacteriol. Rev. 31:230-314, 1967) and had relatively narrow host ranges.

  4. AcEST: BP917617 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000103_C03 527 Adiantum capillus-veneris mRNA. clone: YMU001_000103_C03. BP917617 - Show BP917617...is mRNA. clone: YMU001_000103_C03. Accession BP917617 Tissue type prothallium Developmental stage - Contig I...323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster Align leng..., Nucleic Acids Res. 25:3389-3402. Query= BP917617|Adiantum capillus-veneris mRNA, clone: YMU001_000103_C03....eukemia... 31 2.9 sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (... 31 2.9 sp|P317

  5. AcEST: BP917917 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000107_C09 386 Adiantum capillus-veneris mRNA. clone: YMU001_000107_C09. BP917917... CL9Contig1 Show BP917917 Clone id YMU001_000107_C09 Library YMU01 Length 386 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000107_C09. Accession BP917917 Tissue type prothallium Developmental stage -...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917917|Adiantum capillus-veneris mR...1-alpha OS=Pisum sativum PE... 190 2e-48 sp|Q41803|EF1A_MAIZE Elongation factor 1-alpha OS=Zea mays GN=EF... 190 2e-48 sp|P17

  6. AcEST: BP921111 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000145_G08 481 Adiantum capillus-veneris mRNA. clone: YMU001_000145_G08. BP921111... CL446Contig1 Show BP921111 Clone id YMU001_000145_G08 Library YMU01 Length 481 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000145_G08. Accession BP921111 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921111...V=4 32 1.9 sp|Q6NUV0|RB3GP_DANRE Rab3 GTPase-activating protein catalytic s... 32 1.9 sp|Q3E8Y7|FK114_ARATH

  7. AcEST: BP914214 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000056_D04 404 Adiantum capillus-veneris mRNA. clone: YMU001_000056_D04. BP914214 - Show BP914214...is mRNA. clone: YMU001_000056_D04. Accession BP914214 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914214|Adiantum capillus-ven...eris mRNA, clone: YMU001_000056_D04. (388 letters) Database: uniprot_sprot.fasta 412,525 sequences; 14...l cation channel ... 29 8.4 sp|Q91WD2|TRPV6_MOUSE Transient receptor potential cation channe... 29 8.4 sp|P14

  8. AcEST: BP919090 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_B05 548 Adiantum capillus-veneris mRNA. clone: YMU001_000121_B05. BP919090 - Show BP919090...is mRNA. clone: YMU001_000121_B05. Accession BP919090 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919090|Adiantum capillus-veneris mRNA, clone: YMU001_000121_B...HUMAN Transferrin receptor protein 2 OS=Homo sapi... 75 2e-13 sp|Q90997|TFR1_CHICK Transferrin receptor prot...02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapi... 61 3e-09 sp|Q2V905|TFR1_HORSE Transferrin re

  9. AcEST: BP912432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_E02 526 Adiantum capillus-veneris mRNA. clone: YMU001_000019_E02. BP912432 - Show BP912432...is mRNA. clone: YMU001_000019_E02. Accession BP912432 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912432...2|DEGP7_ARATH Protease Do-like 7 OS=Arabidopsis thaliana... 272 6e-73 sp|O74325|YH05_SCHPO PDZ domain-contai...KSIDSRTDKPKAVHIPRGTL 267 >sp|O74325|YH05_SCHPO PDZ domain-containing protein C1685.05 OS=Schizosaccharomyces

  10. AcEST: BP921212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP92121...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris...OS=Picrophilus to... 31 2.2 sp|Q58550|Y1150_METJA UPF0215 protein MJ1150 OS=Methanocaldococc... 30 2.9 sp|P5... (35%), Positives = 23/39 (58%) Frame = -2 Query: 219 IPLPVSIYISVEGYTMADRSYLPSVLEEGEALSKLKSGC 103 +P+ V+ +SV

  11. AcEST: BP914220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000056_D11 584 Adiantum capillus-veneris mRNA. clone: YMU001_000056_D11. BP914220... CL836Contig1 Show BP914220 Clone id YMU001_000056_D11 Library YMU01 Length 584 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000056_D11. Accession BP914220 Tissue type prothallium Developmental stage...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914220|Adiantum capil....7 sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculu... 30 6.7 sp|P22059|OSBP1_HUMAN Oxystero

  12. AcEST: BP916220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_F11 460 Adiantum capillus-veneris mRNA. clone: YMU001_000084_F11. BP916220... CL2658Contig1 Show BP916220 Clone id YMU001_000084_F11 Library YMU01 Length 460 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000084_F11. Accession BP916220 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916220|Adiantum ... half LIM domains protein 3 OS=Bo... 36 0.091 sp|Q00PK1|TES_ATEAB Testin OS=Atelerix albiventris GN=TES PE=3 SV=1 35 0.16 sp|P22220

  13. AcEST: BP918183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E04 482 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E04. BP918183 - Show BP91818...is mRNA. clone: YMU001_000110_E04. Accession BP918183 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP918183|Adiantum capillus-veneris mRNA, clone: ...5RBR7|LYPA1_PONAB Acyl-protein thioesterase 1 OS=Pongo abeli... 35 0.18 sp|O75608|LYPA1_HUMAN Acyl-protein t...hioesterase 1 OS=Homo sapien... 35 0.18 sp|Q750X7|APTH1_ASHGO Acyl-protein thioesterase 1 OS=Ashbya goss... 35 0.18

  14. AcEST: BP918018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP918018...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM..._ARATH Probable alpha,alpha-trehalose-phosphate sy... 190 3e-48 sp|Q9LRA7|TPS9_ARATH Probable alpha,alpha-tr...ehalose-phosphate sy... 189 3e-48 sp|Q0WUI9|TPS8_ARATH Probable alpha,alpha-trehalose-phosphate sy... 18

  15. Regulation and function of transaldolase isoenzymes involved in sugar and one-carbon metabolism in the ribulose monophosphate cycle methylotroph Arthrobacter P1

    NARCIS (Netherlands)

    Levering, P.R.; Dijkhuizen, Lubbert

    1986-01-01

    In the facultative methylotroph Arthrobacter P1 the enzyme transaldolase plays an important role in both the pentose phosphate pathway and in the ribulose monophosphate cycle of formaldehyde fixation. Among gluconate-negative mutants of Arthrobacter P1 strains occurred which also were unable to grow

  16. Sp1 specific binding sites within the human H-ras promoter: potential role of the 6 bp deletion sequence in the T24 H-ras1 gene.

    Science.gov (United States)

    Pintzas, A; Spandidos, D A

    1991-01-01

    Transcriptionally active domains have been identified and located within the 5'-region of the human normal and mutant T24 H-ras1 promoters, and have been characterised by linkage to the coding sequences of the bacterial chloramphenicol acetyltransferase (CAT) gene or by using DNaseI foot-printing analysis of the promoter sequence. It has been shown, using the latter method, that Sp-1 transcription factor binds to six GC sequences within the H-ras promoter. In the present study we have used unfractionated nuclear protein preparations from HeLa cells and a gel retardation assay to analyse specific binding of nuclear protein preparations from HeLa cells and a gel retardation assay to analyse specific binding of nuclear factors to several oligonucleotide sequences of the human H-ras1 promoter. Our data demonstrate the presence of three Spl specific binding sequences in the T24 promoter, one of them containing a Sp-1 consensus GGCGGC absent in the normal H-rasl promoter. PMID:1776841

  17. AcEST: BP912053 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E04 538 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E04. BP912053 - Show BP9120...is mRNA. clone: YMU001_000012_E04. Accession BP912053 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...IMDELFQDR 188 >sp|A7MTT7|SURE_VIBHB 5'-nucleotidase surE OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912053|Adiantum capillus-veneris m

  18. Impact of phenolic substrate and growth temperature on the arthrobacter chlorophenolicus proteome

    Energy Technology Data Exchange (ETDEWEB)

    Unell, Maria; Abraham, Paul E.; Shah, Manesh; Zhang, Bing; Ruckert, Christian; VerBerkmoes, Nathan C.; Jansson, Janet K.

    2009-02-15

    We compared the Arthrobacter chlorophenolicus proteome during growth on 4-chlorophenol, 4-nitrophenol or phenol at 5 C and 28 C; both for the wild type and a mutant strain with mass spectrometry based proteomics. A label free workflow employing spectral counting identified 3749 proteins across all growth conditions, representing over 70% of the predicted genome and 739 of these proteins form the core proteome. Statistically significant differences were found in the proteomes of cells grown under different conditions including differentiation of hundreds of unknown proteins. The 4-chlorophenol-degradation pathway was confirmed, but not that for phenol.

  19. Accumulation of rare earth elements by siderophore-forming Arthrobacter luteolus isolated from rare earth environment of Chavara, India

    Indian Academy of Sciences (India)

    E S Challaraj Emmanuel; T Ananthi; B Anandkumar; S Maruthamuthu

    2012-03-01

    In this study, Arthrobacter luteolus, isolated from rare earth environment of Chavara (Quilon district, Kerala, India), were found to produce catechol-type siderophores. The bacterial strain accumulated rare earth elements such as samarium and scandium. The siderophores may play a role in the accumulation of rare earth elements. Catecholate siderophore and low-molecular-weight organic acids were found to be present in experiments with Arthrobacter luteolus. The influence of siderophore on the accumulation of rare earth elements by bacteria has been extensively discussed.

  20. EST Table: BP122736 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP122736 epV30177 10/09/28 69 %/169 aa sp|P14296.1|ARYA_MANSE RecName: Full=Arylpho...rylphorin alpha subunit precursor [Manduca sexta] 10/08/29 35 %/167 aa FBpp0072365|Lsp1gamma-PA 10/08/28 n.h

  1. One-pot conversion of levan prepared from Serratia levanicum NN to difructose anhydride IV by Arthrobacter nicotinovorans levan fructotransferase.

    Science.gov (United States)

    Kikuchi, Hiroto; Sakurai, Hiroaki; Nagura, Taizo; Aritsuka, Tsutomu; Tomita, Fusao; Yokota, Atsushi

    2010-03-01

    The newly established difructose anhydride IV (DFA IV) production system is comprised of the effective production of levan from sucrose by Serratia levanicum NN, the conversion of the levan into DFA IV by levan fructotransferase from Arthrobacter nicotinovorans GS-9, which is highly expressed in an Escherichiacoli transformant, and a practical purification step. The chemical properties of DFA IV were also investigated. PMID:20159571

  2. Transcriptional profiling of Gram-positive Arthrobacter in the phyllosphere: induction of pollutant degradation genes by natural plant phenolic compounds

    NARCIS (Netherlands)

    Scheublin, T.R.; Deusch, S.; Moreno-Forero, S.K.; Müller, J.A.; van der Meer, J.R.; Leveau, J.H.J.

    2014-01-01

    Arthrobacter chlorophenolicus A6 is a Gram-positive, 4-chlorophenol degrading soil bacterium that was recently shown to be an effective colonizer of plant leaf surfaces. The genetic basis for this phyllosphere competency is unknown. In this paper, we describe the genome-wide expression profile of A.

  3. Nitrogen metabolism in the facultative methylotroph Arthrobacter P1 grown with various amines or ammonia as nitrogen sources

    NARCIS (Netherlands)

    de Boer, L.; Brouwer, J.W.; Hassel, C.W. van; Levering, Pieter; Dijkhuizen, L.

    1989-01-01

    The metabolism of trimethylamine (TMA) and dimethylamine (DMA) in Arthrobacter P1 involved the enzymes TMA monooxygenase and trimethylamine-N-oxide (TMA-NO) demethylase, and DMA monooxygenase, respectively. The methylamine and formaldehyde produced were further metabolized via a primary amine oxidas

  4. AcEST: BP914470 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_C06 598 Adiantum capillus-veneris mRNA. clone: YMU001_000059_C06. BP9144...70 CL495Contig1 Show BP914470 Clone id YMU001_000059_C06 Library YMU01 Length 598 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000059_C06. Accession BP914470 Tissue type prothallium Developmental stage...wiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q9ASX9 Definition sp|Q9ASX9|BH144_ARAT...H Transcription factor bHLH144 OS=Arabidopsis thaliana Align length 88 Score (bit) 57.8 E-value 4.0e-08 Repo

  5. Epitope Mapping of the Brucella melitensis BP26 Immunogenic Protein: Usefulness for Diagnosis of Sheep Brucellosis

    OpenAIRE

    Seco-Mediavilla, Patricia; Verger, Jean-Michel; Grayon, Maggy; Cloeckaert, Axel; Marín, Clara M.; Zygmunt, Michel S; Fernández-Lago, Luis; Vizcaíno, Nieves

    2003-01-01

    Sequencing of bp26, the gene encoding the Brucella sp. immunogenic BP26 periplasmic protein, was performed in the reference strains of Brucella abortus, B. suis, and B. ovis. The three bp26 sequences were almost identical to that published for B. melitensis 16M bp26, and only minor nucleotide substitutions, without modifying the amino acid sequence, were observed between species. The bp26 genes of the seven B. abortus biovar reference strains and B. abortus S19 and RB51 vaccine strains were a...

  6. AcEST: BP912086 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_H07 536 Adiantum capillus-veneris mRNA. clone: YMU001_000012_H07. BP9120...86 CL1211Contig1 Show BP912086 Clone id YMU001_000012_H07 Library YMU01 Length 536 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_H07. Accession BP912086 Tissue type prothallium Developmental stag...grams, Nucleic Acids Res. 25:3389-3402. Query= BP912086|Adiantum capillus-veneris mRNA, clone: YMU001_000012...LQELSRPHQPTPSSENSWAGPAECSCALQPEAST 1203 >sp|Q4WYE5|MUS81_ASPFU Crossover junction endonuclease mus81 OS=Aspe

  7. AcEST: BP912085 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_H06 509 Adiantum capillus-veneris mRNA. clone: YMU001_000012_H06. BP9120...85 CL1352Contig1 Show BP912085 Clone id YMU001_000012_H06 Library YMU01 Length 509 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_H06. Accession BP912085 Tissue type prothallium Developmental stag...eic Acids Res. 25:3389-3402. Query= BP912085|Adiantum capillus-veneris mRNA, clone: YMU001_000012_H06. (509 ...HZ4|PSBH_PSINU Photosystem II reaction center protein H OS... 120 3e-27 sp|P12160|PSBH_MARPO Photosystem II

  8. AcEST: BP912045 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_D08 401 Adiantum capillus-veneris mRNA. clone: YMU001_000012_D08. BP9120...45 CL1754Contig1 Show BP912045 Clone id YMU001_000012_D08 Library YMU01 Length 401 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_D08. Accession BP912045 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...VADFGL 738 >sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Length = 1207 Score

  9. AcEST: BP912127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi

  10. AcEST: BP911717 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000008_D01 438 Adiantum capillus-veneris mRNA. clone: YMU001_000008_D01. BP911717... CL1298Contig1 Show BP911717 Clone id YMU001_000008_D01 Library YMU01 Length 438 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000008_D01. Accession BP911717 Tissue type prothallium Developmental stag...cleic Acids Res. 25:3389-3402. Query= BP911717|Adiantum capillus-veneris mRNA, cl...|ZSC29_HUMAN Zinc finger and SCAN domain-containing pro... 35 0.14 sp|P17040|ZSC20_HUMAN Zinc finger and SCA

  11. AcEST: BP917717 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E10 488 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E10. BP917717... CL2233Contig1 Show BP917717 Clone id YMU001_000104_E10 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_E10. Accession BP917717 Tissue type prothallium Developmental stag...es. 25:3389-3402. Query= BP917717|Adiantum capillus-veneris mRNA, clone: YMU001_000104_E10. (488 letters) Da...RATH Pentatricopeptide repeat-containing protei... 110 4e-24 sp|O81767|PP348_ARATH Pentatricopeptide repeat-

  12. AcEST: BP917171 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_B09 441 Adiantum capillus-veneris mRNA. clone: YMU001_000097_B09. BP91717...1 CL1480Contig1 Show BP917171 Clone id YMU001_000097_B09 Library YMU01 Length 441 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000097_B09. Accession BP917171 Tissue type prothallium Developmental stag...leic Acids Res. 25:3389-3402. Query= BP917171|Adiantum capillus-veneris mRNA, clo...G 211 >sp|Q03376|BAR3_CHITE Balbiani ring protein 3 OS=Chironomus tentans GN=BR3 PE=2 SV=1 Length = 17

  13. AcEST: BP913030 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_F05 534 Adiantum capillus-veneris mRNA. clone: YMU001_000025_F05. BP913030... CL1982Contig1 Show BP913030 Clone id YMU001_000025_F05 Library YMU01 Length 534 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000025_F05. Accession BP913030 Tissue type prothallium Developmental stag...eic Acids Res. 25:3389-3402. Query= BP913030|Adiantum capillus-veneris mRNA, clone: YMU001_000025_F05. (534 ...0ABC7|HFLK_ECOLI Protein hflK OS=Escherichia coli (strain K1... 30 5.6 sp|P0ABC8|HFLK_ECO57 Protein hflK OS=

  14. AcEST: BP920206 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_C09 332 Adiantum capillus-veneris mRNA. clone: YMU001_000134_C09. BP920206 - Show BP92020...is mRNA. clone: YMU001_000134_C09. Accession BP920206 Tissue type prothallium Developmental stage - Contig I...HAEIN Xylose isomerase OS=Haemophilus influenzae Align length 56 Score (bit) 32.0 E-value 0.99 Report BLASTX 2.2.19 [Nov-02-20...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920206|A...ON_HHV7J Alkaline exonuclease OS=Human herpesvirus 7... 30 3.8 sp|Q12053|PKSL1_ASPPA Aflatoxin biosynthesis

  15. AcEST: BP920200 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_C02 274 Adiantum capillus-veneris mRNA. clone: YMU001_000134_C02. BP920200 - Show BP92020...is mRNA. clone: YMU001_000134_C02. Accession BP920200 Tissue type prothallium Developmental stage - Contig I... Score (bit) 116.0 E-value 3.0e-26 Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thoma...cleic Acids Res. 25:3389-3402. Query= BP920200|Adiantum capillus-veneris mRNA, clone: YMU001_000134_C02. (27...satchenk... 31 2.2 sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosoph

  16. AcEST: BP920209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_C12 539 Adiantum capillus-veneris mRNA. clone: YMU001_000134_C12. BP920209 - Show BP92020...is mRNA. clone: YMU001_000134_C12. Accession BP920209 Tissue type prothallium Developmental stage - Contig I...ATCC 700264) Align length 82 Score (bit) 35.4 E-value 0.18 Report BLASTX 2.2.19 [Nov-02-2008] Reference: Alt...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920209|Adiantum capillus-veneris mRNA, clone...LVAB Tyrosine-protein kinase transforming protein... 32 1.5 sp|P00520|ABL1_MOUSE

  17. AcEST: BP914142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D05 344 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D05. BP914142 - Show BP91414...is mRNA. clone: YMU001_000042_D05. Accession BP914142 Tissue type prothallium Developmental stage - Contig I...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91414..._sprot.fasta 412,525 sequences; 148,809,765 total letters Searching.................ein OS=Pan troglodytes GN... 30 2.9 sp|O14594|NCAN_HUMAN Neurocan core protein OS=Homo sapiens GN=NC... 30 2

  18. AcEST: BP914514 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_G04 533 Adiantum capillus-veneris mRNA. clone: YMU001_000059_G04. BP914514 - Show BP914514...is mRNA. clone: YMU001_000059_G04. Accession BP914514 Tissue type prothallium Developmental stage - Contig I...sp|P29251|FOL1_PNECA Folic acid synthesis protein fol1 OS=Pneumocystis carinii Align length 171 Score (bit) 14...es. 25:3389-3402. Query= BP914514|Adiantum capillus-veneris mRNA, clone: YMU001_000059_G04. (533 letters) Da...tabase: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching..........................

  19. AcEST: BP914141 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D04 288 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D04. BP914141 - Show BP91414...is mRNA. clone: YMU001_000042_D04. Accession BP914141 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914141|Adiantum ...capillus-veneris mRNA, clone: YMU001_000042_D04. (264 letters) Database: uniprot_sprot.fasta 412,525 sequences; 14... subunit beta, chloroplastic OS... 106 4e-23 sp|P62614|ATPB_AEGCR ATP synthase subunit beta, chloroplastic O

  20. AcEST: BP914140 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D03 527 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D03. BP914140 - Show BP91414...is mRNA. clone: YMU001_000042_D03. Accession BP914140 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91414...0|Adiantum capillus-veneris mRNA, clone: YMU001_000042_D03. (527 letters) Database: uniprot_sprot.fasta 412,525 sequences; 14...ein DLN-1 OS=Homo sapiens GN=C10orf140 ... 34 0.49 sp|Q6DE84|MAFB_XENLA Transcription factor MafB OS=Xenopus

  1. AcEST: BP912177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_A09 469 Adiantum capillus-veneris mRNA. clone: YMU001_000016_A09. BP912177 - Show BP912177...is mRNA. clone: YMU001_000016_A09. Accession BP912177 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP912177|Adiantum capillus-veneris mRNA, clone: YMU...rotein 1-3 OS=Homo sapiens GN=KRTAP1-3 PE=2 SV=1 Length = 177 Score = 29.3 bits (64), Expect = 9.1 Identitie... >sp|Q07627|KRA11_HUMAN Keratin-associated protein 1-1 OS=Homo sapiens GN=KRTAP1-1 PE=2 SV=1 Length = 177 Sc

  2. AcEST: BP918180 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E01 492 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E01. BP91818...0 CL642Contig1 Show BP918180 Clone id YMU001_000110_E01 Library YMU01 Length 492 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000110_E01. Accession BP918180 Tissue type prothallium Developmental stage... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918180|Adiantum capil...otein OS=Bos taurus GN=RRP15 ... 35 0.24 sp|Q8TFG4|YL54_SCHPO Uncharacterized protein PB18E9.04c OS=Schiz...

  3. AcEST: BP918618 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_E11 490 Adiantum capillus-veneris mRNA. clone: YMU001_000115_E11. BP918618... CL3774Contig1 Show BP918618 Clone id YMU001_000115_E11 Library YMU01 Length 490 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000115_E11. Accession BP918618 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918618...6WRL0|Y3322_SHEB8 UPF0250 protein Shew185_3322 OS=Shewanella... 32 1.6 sp|A3D7P7|

  4. AcEST: BP918718 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_F12 450 Adiantum capillus-veneris mRNA. clone: YMU001_000116_F12. BP918718 - Show BP918718...is mRNA. clone: YMU001_000116_F12. Accession BP918718 Tissue type prothallium Developmental stage - Contig I...um capillus-veneris Align length 98 Score (bit) 184.0 E-value 2.0e-46 Report BLASTX 2.2.19 [Nov-02-2008] Ref...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918718|Adiantum capillus-veneris ...nificant alignments: (bits) Value sp|Q85FP1|NU2C_ADICA NAD(P)H-quinone oxidoreductase chain 2, chl... 18

  5. AcEST: BP918918 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000119_A05 543 Adiantum capillus-veneris mRNA. clone: YMU001_000119_A05. BP918918 - Show BP918918...is mRNA. clone: YMU001_000119_A05. Accession BP918918 Tissue type prothallium Developmental stage - Contig I...Definition sp|A8ERT9|SYP_ARCB4 Prolyl-tRNA synthetase OS=Arcobacter butzleri (strain RM4018) Align length 62...c Acids Res. 25:3389-3402. Query= BP918918|Adiantum capillus-veneris mRNA, clone: YMU001_000119_A05. (543 le...nthetase OS=Arcobacter butzleri (strain RM4018) GN=proS PE=3 SV=1 Length = 568 Score = 35.8 bits (81), Expec

  6. Identification of a Novel Di-D-Fructofuranose 1,2’:2,3’ Dianhydride (DFA III) Hydrolysis Enzyme from Arthrobacter aurescens SK8.001

    Science.gov (United States)

    Yu, Shuhuai; Wang, Xiao; Zhang, Tao; Stressler, Timo; Fischer, Lutz; Jiang, Bo; Mu, Wanmeng

    2015-01-01

    Previously, a di-D-fructofuranose 1,2’:2,3’ dianhydride (DFA III)-producing strain, Arthrobacter aurescens SK8.001, was isolated from soil, and the gene cloning and characterization of the DFA III-forming enzyme was studied. In this study, a DFA III hydrolysis enzyme (DFA IIIase)-encoding gene was obtained from the same strain, and the DFA IIIase gene was cloned and expressed in Escherichia coli. The SDS-PAGE and gel filtration results indicated that the purified enzyme was a homotrimer holoenzyme of 145 kDa composed of subunits of 49 kDa. The enzyme displayed the highest catalytic activity for DFA III at pH 5.5 and 55°C, with specific activity of 232 U mg-1. Km and Vmax for DFA III were 30.7 ± 4.3 mM and 1.2 ± 0.1 mM min-1, respectively. Interestingly, DFA III-forming enzymes and DFA IIIases are highly homologous in amino acid sequence. The molecular modeling and docking of DFA IIIase were first studied, using DFA III-forming enzyme from Bacillus sp. snu-7 as a template. It was suggested that A. aurescens DFA IIIase shared a similar three-dimensional structure with the reported DFA III-forming enzyme from Bacillus sp. snu-7. Furthermore, their catalytic sites may occupy the same position on the proteins. Based on molecular docking analysis and site-directed mutagenesis, it was shown that D207 and E218 were two potential critical residues for the catalysis of A. aurescens DFA IIIase. PMID:26555784

  7. Cloning of rat sp56, the homologue of mouse sperm ZP3 receptor-sp56

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Mouse sp56 is considered as one of the candidates for mouse zona pellucida 3 (mZP3) receptor. Up to date, its homologue has only been cloned from guinea pig, namely AM67. Based on the cDNA sequence of mouse sp56, we designed a pair of primer to amplify its homologue from rat testis cDNA. Using RT-PCR,two fragments of 743 bp and 938 bp were amplified. The PCR products show very high homology to mouse sp56. However, the 743 bp product completely lacks one of the seven Sushi domains of mouse sp56. Using the 743 bp product as the probe to detect the expression profile of sp56 in rat tissues, Northern blot shows that a ~2.0 kb mRNA expresses specifically in testis. Employed the RACE method, two full cDNA sequences of rat sp56 were obtained. A Mr ~42 KD band was detected in denatured and non-reducing protein sample of rat testis and sperm with anti-mouse sp56 monoclonal antibody by Western blot method. Rat sp56was localized on rat sperm head by the indirect immunofiuorescence method. Rat sp56 immunoreactivitywas detected from the early pachytene spermatocytes and throughout the spermatogenesis. Its cloning willfurther our understanding of the mechanism of the sperm-egg recognition and binding.

  8. EST Table: BP124149 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP124149 epV31958 10/09/28 69 %/169 aa sp|P14296.1|ARYA_MANSE RecName: Full=Arylpho...rylphorin alpha subunit precursor [Manduca sexta] 10/08/29 35 %/167 aa FBpp0072365|Lsp1gamma-PA 10/08/28 n.h...10/09/10 42 %/148 aa gnl|Amel|GB10869-PA 10/09/10 50 %/146 aa gi|270012697|gb|EFA09145.1| hypothetical protein TcasGA2_TC005375 [Tribolium castaneum] BP126555 epV3 ...

  9. EST Table: BP126555 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126555 psV30366 11/12/09 GO hit GO:0005344(oxygen transporter activity)|GO:000681...0(transport) 10/09/28 73 %/168 aa sp|P14296.1|ARYA_MANSE RecName: Full=Arylphorin subunit alpha; Flags: Prec...sor [Manduca sexta] 10/08/29 37 %/184 aa FBpp0073484|Lsp1alpha-PA 10/08/28 n.h 10...GB30362-PA 10/09/10 36 %/167 aa gi|270012699|gb|EFA09147.1| hypothetical protein TcasGA2_TC005377 [Tribolium castaneum] BP126555 psV3 ...

  10. EST Table: BP126508 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126508 psV30291 10/09/28 56 %/172 aa sp|P14296.1|ARYA_MANSE RecName: Full=Arylpho...rylphorin alpha subunit precursor [Manduca sexta] 10/08/29 35 %/109 aa FBpp0073484|Lsp1alpha-PA 10/08/28 n.h... 10/09/10 40 %/103 aa AGAP001345-PA Protein|2R:3362647:3364773:1|gene:AGAP001345 10/09/10 low homology 10/09/10 low homology BP126555 psV3 ...

  11. EST Table: BP123695 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123695 epV31377 10/09/28 73 %/172 aa sp|P14296.1|ARYA_MANSE RecName: Full=Arylpho...rylphorin alpha subunit precursor [Manduca sexta] 10/08/29 39 %/182 aa FBpp0073484|Lsp1alpha-PA 10/08/28 n.h...10/09/10 33 %/159 aa gnl|Amel|GB30362-PA 10/09/10 38 %/171 aa gi|270012699|gb|EFA09147.1| hypothetical protein TcasGA2_TC005377 [Tribolium castaneum] BP126555 epV3 ...

  12. Application of zeolite-Arthrobacter viscosus system for the removal of heavy metal and dye : chromium and azure B

    OpenAIRE

    Rosales, E.; Pazos, M.; Sanromán, M. A.; Tavares, M. T.

    2012-01-01

    A hybrid system combining the ion-exchange properties of a NaY zeolite and the characteristics of the bacterium Arthrobacter viscosus was investigated to treat polluted effluents with dye and toxic metals. In this study, the dye and the metal ion employed were a thiazine dye, Azure B, and chromium (VI), respectively. Initially, the removal of dye by the zeolite was tested. The analysis of dye equilibrium isotherms data was done using Langmuir, Freundlich, Sips and Redlich–Peterson models. Red...

  13. Characterization of the in vitro assembly of FtsZ in Arthrobacter strain A3 using light scattering.

    Science.gov (United States)

    Yang, Fan; Zhang, Shanshan; Ding, Shenglong; Hou, Yannan; Yu, Linghui; Chen, Ximing; Xiao, Jianxi

    2016-10-01

    The self-assembly of FtsZ, the bacterial homolog of tubulin, plays an essential role in cell division. Light scattering technique is applied to real-time monitor the in vitro assembly of FtsZ in Arthrobacter strain A3, a newly isolated psychrotrophic bacterium. The critical concentration needed for the assembly is estimated as 6.7μM. The polymerization of FtsZ in Arthrobacter strain A3 requires both GTP and divalent metal ions, while salt is an unfavorable condition for the assembly. The FtsZ polymerizes under a wide range of pHs, with the fastest rate around pH 6.0. The FtsZ from Arthrobacter strain A3 resembles Mycobacterium tuberculosis FtsZ in terms of the dependence on divalent metal ions and the slow polymerization rate, while it is different from M. tuberculosis FtsZ considering the sensitivity to salt and pH. The comparison of FtsZ from different organisms will greatly advance our understanding of the biological role of the key cell division protein. PMID:27164494

  14. EST Table: BP121593 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121593 ceN-5053 10/09/28 94 %/117 aa ref|NP_054119.1| major viral capsid protein ...[Autographa californica nucleopolyhedrovirus] sp|P17499.1|VP39_NPVAC RecName: Full=Major capsid protein gb|A...AA02580.1| capsid protein [Autographa californica nucleopolyhedrovirus] gb|AAA66719.1| major viral capsid pr

  15. AcEST: BP920220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_D11 532 Adiantum capillus-veneris mRNA. clone: YMU001_000134_D11. BP920220... CL3701Contig1 Show BP920220 Clone id YMU001_000134_D11 Library YMU01 Length 532 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_D11. Accession BP920220 Tissue type prothallium Developmental stag...t_id Q9M373 Definition sp|Q9M373|AGP20_ARATH Arabinogalactan peptide 20 OS=Arabidopsis thaliana Align length... 41 Score (bit) 66.6 E-value 7.0e-11 Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Tho

  16. Biodegradation of Benzo[a]pyrene by Arthrobacter oxydans B4

    Institute of Scientific and Technical Information of China (English)

    PENG Hui; YIN Hua; DENG Jun; YE Jin-Shao; CHEN Shuo-Na; HE Bao-Yan; ZHANG Na

    2012-01-01

    A bacterial strain,Arthrobacter oxydans (B4),capable of degrading benzo[a]pyrene (BaP) in water body,was isolated from a polycyclic aromatic hydrocarbons-contaminated site.Effects of different factors,such as reaction time,pH value,temperature and organic nutrients,on BaP biodegradation by the strain B4 were studied.After 5 d treatment,the concentration of BaP in mineral salts medium was reduced to 0.318 mg L-1,compared to the initial concentration of 1.000 mg L-1.There was a process of acid formation during the degradation with pH failing from initial 7.01 to 4.61 at 5 d,so keeping the water body under slightly alkaline condition was propitious to BaP degradation.Strain B4 efficiently degraded BaP at 20 to 37 ℃ with addition of organic nutrients.The biodegradation and transformation of BaP mainly occurred on cell surfaces,and extracellular secretions played an important role in these processes.Fourier transform infrared spectroscopy and gas chromatograph-mass spectrometer analyses of metabolites showed that ring cleavage occurred in the BaP degradation process and the resulting metabolically utilizable substrates were generated as sole carbon sources for B4 growth.Furthermore,mineralization extent of metabolites was verified by determining the total organic carbon and inorganic carbon in the degradation system.

  17. The rhizobacterium Arthrobacter agilis produces dimethylhexadecylamine, a compound that inhibits growth of phytopathogenic fungi in vitro.

    Science.gov (United States)

    Velázquez-Becerra, Crisanto; Macías-Rodríguez, Lourdes I; López-Bucio, José; Flores-Cortez, Idolina; Santoyo, Gustavo; Hernández-Soberano, Christian; Valencia-Cantero, Eduardo

    2013-12-01

    Plant diseases caused by fungal pathogens such as Botrytis cinerea and the oomycete Phytophthora cinnamomi affect agricultural production worldwide. Control of these pests can be done by the use of fungicides such as captan, which may have deleterious effects on human health. This study demonstrates that the rhizobacterium Arthrobacter agilis UMCV2 produces volatile organic compounds that inhibit the growth of B. cinerea in vitro. A single compound from the volatile blends, namely dimethylhexadecylamine (DMHDA), could inhibit the growth of both B. cinerea and P. cinnamomi when supplied to the growth medium in low concentrations. DMHDA also inhibited the growth of beneficial fungi Trichoderma virens and Trichoderma atroviride but at much higher concentrations. DMHDA-related aminolipids containing 4, 8, 10, 12, and 14 carbons in the alkyl chain were tested for their inhibitory effect on the growth of the pathogens. The results show that the most active compound from those tested was dimethyldodecylamine. This effect correlates with a decrease in the number of membrane lipids present in the mycelium of the pathogen including eicosanoic acid, (Z)-9-hexadecenoic acid, methyl ester, and (Z)-9-octadecenoic acid, methyl ester. Strawberry leaflets treated with DMHDA were not injured by the compound. These data indicate that DMHDA and related compounds, which can be produced by microorganisms may effectively inhibit the proliferation of certain plant pathogens. PMID:23674267

  18. Plasmid-encoded degradation of p-nitrophenol and 4-nitrocatechol by Arthrobacter protophormiae.

    Science.gov (United States)

    Chauhan, A; Chakraborti, A K; Jain, R K

    2000-04-21

    Arthrobacter protophormiae strain RKJ100 is capable of utilizing p-nitrophenol (PNP) as well as 4-nitrocatechol (NC) as the sole source of carbon, nitrogen and energy. The degradation of PNP and NC by this microorganism takes place through an oxidative route, as stoichiometry of nitrite molecules was observed when the strain was grown on PNP or NC as sole carbon and energy sources. The degradative pathways of PNP and NC were elucidated on the basis of enzyme assays and chemical characterization of the intermediates by TLC, GC, (1)H NMR, GC-MS, UV spectroscopy, and HPLC analyses. Our studies clearly indicate that the degradation of PNP proceeds with the formation of p-benzoquinone (BQ) and hydroquinone (HQ) and is further degraded via the beta-ketoadipate pathway. Degradation of NC involved initial oxidation to generate 1,2,4-benzenetriol (BT) and 2-hydroxy-1,4-benzoquinone; the latter intermediate is then reductively dehydroxylated, forming BQ and HQ, and is further cleaved via beta-ketoadipate to TCA intermediates. It is likely, therefore, that the same set of genes encode the further metabolism of HQ in PNP and NC degradation. A plasmid of approximately 65 kb was found to be responsible for harboring genes for PNP and NC degradation in this strain. This was based on the fact that PNP(-) NC(-) derivatives were devoid of the plasmid and had simultaneously lost their capability to grow at the expense of these nitroaromatic compounds.

  19. Improving stability of a novel dextran-degrading enzyme from marine Arthrobacter oxydans KQ11.

    Science.gov (United States)

    Wang, Delong; Lu, Mingsheng; Wang, Xiaobei; Jiao, Yuliang; Fang, Yaowei; Liu, Zhaopu; Wang, Shujun

    2014-03-15

    Dextranases can hydrolyze dextran, so they are used in the sugar industry to mitigate the milling problems associated with dextran contamination. Few studies have been carried out on the storage stability of dextranase, let alone the dextranase of Arthrobacter oxydans KQ11 isolated from sea mud samples. This study improved the storage stability of dextranase from marine A. oxydans KQ11 by adding enzymatic protective reagents (stabilizer and antiseptic). Initially, the conditions (55 °C and 30 min) for maintaining 50% dextranase activity were obtained. Then, the best stabilizers of dextranase were obtained, namely, glycerol (16%), sodium acetate (18%) and sodium citrate (20%). Results showed that p-hydroxybenzoic acid compound sodium acetate (0.05%), D-sodium isoascorbiate (0.03%), and potassium sorbate (0.05%) were the best antiseptics. Subsequent validation experiment showed that dextranase with enzymatic protective reagents maintained 70.8% and 28.96% activities at the 13th week at 25 and 37 °C, respectively. PMID:24528732

  20. Adenylate nucleotide levels and energy charge in Arthrobacter crystallopoietes during growth and starvation.

    Science.gov (United States)

    Leps, W T; Ensign, J C

    1979-07-01

    The adenylate nucleotide concentrations, based on internal water space, were determined in cells of Arthrobacter crystallopoietes during growth and starvation and the energy charge of the cells was calculated. The energy charge of spherical cells rose during the first 10 h of growth, then remained nearly constant for as long as 20 h into the stationary phase. The energy charge of rod-shaped cells rose during the first 4 h of growth, then remained constant during subsequent growth and decreased in the stationary growth phase. Both spherical and rod-shaped cells excreted adenosine monophosphate but not adenosine triphosphate or adenosine diphosphate during starvation. The intracellular energy charge of spherical cells declined during the initial 10 h and then remained constant for 1 week of starvation at a value of 0.78. The intracellular energy charge of rod-shaped cells declined during the first 24 h of starvation, remained constant for the next 80 h, then decreased to a value of 0.73 after a total of 168 h starvation. Both cell forms remained more than 90% viable during this time. Addition of a carbon and energy source to starving cells resulted in an increase in the ATP concentration and as a result the energy charge increased to the smae levels as found during growth.

  1. Characterizing the Catalytic Potential of Deinococcus, Arthrobacter and other Robust Bacteria in Contaminated Subsurface Environments of the Hanford Site

    Energy Technology Data Exchange (ETDEWEB)

    Daly, Michael J.

    2005-06-01

    Natural selection in highly radioactive waste sites may yield bacteria with favorable bioremediating characteristics. However, until recently the microbial ecology of such environments has remained unexplored because of the high costs and technical complexities associated with extracting and characterizing samples from such sites. We have examined the bacterial ecology within radioactive sediments from a high-level nuclear waste plume in the vadose zone on the DOE?s Hanford Site in south-central Washington state (Fredrickson et al, 2004). Manganese-dependent, radiation resistant bacteria have been isolated from this contaminated site including the highly Mn-dependent Deinococcus and Arthrobacter spp.

  2. Optimization of four types of antimicrobial agents to increase the inhibitory ability of marine Arthrobacter oxydans KQ11 dextranase mouthwash

    Science.gov (United States)

    Ren, Wei; Wang, Shujun; Lü, Mingsheng; Wang, Xiaobei; Fang, Yaowei; Jiao, Yuliang; Hu, Jianen

    2016-03-01

    We adopted the response surface methodology using single factor and orthogonal experiments to optimize four types of antimicrobial agents that could inhibit biofilm formation by Streptococcus mutans, which is commonly found in the human oral cavity and causes tooth decay. The objective was to improve the function of marine Arthrobacter oxydans KQ11 dextranase mouthwash (designed and developed by our laboratory). The experiment was conducted in a three-level, four-variable central composite design to determine the best combination of ZnSO4, lysozyme, citric acid and chitosan. The optimized antibacterial agents were 2.16 g/L ZnSO4, 14 g/L lysozyme, 4.5 g/L citric acid and 5 g/L chitosan. The biofilm formation inhibition reached 84.49%. In addition, microscopic observation of the biofilm was performed using scanning electron microscopy and confocal laser scanning microscopy. The optimized formula was tested in marine dextranase Arthrobacter oxydans KQ11 mouthwash and enhanced the inhibition of S. mutans. This work may be promoted for the design and development of future marine dextranase oral care products.

  3. Arthrobacter P 1, a Fast Growing Versatile Methylotroph with Amine Oxidase as a Key Enzyme in the Metabolism of Methylated Amines

    NARCIS (Netherlands)

    Dijken, J.P. van; Veenhuis, M.; Harder, W.

    1981-01-01

    A facultative methylotrophic bacterium was isolated from enrichment cultures containing methylamine as the sole carbon source. It was tentatively identified as an Arthrobacter species. Extracts of cells grown on methylamine or ethylamine contained high levels of amine oxidase (E.C. 1.4.3) activity.

  4. Regulation of methylamine and formaldehyde metabolism in Arthrobacter P1. Formaldehyde is the inducing signal for the synthesis of the RuMP cycle enzyme hexulose phosphate synthase

    NARCIS (Netherlands)

    Croes, L.M.; Dijkhuizen, L.

    1986-01-01

    The inducing potential of formaldehyde on the synthesis of hexulose phosphate synthase, a key enzyme of the RuMP cycle in Arthrobacter P1, was investigated in resting cell suspensions. Induction of this enzyme only occurred at formaldehyde concentrations of 0.5 mM and below. No evidence was obtained

  5. AcEST: BP912593 [AcEST

    Lifescience Database Archive (English)

    Full Text Available an (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...ITHINTYRKNLKYLPTYHLPDNIYATSNIDEVLSDNNT--CIILTIPT 81 Query: 357 RAMSLFTCQILH 392 + + QI H Sbjct: 82 QQLRTICTQ...DNIYATSNIDEVLSDNNT--CIILTVPT 81 Query: 357 RAMSLFTCQILH 392 + + QI H Sbjct: 82 QQLRTICTQIQH 93 >sp|O94085|YL...++ L P+ H P + +T +D + S NT C L Sbjct: 24 ISVNLWGRDHRNTTHINTYRKNLKYLPTYHLPDNIYATSNIDEVLSDNNT--CIILTIPT 81 Query: 357 RAMS... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912593|Adiantum c

  6. Physicochemical factors for affecting the efficiency of Arthrobacter chlorophenolicus MN1409 on manganese oxidation%理化因素对锰细菌Arthrobacter chlorophenolicus MN1409氧化Mn2+的影响

    Institute of Scientific and Technical Information of China (English)

    冯福鑫; 王芳; 许旭萍

    2012-01-01

    Arthrobacter chlorophenolicus MN1409是1株分离自锰矿样品的高效锰氧化细菌.为了建立该菌株氧化Mn2+的适宜条件,研究了接种量、装液量、摇床转速、温度、pH值、Fe2+初始质量浓度和Mn2+初始质量浓度等理化因素对其锰氧化效率的影响.结果表明,接种量、装液量、转速和Mn2+初始质量浓度在一定范围内变化对锰氧化率影响不大;而温度、pH值和Fe2+初始质量浓度变化对锰氧化率有较大影响.当接种量为4%,装液量为60mL,温度为25℃,摇床转速为100r/min,pH值为7,且有一定的Fe2+存在时,Arthrobacter chlorophenolicus MN1409对锰的氧化效率最高.%The physicochemical factors for affecting the manganese oxidation efficiency of an manganese oxidizing bacteria named Arthrobacter chlorophennlicus MN1409 which was isolated from manganese ore sample were studied. The identified factors include inoculum volume, liquid volume, temperature, shaking speed, pH as well as the concentration of Fe2+ and Mn2+ . The results showed that there was no significant effect on the biological manganese oxidation rate and chemical manganese oxidation rate during 2% - 10% inoculum volumes. 4% inoculum volume was the optimum condition according to its highest total manganese oxidation rate. Similarly, biological and chemical manganese oxidation rale have no significant difference for the liquid volume ranging from 50 mL to 100 mL in 250 mL triangular flask , the highest total manganese oxidation rate occurred in 60 mL liquid volume. Nevertheless, temperature showed an positive effect on manganese oxidation rate. By increasing the temperature from 15 ℃ to 35 ℃, highest biological and chemical manganese oxidation rate could be reached at 25 ℃ and 35 ℃ , respectively, plus the total oxidation rate could achieved 81.52% as well in 35 ℃ . In addition, the effect of shaker speed on manganese oxidation efficiency (MOE) showed that the oxidation rates were similar for

  7. Influence of BP Ultimate on engine cleanliness

    OpenAIRE

    Mieghem, R.S.P. van

    2007-01-01

    During early 2005, BP introduced two new fuels in the Netherlands. These new products are called BP Ultimate 98 Unleaded and BP Ultimate Diesel. These fuels were formulated to offer several benefits compared to ordinary fuels, specifically in engine cleanliness. TNO was asked to evaluate the test results from BP, examine the stated claims and, if proven, to give a specific endorsement of calculated claims of the product(s). In order to understand the performed research and the arising conclus...

  8. Application of genetic BP network to discriminating earthquakes and explosions

    Institute of Scientific and Technical Information of China (English)

    边银菊

    2002-01-01

    In this paper, we develop GA-BP algorithm by combining genetic algorithm (GA) with back propagation (BP) algorithm and establish genetic BP neural network. We also applied BP neural network based on BP algorithm and genetic BP neural network based on GA-BP algorithm to discriminate earthquakes and explosions. The obtained result shows that the discriminating performance of genetic BP network is slightly better than that of BP network.

  9. Alleviating salt stress in tomato seedlings using Arthrobacter and Bacillus megaterium isolated from the rhizosphere of wild plants grown on saline-alkaline lands.

    Science.gov (United States)

    Fan, Pengfei; Chen, Daitao; He, Yanan; Zhou, Qingxia; Tian, Yongqiang; Gao, Lihong

    2016-11-01

    Salt-induced soil degradation is common in farmlands and limits the growth and development of numerous crop plants in the world. In this study, we isolated salt-tolerant bacteria from the rhizosphere of Tamarix chinensis, Suaeda salsa and Zoysia sinica, which are common wild plants grown on a saline-alkaline land, to test these bacteria's efficiency in alleviating salt stress in tomato plants. We screened out seven strains (TF1-7) that are efficient in reducing salt stress in tomato seedlings. The sequence data of 16S rRNA genes showed that these strains belong to Arthrobacter and Bacillus megaterium. All strains could hydrolyze casein and solubilize phosphate, and showed at least one plant growth promotion (PGP)-related gene, indicating their potential in promoting plant growth. The Arthrobacter strains TF1 and TF7 and the Bacillus megaterium strain TF2 and TF3 could produce indole acetic acid under salt stress, further demonstrating their PGP potential. Tomato seed germination, seedling length, vigor index, and plant fresh and dry weight were enhanced by inoculation of Arthrobacter and B. megaterium strains under salt stress. Our results demonstrated that salt-tolerant bacteria isolated from the rhizosphere of wild plants grown on saline-alkaline lands could be used for alleviating salt stress in crop plants. PMID:27196364

  10. Draft Genome Sequence of Gordonia sp. Strain UCD-TK1 (Phylum Actinobacteria)

    Science.gov (United States)

    Koenigsaecker, Tynisha M.; Coil, David A.

    2016-01-01

    Here, we present the draft genome of Gordonia sp. strain UCD-TK1. The assembly contains 5,470,576 bp in 98 contigs. This strain was isolated from a disinfected ambulatory surgery center. PMID:27738036

  11. Immune tolerance to an intestine-adapted bacteria, Chryseobacterium sp., injected into the hemocoel of Protaetia brevitarsis seulensis

    Science.gov (United States)

    Lee, Jiae; Hwang, Sejung; Cho, Saeyoull

    2016-01-01

    To explore the interaction of gut microbes and the host immune system, bacteria were isolated from the gut of Protaetia brevitarsis seulensis larvae. Chryseobacterium sp., Bacillus subtilis, Arthrobacter arilaitensis, Bacillus amyloliquefaciens, Bacillus megaterium, and Lysinibacillus xylanilyticus were cultured in vitro, identified, and injected in the hemocoel of P. brevitarsis seulensis larvae, respectively. There were no significant changes in phagocytosis-associated lysosomal formation or pathogen-related autophagosome in immune cells (granulocytes) from Chryseobacterium sp.-challenged larvae. Next, we examined changes in the transcription of innate immune genes such as peptidoglycan recognition proteins and antimicrobial peptides following infection with Chryseobacterium sp. PGRP-1 and -2 transcripts, which may be associated with melanization generated by prophenoloxidase (PPO), were either highly or moderately expressed at 24 h post-infection with Chryseobacterium sp. However, PGRP-SC2 transcripts, which code for bactericidal amidases, were expressed at low levels. With respect to antimicrobial peptides, only coleoptericin was moderately expressed in Chryseobacterium sp.-challenged larvae, suggesting maintenance of an optimum number of Chryseobacterium sp. All examined genes were expressed at significantly higher levels in larvae challenged with a pathogenic bacterium. Our data demonstrated that gut-inhabiting bacteria, the Chryseobacterium sp., induced a weaker immune response than other pathogenic bacteria, E. coli K12. PMID:27530146

  12. Draft Genome Sequences of Two Magnetotactic Bacteria, Magnetospirillum moscoviense BB-1 and Magnetospirillum marisnigri SP-1

    Science.gov (United States)

    Koziaeva, Veronika V.; Dziuba, Marina V.; Ivanov, Timophey M.; Kuznetsov, Boris B.; Skryabin, Konstantin G.

    2016-01-01

    We report here the draft genome sequences of two recently isolated magnetotactic species, Magnetospirillum moscoviense BB-1 and Magnetospirillum marisnigri SP-1. The genome of M. moscoviense BB-1 has 4,164,497 bp, 65.2% G+C content, and comprises 207 contigs. The genome of M. marisnigri SP-1 consists of 131 contigs and has a length of 4,619,819 bp and 64.7% G+C content. PMID:27516508

  13. Draft Genome Sequences of Two Magnetotactic Bacteria, Magnetospirillum moscoviense BB-1 and Magnetospirillum marisnigri SP-1.

    Science.gov (United States)

    Koziaeva, Veronika V; Dziuba, Marina V; Ivanov, Timophey M; Kuznetsov, Boris B; Skryabin, Konstantin G; Grouzdev, Denis S

    2016-01-01

    We report here the draft genome sequences of two recently isolated magnetotactic species, Magnetospirillum moscoviense BB-1 and Magnetospirillum marisnigri SP-1. The genome of M. moscoviense BB-1 has 4,164,497 bp, 65.2% G+C content, and comprises 207 contigs. The genome of M. marisnigri SP-1 consists of 131 contigs and has a length of 4,619,819 bp and 64.7% G+C content. PMID:27516508

  14. Evaluation of Arthrobacter aurescens Strain TC1 as Bioaugmentation Bacterium in Soils Contaminated with the Herbicidal Substance Terbuthylazine.

    Directory of Open Access Journals (Sweden)

    Vera P Silva

    Full Text Available In the last years the chloro-s-triazine active substance terbuthylazine has been increasingly used as an herbicide and may leave residues in the environment which can be of concern. The present study aimed at developing a bioaugmentation tool based on the soil bacterium Arthrobacter aurescens strain TC1 for the remediation of terbuthylazine contaminated soils and at examining its efficacy for both soil and aquatic compartments. First, the feasibility of growing the bioaugmentation bacterium inocula on simple sole nitrogen sources (ammonium and nitrate instead of atrazine, while still maintaining its efficiency to biodegrade terbuthylazine was shown. In sequence, the successful and quick (3 days bioremediation efficacy of ammonium-grown A. aurescens TC1 cells was proven in a natural soil freshly spiked or four-months aged with commercial terbuthylazine at a dose 10× higher than the recommended in corn cultivation, to mimic spill situations. Ecotoxicity assessment of the soil eluates towards a freshwater microalga supported the effectiveness of the bioaugmentation tool. Obtained results highlight the potential to decontaminate soil while minimizing terbuthylazine from reaching aquatic compartments via the soil-water pathway. The usefulness of this bioaugmentation tool to provide rapid environment decontamination is particularly relevant in the event of accidental high herbicide contamination. Its limitations and advantages are discussed.

  15. Evaluation of Arthrobacter aurescens Strain TC1 as Bioaugmentation Bacterium in Soils Contaminated with the Herbicidal Substance Terbuthylazine.

    Science.gov (United States)

    Silva, Vera P; Moreira-Santos, Matilde; Mateus, Carla; Teixeira, Tânia; Ribeiro, Rui; Viegas, Cristina A

    2015-01-01

    In the last years the chloro-s-triazine active substance terbuthylazine has been increasingly used as an herbicide and may leave residues in the environment which can be of concern. The present study aimed at developing a bioaugmentation tool based on the soil bacterium Arthrobacter aurescens strain TC1 for the remediation of terbuthylazine contaminated soils and at examining its efficacy for both soil and aquatic compartments. First, the feasibility of growing the bioaugmentation bacterium inocula on simple sole nitrogen sources (ammonium and nitrate) instead of atrazine, while still maintaining its efficiency to biodegrade terbuthylazine was shown. In sequence, the successful and quick (3 days) bioremediation efficacy of ammonium-grown A. aurescens TC1 cells was proven in a natural soil freshly spiked or four-months aged with commercial terbuthylazine at a dose 10× higher than the recommended in corn cultivation, to mimic spill situations. Ecotoxicity assessment of the soil eluates towards a freshwater microalga supported the effectiveness of the bioaugmentation tool. Obtained results highlight the potential to decontaminate soil while minimizing terbuthylazine from reaching aquatic compartments via the soil-water pathway. The usefulness of this bioaugmentation tool to provide rapid environment decontamination is particularly relevant in the event of accidental high herbicide contamination. Its limitations and advantages are discussed. PMID:26662024

  16. TIME DEPENDENT ACCUMULATION OF NICOTINE DERIVATIVES IN THE CULTURE MEDIUM OF ARTHROBACTER NICOTINOVORANS pAO1

    Directory of Open Access Journals (Sweden)

    Răzvan Ștefan Boiangiu

    2014-12-01

    Full Text Available Previous studies have shown that the metabolic intermediate 6-hidroxy-D-nicotine (6HNic found in the Arthrobacter nicotinovorans pAO1+ nicotine catabolic pathway has the ability to bind nicotinic acetylcholine receptors and to sustain spatial memory in rats. These properties make 6HNic a valuable compound with some potential for medical applications, thereby a suitable, simple and efficient method for producing 6-hidroxy-D-nicotine is necessary. Here, we focus on identifying the best moment for harvesting A. nicotinovorans cells in order to directly convert nicotine to 6HNic with the best yield.  The growth of  A. nicotinovorans pAO1+ was monitored and the correlation between the growth phases and nicotine metabolism was established. After about 5 hours of lag,the strain entered the log phase and was fully grown after 10 hours. The nicotine concentration began to drop dramatically as the pAO1+ culture reached saturation and was depleted in 5 hours. As the nicotine concentration dropped, 6HNic began to accumulate, reaching the maximum levels after about 11 hours of growth. Two other products could be detected by HPLC, one which was identified as the nicotine-blue (NB pigment and a second a still unknown end-product. 

  17. Transcriptional profiling of Gram-positive Arthrobacter in the phyllosphere: induction of pollutant degradation genes by natural plant phenolic compounds.

    Science.gov (United States)

    Scheublin, Tanja R; Deusch, Simon; Moreno-Forero, Silvia K; Müller, Jochen A; van der Meer, Jan Roelof; Leveau, Johan H J

    2014-07-01

    Arthrobacter chlorophenolicus A6 is a Gram-positive, 4-chlorophenol-degrading soil bacterium that was recently shown to be an effective colonizer of plant leaf surfaces. The genetic basis for this phyllosphere competency is unknown. In this paper, we describe the genome-wide expression profile of A.chlorophenolicus on leaves of common bean (Phaseolus vulgaris) compared with growth on agar surfaces. In phyllosphere-grown cells, we found elevated expression of several genes known to contribute to epiphytic fitness, for example those involved in nutrient acquisition, attachment, stress response and horizontal gene transfer. A surprising result was the leaf-induced expression of a subset of the so-called cph genes for the degradation of 4-chlorophenol. This subset encodes the conversion of the phenolic compound hydroquinone to 3-oxoadipate, and was shown to be induced not only by 4-chlorophenol but also hydroquinone, its glycosylated derivative arbutin, and phenol. Small amounts of hydroquinone, but not arbutin or phenol, were detected in leaf surface washes of P.vulgaris by gas chromatography-mass spectrometry. Our findings illustrate the utility of genomics approaches for exploration and improved understanding of a microbial habitat. Also, they highlight the potential for phyllosphere-based priming of bacteria to stimulate pollutant degradation, which holds promise for the application of phylloremediation. PMID:24373130

  18. Electronic states of BP, BP +, BP -, B 2P 2, B2P2- and B2P2+

    Science.gov (United States)

    Linguerri, Roberto; Komiha, Najia; Oswald, Rainer; Mitrushchenkov, Alexander; Rosmus, Pavel

    2008-05-01

    Using augmented sextuple zeta basis sets and internally contracted multireference configuration interaction (MRCI) wavefunctions, potential energy, electric dipole and transition moments have been computed for the X 3Π, a 1Σ +, b 1Π and A 3Σ - states of BP, X 2Σ + and A 2Π states of BP - and X 4Σ - and A 4Π states of BP +. From these data spectroscopic constants, radiative transition probabilities and photoelectron spectra of BP - and BP have been evaluated. The non-vanishing spin-orbit coupling elements between the four low lying triplet and singlet states of the neutral BP have also been calculated from MRCI wavefunctions. The treatment of the corresponding perturbations in the manifold of dense rovibrational states in the three lowest states would require a precise knowledge of the electronic excitation energies. Our best singlet-triplet separations (X-a) are calculated to be 2412 cm -1 (MRCI) and 2482 cm -1 (restricted coupled cluster with perturbative triples (RCCSD(T))) with an estimated error bound of about ±200 cm -1. All three states have long radiative lifetimes with cascading among the rovibrational levels of different states. The ionization energy IE e of BP is calculated to be 9.22 eV (MRCI) and 9.48 eV (RCCSD(T)), the electron affinity EA e 2.51 eV (MRCI) and 2.74 eV (RCCSD(T)). The photoelectron spectra of BP and BP - have been obtained from the Franck-Condon factors of the MRCI potentials. For the UV spectroscopy the dipole allowed radiative transition probabilities are given for A 3Σ - ↔ X 3Π, b 1Π ↔ a 1Σ + of BP, A 2Π ↔ X 2Σ + of BP - and A 4Π ↔ X 4Σ - of BP +. The ionization energy IE e of B 2P 2 of 8.71 eV and the electron affinity EA e of 2.34 eV have been calculated by the RCCSD(T)/aVQZ approach. Also the harmonic vibrational wavenumbers for the electronic ground states of the ions B2P2+ and B2P2- are given.

  19. BP Investment Exceeds $4 Bln in china

    Institute of Scientific and Technical Information of China (English)

    Wang Ping

    2008-01-01

    @@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.

  20. Spectroscopic observations of ASASSN-15bp

    Science.gov (United States)

    Williams, S. C.; Darnley, M. J.; Bode, M. F.; Copperwheat, C. M.

    2015-01-01

    We report spectroscopic observations of the optical transient ASASSN-15bp (ATel #6981) taken on 2015 January 25.31 UT using the FRODOSpec spectrograph (Barnsley et al. 2012) on the Liverpool Telescope (Steele et al. 2004).

  1. ESTROGEN REGULATION OF LRP16 GENE EXPRESSION INVOLVES SP1 TRANSCRIPTION FACTOR

    Institute of Scientific and Technical Information of China (English)

    SI Yi-ling; HAN Wei-dong; ZhAO Ya-li; LI Qi; HAO Hao-jie; SONG Hai-jing; MU Yi-ming; YU Li

    2006-01-01

    Objective: To investigate the role of Sp1 as transcription factor required for transactivation of LRP16 gene by estrogen. Methods: Specific antibodies of Erα and Sp1 were used to precipitate the target DNA/protein complexes of MCF-7 cells at different time points after estrogen treatment (Chromatin immunoprecipitation assay), the promoter region of LRP16 gene was amplified by semi-nested polymerase chain reaction (snPCR). Small interfering RNA (siRNA) against Sp1 was transiently cotransfected with LRP16-Luc (containing the region from -213bp to -126bp of LRP16 gene promoter) in MCF-7 cells. The luciferase activities were measured by dual-luciferase assay. Results: The results of chromatin immunoprecipitation assay showed that Sp1 protein directly bound to the -213bp to -126bp region of LRP16 gene, and Erα could enhance the affinity of Sp1 to DNA. Sp1-siRNA specifically decreased the transactivation of LRP16-Luc by 17β-estradiol to 70-80%. Conclusion: The estrogen-induced transactivation of the human LRP16 gene was mediated by Sp1 protein. Moreover, the interactions of ER(/Sp1 functional complex with LRP16 promoter DNA were required for enhanced LRP16 gene transactivation.

  2. An Sp1/Sp3 binding polymorphism confers methylation protection.

    Directory of Open Access Journals (Sweden)

    Yanis A Boumber

    Full Text Available Hundreds of genes show aberrant DNA hypermethylation in cancer, yet little is known about the causes of this hypermethylation. We identified RIL as a frequent methylation target in cancer. In search for factors that influence RIL hypermethylation, we found a 12-bp polymorphic sequence around its transcription start site that creates a long allele. Pyrosequencing of homozygous tumors revealed a 2.1-fold higher methylation for the short alleles (P<0.001. Bisulfite sequencing of cancers heterozygous for RIL showed that the short alleles are 3.1-fold more methylated than the long (P<0.001. The comparison of expression levels between unmethylated long and short EBV-transformed cell lines showed no difference in expression in vivo. Electrophorectic mobility shift assay showed that the inserted region of the long allele binds Sp1 and Sp3 transcription factors, a binding that is absent in the short allele. Transient transfection of RIL allele-specific transgenes showed no effects of the additional Sp1 site on transcription early on. However, stable transfection of methylation-seeded constructs showed gradually decreasing transcription levels from the short allele with eventual spreading of de novo methylation. In contrast, the long allele showed stable levels of expression over time as measured by luciferase and approximately 2-3-fold lower levels of methylation by bisulfite sequencing (P<0.001, suggesting that the polymorphic Sp1 site protects against time-dependent silencing. Our finding demonstrates that, in some genes, hypermethylation in cancer is dictated by protein-DNA interactions at the promoters and provides a novel mechanism by which genetic polymorphisms can influence an epigenetic state.

  3. Equipment Design for Oxidation of 1BP/2BP Using NO_x

    Institute of Scientific and Technical Information of China (English)

    ZHOU; Xian-ming; CHANG; Shang-wen; LI; Gao-liang; LAN; Tian; LIU; Jin-ping; TANG; Hong-bin; HE; Hui

    2013-01-01

    NOx can Oxidize the reductants in 1BP and 2BP feed of Purex process,and can adjust the oxidation state of plutonium as Pu(Ⅳ)to meet the need of 2AF feed.Using NOx in Purex process can reduce the volumn of solid waste effectively,and attract more and more interest of researchers.In this work the oxidation of reductants in 1BP/2BP feed were investigated in glass column as the same-current mode,in

  4. Genome sequencing and annotation of Cellulomonas sp. HZM

    Directory of Open Access Journals (Sweden)

    Patric Chua

    2015-09-01

    Full Text Available We report the draft genome sequence of Cellulomonas sp. HZM, isolated from a tropical peat swamp forest. The draft genome size is 3,559,280 bp with a G + C content of 73% and contains 3 rRNA sequences (single copies of 5S, 16S and 23S rRNA.

  5. Complete genome sequence of ionizing radiation-resistant Hymenobacter sp. strain PAMC26628 isolated from an Arctic lichen.

    Science.gov (United States)

    Ahn, Do-Hwan; Han, So-Ra; Oh, Tae-Jin; Park, Hyun

    2016-04-10

    Ionizing radiation-resistant Hymenobacter sp. strain PAMC26628 was isolated from Stereocaulon sp., an Arctic lichen. Complete genome sequencing of Hymenobacter sp. PAMC26628 revealed one chromosome (5,277,381 bp), one plasmid (89,596 bp), and several genes involved in nucleotide excision repair, a DNA damage removal pathway. An analysis of the Hymenobacter sp. PAMC26628 genome will help us understand its evolution and provide novel insight into the adaptations that allow this organism to survive in the extreme cold of the Arctic.

  6. Low temperature reduction of hexavalent chromium by a microbial enrichment consortium and a novel strain of Arthrobacter aurescens

    Directory of Open Access Journals (Sweden)

    Thompson Vicki S

    2006-01-01

    Full Text Available Abstract Background Chromium is a transition metal most commonly found in the environment in its trivalent [Cr(III] and hexavalent [Cr(VI] forms. The EPA maximum total chromium contaminant level for drinking water is 0.1 mg/l (0.1 ppm. Many water sources, especially underground sources, are at low temperatures (less than or equal to 15 Centigrade year round. It is important to evaluate the possibility of microbial remediation of Cr(VI contamination using microorganisms adapted to these low temperatures (psychrophiles. Results Core samples obtained from a Cr(VI contaminated aquifer at the Hanford facility in Washington were enriched in Vogel Bonner medium at 10 Centigrade with 0, 25, 50, 100, 200, 400 and 1000 mg/l Cr(VI. The extent of Cr(VI reduction was evaluated using the diphenyl carbazide assay. Resistance to Cr(VI up to and including 1000 mg/l Cr(VI was observed in the consortium experiments. Reduction was slow or not observed at and above 100 mg/l Cr(VI using the enrichment consortium. Average time to complete reduction of Cr(VI in the 30 and 60 mg/l Cr(VI cultures of the consortium was 8 and 17 days, respectively at 10 Centigrade. Lyophilized consortium cells did not demonstrate adsorption of Cr(VI over a 24 hour period. Successful isolation of a Cr(VI reducing organism (designated P4 from the consortium was confirmed by 16S rDNA amplification and sequencing. Average time to complete reduction of Cr(VI at 10 Centigrade in the 25 and 50 mg/l Cr(VI cultures of the isolate P4 was 3 and 5 days, respectively. The 16S rDNA sequence from isolate P4 identified this organism as a strain of Arthrobacter aurescens, a species that has not previously been shown to be capable of low temperature Cr(VI reduction. Conclusion A. aurescens, indigenous to the subsurface, has the potential to be a predominant metal reducer in enhanced, in situ subsurface bioremediation efforts involving Cr(VI and possibly other heavy metals and radionuclides.

  7. Increased iron-stress resilience of maize through inoculation of siderophore-producing Arthrobacter globiformis from mine.

    Science.gov (United States)

    Sharma, Meenakshi; Mishra, Vandana; Rau, Nupur; Sharma, Radhey Shyam

    2016-07-01

    Iron deficiency is common among graminaceous crops. Ecologically successful wild grasses from iron-limiting habitats are likely to harbour bacteria which secrete efficient high-affinity iron-chelating molecules (siderophores) to solubilize and mobilize iron. Such siderophore-producing rhizobacteria may increase the iron-stress resilience of graminaceous crops. Considering this, 51 rhizobacterial isolates of Dichanthium annulatum from iron-limiting abandoned mine (∼84% biologically unavailable iron) were purified and tested for siderophore production; and efficacy of Arthrobacter globiformis inoculation to increase iron-stress resilience of maize and wheat was also evaluated. 16S rRNA sequence analyses demonstrated that siderophore-producing bacteria were taxonomically diverse (seven genera, nineteen species). Among these, Gram-positive Bacillus (eleven species) was prevalent (76.92%). A. globiformis, a commonly found rhizobacterium of graminaceous crops was investigated in detail. Its siderophore has high iron-chelation capacity (ICC: 13.0 ± 2.4 μM) and effectively dissolutes diverse iron-complexes (FeCl3 : 256.13 ± 26.56 μM/ml; Fe2 O3 red: 84.3 ± 4.74 μM/ml; mine spoil: 123.84 ± 4.38 μM/ml). Siderophore production (ICC) of A. globiformis BGDa404 also varied with supplementation of different iron complexes. In plant bioassay with iron-deficiency sensitive species maize, A. globiformis inoculation triggered stress-associated traits (peroxidase and proline) in roots, enhanced plant biomass, uptake of iron and phosphate, and protein and chlorophyll contents. However, in iron deficiency tolerant species wheat, growth improvement was marginal. The present study illustrates: (i) rhizosphere of D. annulatum colonizing abandoned mine as a "hotspot" of siderophore-producing bacteria; and (ii) potential of A. globiformis BGDa404 inoculation to increase iron-stress resilience in maize. A. globiformis BGDa404 has the potential to develop as

  8. PLASMID-ENCODED PHTHALATE CATABOLIC PATHWAY IN ARTHROBACTER KEYSERI 12B: BIOTRANSFORMATIONS OF 2-SUBSTITUTED BENZOATES AND THEIR USE IN CLONING AND CHARACTERIZATION OF PHTHALATE CATABOLISM GENES AND GENE PRODUCTS

    Science.gov (United States)

    Several 2-substituted benzoates (including 2-trifluoromethyl-, 2-chloro-, 2-bromo-, 2-iodo-, 2-nitro-, 2-methoxy-, and 2-acetyl-benzoates) were converted by phthalate-grown Arthrobacter keyseri 12B to the corresponding 2-substituted 3,4-dihydroxybenzoates (protocatechuates)...

  9. 2000 Johnston Site 2B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  10. 2000 Johnston Site 3B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  11. 2000 Johnston Site 1B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  12. Genome Sequence of Halomonas sp. Strain A3H3, Isolated from Arsenic-Rich Marine Sediments

    OpenAIRE

    Koechler, Sandrine; Plewniak, Frédéric; Barbe, Valérie; Battaglia-Brunet, Fabienne; Jost, Bernard; Joulian, Catherine; Philipps, Muriel; Vicaire, Serge; Vincent, Stéphanie; Ye, Tao; Bertin, Philippe N.

    2013-01-01

    We report the genome sequence of Halomonas sp. strain A3H3, a bacterium with a high tolerance to arsenite, isolated from multicontaminated sediments of the l’Estaque harbor in Marseille, France. The genome is composed of a 5,489,893-bp chromosome and a 157,085-bp plasmid.

  13. The Effects of Heterologous Expression of groEL from Arthrobacter simplex on the Resistance Performance of Escherichia coli%简单节杆菌groEL基因表达对大肠杆菌抗逆性能的影响

    Institute of Scientific and Technical Information of China (English)

    王艳霞; 王红玲; 王敏; 骆健美

    2016-01-01

    Arthrobacter simplex,a strain with steroid C1,2 dehydrogenation ability,has been widely used in the steroid industry, usually adding ethanol in the transforming system may catalyze the dissolution of hydrophobic substrates. Our prior work by LC-MS/MS and bioinformatics analysis found that heat shock protein(HSP)GroEL was closely correlated to the cell adaptive behavior under ethanol stress condition. Based on this concept,groEL gene was cloned by PCR while usingA. simplexTCCC 11037 genome as a template. The results showed that the homologies of nucleotide and amino acid sequence of GroEL in the strain were the highest with that fromNocardioides sp. JS614 by the ratio of 89% and 95%,respectively. Then its heterologous expression was conducted in Escherichia coli BL21(DE3)with the vector pET-22b (+),and the results showed that the recombinant strain presented the significant increase on the survival performance under the shock condition with high-concentration of methanol,hypertonicity and superacid,as well as the growth performance under the proper stresses of them. The study was the first report on the cloning and expression of genegroEL fromA. simplex,and also provided fundamental data for exploring the biological function of HSP protein GroEL from A. simplex.%以简单节杆菌(Arthrobacter simplex)TCCC 11037基因组为模板,通过PCR方法进行groEL基因克隆,结果表明,该菌株中GroEL的核苷酸和氨基酸序列与Nocardioidessp. JS614来源的GroEL同源性最高,分别为89%和95%。通过pET-22b(+)将其在大肠杆菌BL21(DE3)中进行异源表达,结果表明,重组菌株在甲醇、高渗和强酸这3种压力高浓度冲击条件下的存活能力和适当压力条件下的生长性能均明显提高。

  14. AcEST: BP917025 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000094_H07 471 Adiantum capillus-veneris mRNA. clone: YMU001_000094_H07. BP917025 - Show BP917025...is mRNA. clone: YMU001_000094_H07. Accession BP917025 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP917025|Adiantum capillus-ven...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917025

  15. AcEST: BP917781 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D04 511 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D04. BP917781 - Show BP9177...is mRNA. clone: YMU001_000105_D04. Accession BP917781 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177... programs, Nucleic Acids Res. 25:3389-3402. Query= BP917781|Adiantum capillus-ven

  16. AcEST: BP920154 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F09 487 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F09. BP920154 - Show BP92015...is mRNA. clone: YMU001_000133_F09. Accession BP920154 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adia...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adiantum

  17. AcEST: BP919841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G06 496 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G06. BP919841 - Show BP91984...is mRNA. clone: YMU001_000129_G06. Accession BP919841 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum ca...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum capi

  18. AcEST: BP914066 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E02 515 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E02. BP914066 - Show BP91406...is mRNA. clone: YMU001_000039_E02. Accession BP914066 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP914066|Adiantum capillus-ve

  19. AcEST: BP918406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

  20. AcEST: BP921101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000145_F04 489 Adiantum capillus-veneris mRNA. clone: YMU001_000145_F04. BP921101 - Show BP921101...is mRNA. clone: YMU001_000145_F04. Accession BP921101 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101|Adiantum cap... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101

  1. AcEST: BP914473 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_C10 217 Adiantum capillus-veneris mRNA. clone: YMU001_000059_C10. BP914473 - Show BP9144...is mRNA. clone: YMU001_000059_C10. Accession BP914473 Tissue type prothallium Developmental stage - Contig I...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914473|Adiantum capil

  2. AcEST: BP919212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E05 508 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E05. BP919212 - Show BP91921...is mRNA. clone: YMU001_000122_E05. Accession BP919212 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919212|Adiantum capillus-ven...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919212|Adiantum capillus-

  3. Dicty_cDB: Contig-U15862-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ohexanone... 212 6e-53 AY083902_1( AY083902 |pid:none) Atriplex prostrata betaine a...de dehydrogenase 5, mitochondrial; ... 212 6e-53 AY123972_4( AY123972 |pid:none) Arthrobacter sp. BP2 cycl

  4. Multivalent display of the antimicrobial peptides BP100 and BP143

    OpenAIRE

    Imma Güell; Rafael Ferre; Kasper K. Sørensen; Esther Badosa; Iteng Ng-Choi; Emilio Montesinos; Eduard Bardají; Lidia Feliu; Jensen, Knud J; Marta Planas

    2012-01-01

    Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100) and KKLfKKILKYL-NH2 (BP143) attached to the carbohydrate template cyclodithioerythritol (cDTE) or α-D-galactopyranoside (Galp). The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling ...

  5. BP Oil Company's approach to risk management

    International Nuclear Information System (INIS)

    The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams

  6. Production of β -cyclodextrin from pH and thermo stable Cyclodextrin Glycosyl Transferase, obtained from Arthrobacter mysorens and its evaluation as a drug carrier for Irbesartan.

    Science.gov (United States)

    Rajesh, Y; Narayanan, K; Reddy, M Sreenivasa; Bhaskar, Vijaya K; Shenoy, G Gautham; Subrahmanyam, V M; Rao, J Venkata

    2015-01-01

    Cyclodextrins (CDs) are carrier molecules produced by cyclization of α-1,4-glucans by Cyclodextrin Glycosyl Transferase (CGTase). These torus shaped molecules have hydrophobic cavity and hydrophilic shell making them useful in pharmaceutical, food, textile, pesticide and cosmetic industries. In this study, culture conditions for the production of CGTase by organism belonging to Arthrobacter genus obtained from a paddy field soil were optimized by single parameter mode. Soluble starch, yeast extract and magnesium sulphate played an important role in CGTase production. Percentage increase in CGTase yield under optimized conditions was 396.77%. The enzyme precipitated by 60% ammonium sulphate was purified using DEAE-sepharose. The molecular weight of the purified protein as determined by SDS-PAGE was 75 kDa. Purified CGTase was thermostable and stable over a wide pH range. Dissolution studies on β -cyclodextrin-Irbesartan complex revealed that β -CDs formed were useful in preparing immediate release oral dosage forms. PMID:25901452

  7. The Value of a BP Determination Method Using a Novel Non-Invasive BP Device against the Invasive Catheter Measurement

    OpenAIRE

    Jinsong Xu; Yanqing Wu; Hai Su; Weitong Hu; Juxiang Li; Wenying Wang; Xin Liu; Xiaoshu Cheng

    2014-01-01

    OBJECTIVE: The aim of this study was to evaluate the accuracy of a new blood pressure (BP) measurement method (Pulse method). METHODS: This study enrolled 45 patients for selective percutaneous coronary intervention (PCI) via right radial artery. A BP device using either oscillometric (Microlife 3AC1-1) or Pulse method(RG-BP11)was used. At the beginning of each PCI, intra-radial BP was measured before Microlife BP or Pulse BP measurement as its own reference, respectively. At the end of PCI, ...

  8. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  9. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  10. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  11. Complete genome sequence of Hymenobacter sp. strain PAMC26554, an ionizing radiation-resistant bacterium isolated from an Antarctic lichen.

    Science.gov (United States)

    Oh, Tae-Jin; Han, So-Ra; Ahn, Do-Hwan; Park, Hyun; Kim, Augustine Yonghwi

    2016-06-10

    A Gram-negative, rod-shaped, red-pink in color, and UV radiation-resistant bacterium Hymenobacter sp. strain PAMC26554 was isolated from Usnea sp., an Antarctic lichen, and belongs to the class of Cytophagia and the phylum of Bacteroidetes. The complete genome of Hymenobacter sp. PAMC26554 consists of one chromosome (5,244,843bp) with two plasmids (199,990bp and 6421bp). The genomic sequence indicates that Hymenobacter sp. strain PAMC26554 possesses several genes involved in the nucleotide excision repair pathway that protects damaged DNA. This complete genome information will help us to understand its adaptation and novel survival strategy in the Antarctic extreme cold environment.

  12. AcEST: BP912001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H05 68 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H05. BP912001 - Show BP9120... mRNA. clone: YMU001_000011_H05. Accession BP912001 Tissue type prothallium Developmental stage - Contig ID

  13. AcEST: BP920020 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_B05 91 Adiantum capillus-veneris mRNA. clone: YMU001_000132_B05. BP920020 - Show BP920020... mRNA. clone: YMU001_000132_B05. Accession BP920020 Tissue type prothallium Developmental stage - Contig ID

  14. AcEST: BP919947 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A11 35 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A11. BP919947 - Show BP91994... mRNA. clone: YMU001_000131_A11. Accession BP919947 Tissue type prothallium Developmental stage - Contig ID

  15. AcEST: BP917767 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B11 76 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B11. BP917767 - Show BP9177... mRNA. clone: YMU001_000105_B11. Accession BP917767 Tissue type prothallium Developmental stage - Contig ID

  16. AcEST: BP919848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H02 84 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H02. BP919848 - Show BP91984... mRNA. clone: YMU001_000129_H02. Accession BP919848 Tissue type prothallium Developmental stage - Contig ID

  17. AcEST: BP916367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000086_H07 86 Adiantum capillus-veneris mRNA. clone: YMU001_000086_H07. BP916367 - Show BP916367... mRNA. clone: YMU001_000086_H07. Accession BP916367 Tissue type prothallium Developmental stage - Contig ID

  18. AcEST: BP914480 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_D05 74 Adiantum capillus-veneris mRNA. clone: YMU001_000059_D05. BP914480 - Show BP9144... mRNA. clone: YMU001_000059_D05. Accession BP914480 Tissue type prothallium Developmental stage - Contig ID

  19. AcEST: BP915916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D12 73 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D12. BP915916 - Show BP91591... mRNA. clone: YMU001_000079_D12. Accession BP915916 Tissue type prothallium Developmental stage - Contig ID

  20. AcEST: BP920054 [AcEST

    Lifescience Database Archive (English)

    Full Text Available its) Value sp|Q9P246|STIM2_HUMAN Stromal interaction molecule 2 OS=Homo sap... 33 0.85 sp|P59438|HPS5_MOUSE Herman...LHDNH 246 +++R I SP P+R +A + P SHP H +H Sbjct: 514 RSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHH 546 >sp|P59438|HPS5_MOUSE Herman

  1. AcEST: BP917001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available iss-Prot sp_hit_id P09615 Definition sp|P09615|WNTG_DROME Protein wingless OS=Dro...cant alignments: (bits) Value sp|P09615|WNTG_DROME Protein wingless OS=Drosophila....1 >sp|P09615|WNTG_DROME Protein wingless OS=Drosophila melanogaster GN=wg PE=1 S

  2. AcEST: BP918782 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . 42 0.001 sp|O15164|TIF1A_HUMAN Transcription intermediary factor 1-alpha ... 42 0.001 sp|Q91Y44|BRDT_MOUSE...2 sp|Q64127|TIF1A_MOUSE Transcription intermediary factor 1-alpha ... 42 0.002 sp

  3. Complete genome analysis of Ketogulonigenium sp.WB0104

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Ketogulonigenium sp. may convert L-sorbose into 2-keto-L-gulonic acid, the vitamin C precursor. The genome of Ketogulonigenium sp. WB0104 consists of a circular 2765030 bp chromosome with 61.69% G+C content and two circular plasmids of 267968 and 242707 bp. The genome contains 2727 open reading frames (ORFs). The systems of replication, transcription, translation, carbohydrate and energy metabolism are intact, but the repair system is incomplete. About 640 predicted ORFs have been found to encode transporter proteins, which account for about one fourth of total predicted ORFs, noticeably higher than other documented bacteria. This may be due to the fact that WB0104 adapts to soil circumstance.

  4. AcEST: BP912094 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_A09 564 Adiantum capillus-veneris mRNA. clone: YMU001_000015_A09. BP9120...94 CL2967Contig1 Show BP912094 Clone id YMU001_000015_A09 Library YMU01 Length 564 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_A09. Accession BP912094 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912094|Adiantum c...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  5. AcEST: BP912003 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H07 455 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H07. BP9120...03 CL3942Contig1 Show BP912003 Clone id YMU001_000011_H07 Library YMU01 Length 455 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_H07. Accession BP912003 Tissue type prothallium Developmental stag..., Nucleic Acids Res. 25:3389-3402. Query= BP912003|Adiantum capillus-veneris mRNA...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  6. AcEST: BP912057 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E09 528 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E09. BP9120...57 CL1892Contig1 Show BP912057 Clone id YMU001_000012_E09 Library YMU01 Length 528 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_E09. Accession BP912057 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP912057|Adiantum capillus-veneris mRNA, clone: YMU001_000012_E09. (528 lett... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  7. AcEST: BP921209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A04 535 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A04. BP921209 - Show BP92120...is mRNA. clone: YMU001_000147_A04. Accession BP921209 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92120...grams, Nucleic Acids Res. 25:3389-3402. Query= BP921209|Adiantum capillus-veneris mRNA, clone: YMU001_000147

  8. AcEST: BP912061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_F01 532 Adiantum capillus-veneris mRNA. clone: YMU001_000012_F01. BP912061 - Show BP9120...is mRNA. clone: YMU001_000012_F01. Accession BP912061 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  9. AcEST: BP912036 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_C09 555 Adiantum capillus-veneris mRNA. clone: YMU001_000012_C09. BP912036 - Show BP9120...is mRNA. clone: YMU001_000012_C09. Accession BP912036 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP912036|Adiantum capillus-veneris mRNA, clone: YMU001_000012_C0... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912036|Adiantum capillus-ven

  10. AcEST: BP912065 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_F05 374 Adiantum capillus-veneris mRNA. clone: YMU001_000012_F05. BP912065 - Show BP912065 Clone id YMU001_000012_F05 Library YMU01 Length 374 Definition Adiantum capillus-veneris mRNA. clone: YMU001_000012_F05. Accession BP912065 ...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912065|Adiantum capillus-veneris mRNA, clone: YMU...programs, Nucleic Acids Res. 25:3389-3402. Query= BP912065|Adiantum capillus-vene

  11. AcEST: BP912025 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_B09 484 Adiantum capillus-veneris mRNA. clone: YMU001_000012_B09. BP9120...25 CL1441Contig1 Show BP912025 Clone id YMU001_000012_B09 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_B09. Accession BP912025 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  12. AcEST: BP912042 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_D05 541 Adiantum capillus-veneris mRNA. clone: YMU001_000012_D05. BP912042 - Show BP9120...is mRNA. clone: YMU001_000012_D05. Accession BP912042 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP912042|Adiantum capillus-veneris mRNA, clone: YMU001_000012_D05. (541 le...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912042|Adiantum capil

  13. AcEST: BP921208 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A03 436 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A03. BP921208 - Show BP92120...is mRNA. clone: YMU001_000147_A03. Accession BP921208 Tissue type prothallium Developmental stage - Contig I..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92120... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921208|Adiantum c

  14. AcEST: BP912056 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E08 538 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E08. BP912056 - Show BP9120...is mRNA. clone: YMU001_000012_E08. Accession BP912056 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912056|Adiantum capillus-veneris mRNA, clone... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  15. AcEST: BP921120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_A02 427 Adiantum capillus-veneris mRNA. clone: YMU001_000146_A02. BP921120 - Show BP921120...is mRNA. clone: YMU001_000146_A02. Accession BP921120 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP921120|Adiantum capillus-veneris mRNA, clone: ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921120|Adian

  16. AcEST: BP912007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A01 574 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A01. BP912007 - Show BP9120...is mRNA. clone: YMU001_000012_A01. Accession BP912007 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912007|Adiantum capillus-veneris mRNA, clone: YMU001_000012_A...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912007|Adiantum capillus-veneris

  17. AcEST: BP912009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A03 561 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A03. BP912009 - Show BP9120...is mRNA. clone: YMU001_000012_A03. Accession BP912009 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP912009|Adiantum capillus-veneris mRNA, clone: YMU001_000012_A03... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912009|Adian

  18. AcEST: BP912030 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_C03 525 Adiantum capillus-veneris mRNA. clone: YMU001_000012_C03. BP912030 - Show BP9120...is mRNA. clone: YMU001_000012_C03. Accession BP912030 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912030|Ad...cids Res. 25:3389-3402. Query= BP912030|Adiantum capillus-veneris mRNA, clone: YMU001_000012_C03. (513 lette

  19. AcEST: BP912050 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E01 544 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E01. BP912050 - Show BP9120...is mRNA. clone: YMU001_000012_E01. Accession BP912050 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912050|Adiantum capillus-veneris mRNA, c.... 25:3389-3402. Query= BP912050|Adiantum capillus-veneris mRNA, clone: YMU001_000

  20. AcEST: BP912074 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_G05 524 Adiantum capillus-veneris mRNA. clone: YMU001_000012_G05. BP912074 - Show BP9120...is mRNA. clone: YMU001_000012_G05. Accession BP912074 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...ength = 1129 Score = 48.9 bits (115), Expect = 2e-04 Identities = 28/120 (23%), Positives = 64/120 (53%) Fra

  1. AcEST: BP912012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP9120...12 CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  2. AcEST: BP917117 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000096_B11 125 Adiantum capillus-veneris mRNA. clone: YMU001_000096_B11. BP917117... CL2704Contig1 Show BP917117 Clone id YMU001_000096_B11 Library YMU01 Length 125 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000096_B11. Accession BP917117 Tissue type prothallium Developmental stag...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917117...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917117

  3. AcEST: BP917177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_C05 471 Adiantum capillus-veneris mRNA. clone: YMU001_000097_C05. BP917177 - Show BP91717...is mRNA. clone: YMU001_000097_C05. Accession BP917177 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917177|Adiantum capillus-veneris mRNA, clone: YMU...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917

  4. AcEST: BP920166 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G12 149 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G12. BP920166 - Show BP92016...is mRNA. clone: YMU001_000133_G12. Accession BP920166 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920166|Adiantum capillus-veneris

  5. AcEST: BP920169 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H03. BP920169 - Show BP92016...is mRNA. clone: YMU001_000133_H03. Accession BP920169 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920169|Adiantum cap

  6. AcEST: BP920164 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G09 447 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G09. BP920164 - Show BP92016...is mRNA. clone: YMU001_000133_G09. Accession BP920164 Tissue type prothallium Developmental stage - Contig I...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|A...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|Adiantum cap

  7. AcEST: BP920163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G08 372 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G08. BP92016...3 CL2472Contig1 Show BP920163 Clone id YMU001_000133_G08 Library YMU01 Length 372 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_G08. Accession BP920163 Tissue type prothallium Developmental stag...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum cap... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum capillus-veneris mRNA, clone: YM

  8. AcEST: BP920161 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G06. BP920161 - Show BP92016...is mRNA. clone: YMU001_000133_G06. Accession BP920161 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  9. AcEST: BP912016 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A10 262 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A10. BP912016 - Show BP912016...is mRNA. clone: YMU001_000012_A10. Accession BP912016 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912016|Adiantum capillus-veneris mRNA, clone:.... 25:3389-3402. Query= BP912016|Adiantum capillus-veneris mRNA, clone: YMU001_000012_A10. (262 letters) Data

  10. AcEST: BP920165 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G11 301 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G11. BP920165 - Show BP92016...is mRNA. clone: YMU001_000133_G11. Accession BP920165 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920165...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  11. AcEST: BP920168 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H02 390 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H02. BP920168 - Show BP92016...is mRNA. clone: YMU001_000133_H02. Accession BP920168 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA,...c Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA, clone: YMU001_000133_H02. (390 le

  12. AcEST: BP920167 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H01 152 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H01. BP920167 - Show BP92016...is mRNA. clone: YMU001_000133_H01. Accession BP920167 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP920167|Adiantum capillus-veneris mRNA, clone: YMU...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920167

  13. AcEST: BP919001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000120_A02 410 Adiantum capillus-veneris mRNA. clone: YMU001_000120_A02. BP919001... CL1112Contig1 Show BP919001 Clone id YMU001_000120_A02 Library YMU01 Length 410 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000120_A02. Accession BP919001 Tissue type prothallium Developmental stag...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919001|Adiantum capillus...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919001|Adiantum capillus-veneris mRNA, clone: YMU00

  14. AcEST: BP919941 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_H09 463 Adiantum capillus-veneris mRNA. clone: YMU001_000130_H09. BP91994...1 CL396Contig1 Show BP919941 Clone id YMU001_000130_H09 Library YMU01 Length 463 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000130_H09. Accession BP919941 Tissue type prothallium Developmental stage...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919941|Adiantum capi...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994

  15. AcEST: BP919946 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A10 457 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A10. BP919946 - Show BP91994...is mRNA. clone: YMU001_000131_A10. Accession BP919946 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP919946|Adiantum capillus-veneris mRNA, clone: YMU00...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919946|A

  16. AcEST: BP911994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_G08 559 Adiantum capillus-veneris mRNA. clone: YMU001_000011_G08. BP911994... CL4209Contig1 Show BP911994 Clone id YMU001_000011_G08 Library YMU01 Length 559 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_G08. Accession BP911994 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum ... programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum capillus-veneris mRNA, clone: YMU001_00

  17. AcEST: BP919948 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A12. BP919948 - Show BP91994...is mRNA. clone: YMU001_000131_A12. Accession BP919948 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919948|Adia...leic Acids Res. 25:3389-3402. Query= BP919948|Adiantum capillus-veneris mRNA, clone: YMU001_000131_A12. (489

  18. AcEST: BP919943 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_H11 517 Adiantum capillus-veneris mRNA. clone: YMU001_000130_H11. BP919943 - Show BP91994...is mRNA. clone: YMU001_000130_H11. Accession BP919943 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001_000130_H11. (493 le... Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001

  19. AcEST: BP919949 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B01 318 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B01. BP91994...9 CL2311Contig1 Show BP919949 Clone id YMU001_000131_B01 Library YMU01 Length 318 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_B01. Accession BP919949 Tissue type prothallium Developmental stag...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994

  20. AcEST: BP914147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D12 534 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D12. BP914147 - Show BP91414...is mRNA. clone: YMU001_000042_D12. Accession BP914147 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91414...niprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching......................................ids Res. 25:3389-3402. Query= BP914147|Adiantum capillus-veneris mRNA, clone: YMU001_000042_D12. (534 letter

  1. AcEST: BP917711 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E02. BP917711 - Show BP9177...is mRNA. clone: YMU001_000104_E02. Accession BP917711 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP917711|Adiantum capillus-veneris mRNA, clone: YMU001_000104_E02. (534 letters) Dat...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917711|Adiantum capillus-ve

  2. AcEST: BP917703 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D05 340 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D05. BP9177...03 CL1948Contig1 Show BP917703 Clone id YMU001_000104_D05 Library YMU01 Length 340 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_D05. Accession BP917703 Tissue type prothallium Developmental stag...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917703|Adiantum capillus-veneris mRNA, clone: YMU00...ic Acids Res. 25:3389-3402. Query= BP917703|Adiantum capillus-veneris mRNA, clone

  3. AcEST: BP917787 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D11 582 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D11. BP917787 - Show BP9177...is mRNA. clone: YMU001_000105_D11. Accession BP917787 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917787|Adiantum capillus-veneris mRNA,...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  4. AcEST: BP917732 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G02 305 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G02. BP917732 - Show BP9177...is mRNA. clone: YMU001_000104_G02. Accession BP917732 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917732|Adiantum capillus-veneris mRNA...ds Res. 25:3389-3402. Query= BP917732|Adiantum capillus-veneris mRNA, clone: YMU001_000104_G02. (305 letters

  5. AcEST: BP917756 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A08 493 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A08. BP917756 - Show BP9177...is mRNA. clone: YMU001_000105_A08. Accession BP917756 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917756|Adi...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP917756|Adiantum capillus-veneris mRNA, clone: YMU001_00010

  6. AcEST: BP917783 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D07 525 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D07. BP917783 - Show BP9177...is mRNA. clone: YMU001_000105_D07. Accession BP917783 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP917783|Adiantum capillus-veneris mRNA, clone: YMU001_000105_D07. (525 letter...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  7. AcEST: BP917763 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B06 159 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B06. BP917763 - Show BP9177...is mRNA. clone: YMU001_000105_B06. Accession BP917763 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP917763|Adiantum capillus-veneris mRNA, clo...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  8. AcEST: BP917796 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_E10 461 Adiantum capillus-veneris mRNA. clone: YMU001_000105_E10. BP9177...96 CL2065Contig1 Show BP917796 Clone id YMU001_000105_E10 Library YMU01 Length 461 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_E10. Accession BP917796 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917796|Adiantum capillus-...ids Res. 25:3389-3402. Query= BP917796|Adiantum capillus-veneris mRNA, clone: YMU

  9. AcEST: BP911772 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A06 326 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A06. BP911772 - Show BP91177...is mRNA. clone: YMU001_000009_A06. Accession BP911772 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91177...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91177

  10. AcEST: BP917735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G07 461 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G07. BP917735 - Show BP9177...is mRNA. clone: YMU001_000104_G07. Accession BP917735 Tissue type prothallium Developmental stage - Contig I...eic Acids Res. 25:3389-3402. Query= BP917735|Adiantum capillus-veneris mRNA, clon...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917735|Adiantum cap

  11. AcEST: BP911771 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A05 478 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A05. BP911771 - Show BP91177...is mRNA. clone: YMU001_000009_A05. Accession BP911771 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP911771|Adiantum capillus-veneris mRNA, clone... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911771|Adiantum capillus-veneri

  12. AcEST: BP917727 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_F09 528 Adiantum capillus-veneris mRNA. clone: YMU001_000104_F09. BP917727 - Show BP9177...is mRNA. clone: YMU001_000104_F09. Accession BP917727 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP917727|Adiantum capillus-veneris mRNA, clone: YMU001_000104_F09. (528 letters) D...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  13. AcEST: BP917741 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H02 445 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H02. BP917741 - Show BP9177...is mRNA. clone: YMU001_000104_H02. Accession BP917741 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  14. AcEST: BP917752 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A04 422 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A04. BP917752 - Show BP9177...is mRNA. clone: YMU001_000105_A04. Accession BP917752 Tissue type prothallium Developmental stage - Contig I...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917752|Adiantum capillus-...ncharacterized protein OS=Vitis vinifera GN=VITISV_008296 PE=4 SV=1 Length = 1027 Score = 72.8 bits (177

  15. AcEST: BP917740 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G12 396 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G12. BP917740 - Show BP9177...is mRNA. clone: YMU001_000104_G12. Accession BP917740 Tissue type prothallium Developmental stage - Contig I...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917740|Adiantum capillus-veneris mR...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917740|Adiantum ...: 4 DLLKAYVTEVDQRDQWKNHSPLVEYVYNYSTHTSTRKTLFKVTEERLKIRLIVKTLG--K 177 D+L+A V +D +

  16. AcEST: BP917700 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D02 544 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D02. BP9177...00 CL272Contig1 Show BP917700 Clone id YMU001_000104_D02 Library YMU01 Length 544 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000104_D02. Accession BP917700 Tissue type prothallium Developmental stage... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917700|Adiantum capillus-ven...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917700|Adiantum capillus-vener

  17. AcEST: BP917712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E03 514 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E03. BP917712 - Show BP9177...is mRNA. clone: YMU001_000104_E03. Accession BP917712 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917712|Adia...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917712|Adiantu...073 PE=4 SV=1 Length = 146 Score = 34.7 bits (78), Expect = 2.5 Identities = 22/91 (24%), Positives = 38/91

  18. AcEST: BP917747 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H10 483 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H10. BP917747 - Show BP9177...is mRNA. clone: YMU001_000104_H10. Accession BP917747 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...s. 25:3389-3402. Query= BP917747|Adiantum capillus-veneris mRNA, clone: YMU001_000104_H10. (483 letters) Dat

  19. AcEST: BP917743 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_H04 524 Adiantum capillus-veneris mRNA. clone: YMU001_000104_H04. BP917743 - Show BP9177...is mRNA. clone: YMU001_000104_H04. Accession BP917743 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917743|Adiantum capi...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917743|Adiantum capillus-veneris mRNA, clo

  20. AcEST: BP917775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_C08 544 Adiantum capillus-veneris mRNA. clone: YMU001_000105_C08. BP917775 - Show BP9177...is mRNA. clone: YMU001_000105_C08. Accession BP917775 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917775|Adiantum capill

  1. AcEST: BP917780 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D03. BP917780 - Show BP9177...is mRNA. clone: YMU001_000105_D03. Accession BP917780 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917780|Ad...) Frame = +1 Query: 229 TLGN*FDLFGPPIRRLPF-WIVLWSILGLA*GGAC 330 TLG D+F P ++LP W+ LWS LG GG C Sbjct: 177

  2. AcEST: BP911775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_A09 285 Adiantum capillus-veneris mRNA. clone: YMU001_000009_A09. BP91177...5 CL2064Contig1 Show BP911775 Clone id YMU001_000009_A09 Library YMU01 Length 285 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000009_A09. Accession BP911775 Tissue type prothallium Developmental stag...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911775...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911775|Adiantum capillus

  3. AcEST: BP917799 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_F02 443 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F02. BP917799 - Show BP9177...is mRNA. clone: YMU001_000105_F02. Accession BP917799 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91779...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917799|Adiantum capillus

  4. AcEST: BP917718 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E11 470 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E11. BP917718 - Show BP9177...is mRNA. clone: YMU001_000104_E11. Accession BP917718 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917718|Adiantum capillus-veneris mRNA, clone: YMU0...es. 25:3389-3402. Query= BP917718|Adiantum capillus-veneris mRNA, clone: YMU001_000104_E11. (470 letters) Da

  5. AcEST: BP917785 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_D09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000105_D09. BP917785 - Show BP9177...is mRNA. clone: YMU001_000105_D09. Accession BP917785 Tissue type prothallium Developmental stage - Contig I...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917785|Adiantum capillus-veneris mRNA,

  6. AcEST: BP917736 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_G08 378 Adiantum capillus-veneris mRNA. clone: YMU001_000104_G08. BP917736 - Show BP9177...is mRNA. clone: YMU001_000104_G08. Accession BP917736 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917736|Adiantum capillus-veneris... programs, Nucleic Acids Res. 25:3389-3402. Query= BP917736|Adiantum capillus-veneris mRNA, clone: YMU001_00

  7. AcEST: BP917708 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_D11 459 Adiantum capillus-veneris mRNA. clone: YMU001_000104_D11. BP9177...08 CL668Contig1 Show BP917708 Clone id YMU001_000104_D11 Library YMU01 Length 459 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000104_D11. Accession BP917708 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP917708|Adiantum capillus-vener...cids Res. 25:3389-3402. Query= BP917708|Adiantum capillus-veneris mRNA, clone: YMU001_000104_D11. (459 lette

  8. AcEST: BP916177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_C01 435 Adiantum capillus-veneris mRNA. clone: YMU001_000084_C01. BP916177 - Show BP916177...is mRNA. clone: YMU001_000084_C01. Accession BP916177 Tissue type prothallium Developmental stage - Contig I...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916177...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916177

  9. AcEST: BP917716 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E09 452 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E09. BP9177...16 CL2904Contig1 Show BP917716 Clone id YMU001_000104_E09 Library YMU01 Length 452 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_E09. Accession BP917716 Tissue type prothallium Developmental stag...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917716|Adiant...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  10. AcEST: BP917771 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_C03 433 Adiantum capillus-veneris mRNA. clone: YMU001_000105_C03. BP917771 - Show BP9177...is mRNA. clone: YMU001_000105_C03. Accession BP917771 Tissue type prothallium Developmental stage - Contig I...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  11. AcEST: BP921773 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A04 367 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A04. BP921773 - Show BP92177...is mRNA. clone: YMU001_000154_A04. Accession BP921773 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921773|Adiantum capillus-ven...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP921773|Adiantum capillus-veneris mRNA, clone: YMU001_00015

  12. AcEST: BP921177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_F04 542 Adiantum capillus-veneris mRNA. clone: YMU001_000146_F04. BP921177 - Show BP921177...is mRNA. clone: YMU001_000146_F04. Accession BP921177 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP921177|Adiantum capillus-veneris mRNA, clone: YMU001_000146_F04....T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921177|Ad

  13. AcEST: BP921778 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A09 262 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A09. BP921778 - Show BP92177...is mRNA. clone: YMU001_000154_A09. Accession BP921778 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92177...s, Nucleic Acids Res. 25:3389-3402. Query= BP921778|Adiantum capillus-veneris mRNA, clone: YMU001_000154_A09

  14. AcEST: BP917751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A03 466 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A03. BP9177...51 CL2236Contig1 Show BP917751 Clone id YMU001_000105_A03 Library YMU01 Length 466 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A03. Accession BP917751 Tissue type prothallium Developmental stag...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917751|Adiantum..., Nucleic Acids Res. 25:3389-3402. Query= BP917751|Adiantum capillus-veneris mRNA, clone: YMU001_000105_A03.

  15. AcEST: BP917768 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_B12 509 Adiantum capillus-veneris mRNA. clone: YMU001_000105_B12. BP917768 - Show BP9177...is mRNA. clone: YMU001_000105_B12. Accession BP917768 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177...Res. 25:3389-3402. Query= BP917768|Adiantum capillus-veneris mRNA, clone: YMU001_000105_B12. (509 letters) D

  16. AcEST: BP917792 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_E06 308 Adiantum capillus-veneris mRNA. clone: YMU001_000105_E06. BP917792 - Show BP9177...is mRNA. clone: YMU001_000105_E06. Accession BP917792 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP917792|Adiantum capillus-veneris mRNA, clone: YMU001_000105_E06. (308 l...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9177

  17. AcEST: BP920125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C12 422 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C12. BP920125 - Show BP92012...is mRNA. clone: YMU001_000133_C12. Accession BP920125 Tissue type prothallium Developmental stage - Contig I...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012

  18. AcEST: BP920120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C05 434 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C05. BP920120 - Show BP92012...is mRNA. clone: YMU001_000133_C05. Accession BP920120 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|Ad...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|

  19. AcEST: BP920124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C09 380 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C09. BP920124 - Show BP92012...is mRNA. clone: YMU001_000133_C09. Accession BP920124 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris ...ic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C09. (380 l

  20. AcEST: BP920127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D02 541 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D02. BP92012...7 CL3843Contig1 Show BP920127 Clone id YMU001_000133_D02 Library YMU01 Length 541 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_D02. Accession BP920127 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adian

  1. AcEST: BP920121 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C06. BP920121 - Show BP92012...is mRNA. clone: YMU001_000133_C06. Accession BP920121 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP920121|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C06. (542 letters...Res. 25:3389-3402. Query= BP920121|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C06. (542 letters) D

  2. AcEST: BP920157 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G01 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G01. BP92015...7 CL541Contig1 Show BP920157 Clone id YMU001_000133_G01 Library YMU01 Length 550 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_G01. Accession BP920157 Tissue type prothallium Developmental stage...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris mRNA,...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris

  3. AcEST: BP920158 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G02 530 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G02. BP92015...8 CL188Contig1 Show BP920158 Clone id YMU001_000133_G02 Library YMU01 Length 530 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_G02. Accession BP920158 Tissue type prothallium Developmental stage.... 25:3389-3402. Query= BP920158|Adiantum capillus-veneris mRNA, clone: YMU001_000133_G02. (530 letters) Data... programs, Nucleic Acids Res. 25:3389-3402. Query= BP920158|Adiantum capillus-ven

  4. AcEST: BP920152 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F06 457 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F06. BP920152 - Show BP92015...is mRNA. clone: YMU001_000133_F06. Accession BP920152 Tissue type prothallium Developmental stage - Contig I...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920152|Adiantu...Res. 25:3389-3402. Query= BP920152|Adiantum capillus-veneris mRNA, clone: YMU001_

  5. AcEST: BP920159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G03 420 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G03. BP920159 - Show BP92015...is mRNA. clone: YMU001_000133_G03. Accession BP920159 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015

  6. AcEST: BP920153 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F08 540 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F08. BP920153 - Show BP92015...is mRNA. clone: YMU001_000133_F08. Accession BP920153 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-veneris mRNA, clone: YMU...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-ve

  7. AcEST: BP920156 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F12 587 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F12. BP92015...6 CL200Contig1 Show BP920156 Clone id YMU001_000133_F12 Library YMU01 Length 587 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_F12. Accession BP920156 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156|Adiantum

  8. AcEST: BP920150 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F04 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F04. BP920150 - Show BP92015...is mRNA. clone: YMU001_000133_F04. Accession BP920150 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 lette...c Acids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 le

  9. AcEST: BP919843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G09 473 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G09. BP91984...3 CL2697Contig1 Show BP919843 Clone id YMU001_000129_G09 Library YMU01 Length 473 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G09. Accession BP919843 Tissue type prothallium Developmental stag...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Ad...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Adiantum capillus-veneris

  10. AcEST: BP919842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G07. BP919842 - Show BP91984...is mRNA. clone: YMU001_000129_G07. Accession BP919842 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris m...c Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G07. (567 le

  11. AcEST: BP911984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F07 566 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F07. BP911984... CL2332Contig1 Show BP911984 Clone id YMU001_000011_F07 Library YMU01 Length 566 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_F07. Accession BP911984 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984|Adiantum capillus-veneris mR...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984

  12. AcEST: BP919840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G05. BP919840 - Show BP91984...is mRNA. clone: YMU001_000129_G05. Accession BP919840 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_...es. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_0

  13. AcEST: BP919847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H01 512 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H01. BP919847 - Show BP91984...is mRNA. clone: YMU001_000129_H01. Accession BP919847 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91984...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919847|Adiantum capillus-veneris mRNA, clone: YMU0

  14. AcEST: BP919845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G11 376 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G11. BP919845 - Show BP91984...is mRNA. clone: YMU001_000129_G11. Accession BP919845 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G1...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus

  15. AcEST: BP919849 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H04 454 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H04. BP919849 - Show BP91984...is mRNA. clone: YMU001_000129_H04. Accession BP919849 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_00...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  16. AcEST: BP918100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_F01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000109_F01. BP918100... CL8Contig1 Show BP918100 Clone id YMU001_000109_F01 Library YMU01 Length 496 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000109_F01. Accession BP918100 Tissue type prothallium Developmental stage -...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918100... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918100|Adia

  17. AcEST: BP914100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_H03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000039_H03. BP914100 - Show BP914100...is mRNA. clone: YMU001_000039_H03. Accession BP914100 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP914100|Adiantum capillus-veneris mRNA, clone: YMU001_000039_H...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914100

  18. AcEST: BP912100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_B06 447 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B06. BP912100 - Show BP912100...is mRNA. clone: YMU001_000015_B06. Accession BP912100 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP912100|Adiantum capillus-veneris mRNA, clone: YMU001_00...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912100|Adiantum capi

  19. AcEST: BP916100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_B04 427 Adiantum capillus-veneris mRNA. clone: YMU001_000083_B04. BP916100... CL115Contig1 Show BP916100 Clone id YMU001_000083_B04 Library YMU01 Length 427 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000083_B04. Accession BP916100 Tissue type prothallium Developmental stage...s, Nucleic Acids Res. 25:3389-3402. Query= BP916100|Adiantum capillus-veneris mRN... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916100

  20. AcEST: BP921008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E02 477 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E02. BP921008 - Show BP92100...is mRNA. clone: YMU001_000144_E02. Accession BP921008 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP921008|Adiantum capillus-veneris mRNA, clone:...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921008|Adiantum capillus-

  1. AcEST: BP914062 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D10 340 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D10. BP914062 - Show BP91406...is mRNA. clone: YMU001_000039_D10. Accession BP914062 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406

  2. AcEST: BP914064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi

  3. AcEST: BP921406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000149_E02 542 Adiantum capillus-veneris mRNA. clone: YMU001_000149_E02. BP921406... CL4001Contig1 Show BP921406 Clone id YMU001_000149_E02 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000149_E02. Accession BP921406 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921406|Adiantum capillus-veneris mRNA, cl...s Res. 25:3389-3402. Query= BP921406|Adiantum capillus-veneris mRNA, clone: YMU00

  4. AcEST: BP912406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406

  5. AcEST: BP914067 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E03 508 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E03. BP91406...7 CL855Contig1 Show BP914067 Clone id YMU001_000039_E03 Library YMU01 Length 508 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E03. Accession BP914067 Tissue type prothallium Developmental stage...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914067|Adiantum capillus-veneris mRNA, c

  6. AcEST: BP914061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c

  7. AcEST: BP914406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406

  8. AcEST: BP920406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_G02 527 Adiantum capillus-veneris mRNA. clone: YMU001_000136_G02. BP920406 - Show BP920406...is mRNA. clone: YMU001_000136_G02. Accession BP920406 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920406|Adiantum capillus-veneris mRNA, clone...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920406|Adiantum capillus-veneris mRNA, c

  9. AcEST: BP914063 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D11 515 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D11. BP914063 - Show BP91406...is mRNA. clone: YMU001_000039_D11. Accession BP914063 Tissue type prothallium Developmental stage - Contig I...es. 25:3389-3402. Query= BP914063|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D11. (515 letters) Da...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914063|Adiantum capillus-veneris mRN

  10. AcEST: BP916406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c

  11. AcEST: BP914068 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:

  12. AcEST: BP913406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM

  13. AcEST: BP915406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433

  14. AcEST: BP912343 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A05 305 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A05. BP912343 - Show BP91234...is mRNA. clone: YMU001_000018_A05. Accession BP912343 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912343|Adiantum capill

  15. AcEST: BP912346 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A08 453 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A08. BP912346 - Show BP91234...is mRNA. clone: YMU001_000018_A08. Accession BP912346 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP912346|Adiantum capillus-veneris mRNA, clone...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234

  16. AcEST: BP912344 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A06 486 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A06. BP91234...4 CL599Contig1 Show BP912344 Clone id YMU001_000018_A06 Library YMU01 Length 486 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000018_A06. Accession BP912344 Tissue type prothallium Developmental stage... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912344|Adiantum capil...leic Acids Res. 25:3389-3402. Query= BP912344|Adiantum capillus-veneris mRNA, clone: YMU001_000018_A06. (468

  17. AcEST: BP912340 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A02 465 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A02. BP91234...0 CL1330Contig1 Show BP912340 Clone id YMU001_000018_A02 Library YMU01 Length 465 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_A02. Accession BP912340 Tissue type prothallium Developmental stag...Nucleic Acids Res. 25:3389-3402. Query= BP912340|Adiantum capillus-veneris mRNA, ...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234

  18. AcEST: BP912349 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A11 539 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A11. BP912349 - Show BP91234...is mRNA. clone: YMU001_000018_A11. Accession BP912349 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91234...ucleic Acids Res. 25:3389-3402. Query= BP912349|Adiantum capillus-veneris mRNA, clone: YMU001_000018_A11. (5

  19. AcEST: BP912342 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_A04 553 Adiantum capillus-veneris mRNA. clone: YMU001_000018_A04. BP91234...2 CL2124Contig1 Show BP912342 Clone id YMU001_000018_A04 Library YMU01 Length 553 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_A04. Accession BP912342 Tissue type prothallium Developmental stag...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912342|Adiantum capillus-veneris mRNA, clone:...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912342|Adiantum capillus-

  20. AcEST: BP919367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_C07 523 Adiantum capillus-veneris mRNA. clone: YMU001_000124_C07. BP919367... CL601Contig1 Show BP919367 Clone id YMU001_000124_C07 Library YMU01 Length 523 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000124_C07. Accession BP919367 Tissue type prothallium Developmental stage...es. 25:3389-3402. Query= BP919367|Adiantum capillus-veneris mRNA, clone: YMU001_000124_C07. (523 letters) Da...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919367|Adiantum ca

  1. AcEST: BP914367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_B03 578 Adiantum capillus-veneris mRNA. clone: YMU001_000058_B03. BP914367 - Show BP914367...is mRNA. clone: YMU001_000058_B03. Accession BP914367 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914367|Adiantum ...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914367|

  2. AcEST: BP913671 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A02 620 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A02. BP913671 - Show BP91367...is mRNA. clone: YMU001_000033_A02. Accession BP913671 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP913671|Adiantum capillus-veneris mRNA, clone: YMU001_000033_A02. ...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913671|Adiantum capillus-veneris mRNA, c

  3. AcEST: BP913676 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A07 497 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A07. BP913676 - Show BP91367...is mRNA. clone: YMU001_000033_A07. Accession BP913676 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP913676|Adiantum capillus-ven...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913676|Adiantum capillus-veneris mRNA, clone:

  4. AcEST: BP913367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_E01 457 Adiantum capillus-veneris mRNA. clone: YMU001_000029_E01. BP913367 - Show BP913367...is mRNA. clone: YMU001_000029_E01. Accession BP913367 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP913367|Adiantum capillus-veneris mRNA, clo...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913367

  5. AcEST: BP913675 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A06 440 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A06. BP913675 - Show BP91367...is mRNA. clone: YMU001_000033_A06. Accession BP913675 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP913675|Adiantum capillus-veneris mRNA,...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367

  6. AcEST: BP913677 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A08 517 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A08. BP913677 - Show BP91367...is mRNA. clone: YMU001_000033_A08. Accession BP913677 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367

  7. AcEST: BP913679 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A11 505 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A11. BP91367...9 CL11Contig1 Show BP913679 Clone id YMU001_000033_A11 Library YMU01 Length 505 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000033_A11. Accession BP913679 Tissue type prothallium Developmental stage ...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91367...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913679|Adiantum cap

  8. AcEST: BP920367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_C07 537 Adiantum capillus-veneris mRNA. clone: YMU001_000136_C07. BP920367 - Show BP920367...is mRNA. clone: YMU001_000136_C07. Accession BP920367 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920367...grams, Nucleic Acids Res. 25:3389-3402. Query= BP920367|Adiantum capillus-veneris mRNA, clone: YMU001_000136

  9. AcEST: BP913674 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A05 472 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A05. BP913674 - Show BP91367...is mRNA. clone: YMU001_000033_A05. Accession BP913674 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP913674|Adiantum capillus-veneris mRNA, cl...rams, Nucleic Acids Res. 25:3389-3402. Query= BP913674|Adiantum capillus-veneris mRNA, clone: YMU001_000033_

  10. AcEST: BP913672 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A03 488 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A03. BP913672 - Show BP91367...is mRNA. clone: YMU001_000033_A03. Accession BP913672 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913672|Adiantum cap...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913672|Adiantum capillus-

  11. AcEST: BP913678 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000033_A10 511 Adiantum capillus-veneris mRNA. clone: YMU001_000033_A10. BP913678 - Show BP91367...is mRNA. clone: YMU001_000033_A10. Accession BP913678 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP913678|Adiantum capillus-veneris mRNA, clone: YMU001_000033_A10. (511 l...s Res. 25:3389-3402. Query= BP913678|Adiantum capillus-veneris mRNA, clone: YMU001_000033_A10. (511 letters)

  12. AcEST: BP918367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F09 563 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F09. BP918367 - Show BP918367...is mRNA. clone: YMU001_000112_F09. Accession BP918367 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918367|Adiantum capillus-veneris mRNA, clone: YMU001_000112_F09. (5...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918367|Adiantum capillus-veneris

  13. AcEST: BP919775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A08 507 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A08. BP919775 - Show BP919775...is mRNA. clone: YMU001_000129_A08. Accession BP919775 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919775|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919775|Adiantum capillus-veneris mRNA,

  14. AcEST: BP916775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000091_D11 369 Adiantum capillus-veneris mRNA. clone: YMU001_000091_D11. BP916775 - Show BP916775...is mRNA. clone: YMU001_000091_D11. Accession BP916775 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP916775|Adiantum capillus-veneris mRNA, clone: YMU001_000091_...programs, Nucleic Acids Res. 25:3389-3402. Query= BP916775|Adiantum capillus-veneris mRNA, clone: YMU001_000

  15. AcEST: BP917753 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A05 482 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A05. BP91775...3 CL2810Contig1 Show BP917753 Clone id YMU001_000105_A05 Library YMU01 Length 482 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A05. Accession BP917753 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917753|Adiant...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917753|Adiantum capillus

  16. AcEST: BP914775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000062_G03 488 Adiantum capillus-veneris mRNA. clone: YMU001_000062_G03. BP914775... CL4173Contig1 Show BP914775 Clone id YMU001_000062_G03 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000062_G03. Accession BP914775 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914775...leic Acids Res. 25:3389-3402. Query= BP914775|Adiantum capillus-veneris mRNA, clo

  17. AcEST: BP920775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000141_D06 589 Adiantum capillus-veneris mRNA. clone: YMU001_000141_D06. BP920775 - Show BP920775...is mRNA. clone: YMU001_000141_D06. Accession BP920775 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920775|Adi...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920775|Adiantum capillus-veneris mRNA, clone: YMU001_000141_D0

  18. AcEST: BP917750 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A02 462 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A02. BP91775...0 CL3417Contig1 Show BP917750 Clone id YMU001_000105_A02 Library YMU01 Length 462 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A02. Accession BP917750 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917750|Adiantu...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917750|Adiantum capillus-veneris mRNA, clone

  19. AcEST: BP915775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000076_F10 565 Adiantum capillus-veneris mRNA. clone: YMU001_000076_F10. BP915775 - Show BP915775...is mRNA. clone: YMU001_000076_F10. Accession BP915775 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915775|Adiantum capillus-veneris mRNA,...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915775|Adiantum capi

  20. AcEST: BP913775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000035_B05 311 Adiantum capillus-veneris mRNA. clone: YMU001_000035_B05. BP913775 - Show BP913775...is mRNA. clone: YMU001_000035_B05. Accession BP913775 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913775|Adiantum capillus...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913775

  1. AcEST: BP917758 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_A12 315 Adiantum capillus-veneris mRNA. clone: YMU001_000105_A12. BP91775...8 CL2869Contig1 Show BP917758 Clone id YMU001_000105_A12 Library YMU01 Length 315 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000105_A12. Accession BP917758 Tissue type prothallium Developmental stag... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91775...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP917758|Adiantum capillus-vener

  2. AcEST: BP919802 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C12. BP919802 - Show BP91980...is mRNA. clone: YMU001_000129_C12. Accession BP919802 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919802|Adiantum capillus-ve...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91980

  3. AcEST: BP919804 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D02 242 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D02. BP91980...4 CL1786Contig1 Show BP919804 Clone id YMU001_000129_D02 Library YMU01 Length 242 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_D02. Accession BP919804 Tissue type prothallium Developmental stag...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919804|Adiantum capillus-veneris m...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919804|Adiantum capillus-veneris m

  4. AcEST: BP919807 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D05 485 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D05. BP91980...7 CL2558Contig1 Show BP919807 Clone id YMU001_000129_D05 Library YMU01 Length 485 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_D05. Accession BP919807 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91980...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919807|Adiantum

  5. AcEST: BP919805 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D03 530 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D03. BP919805 - Show BP91980...is mRNA. clone: YMU001_000129_D03. Accession BP919805 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP919805|Adiantum capillus-veneris mRNA, clone: YMU001_000129_D03. (530 letters)...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919805|Adi

  6. AcEST: BP919803 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D01 477 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D01. BP91980...3 CL2549Contig1 Show BP919803 Clone id YMU001_000129_D01 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_D01. Accession BP919803 Tissue type prothallium Developmental stag...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91980...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91980

  7. AcEST: BP919808 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D06 483 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D06. BP919808 - Show BP91980...is mRNA. clone: YMU001_000129_D06. Accession BP919808 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919808|Adiantum capi...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91980

  8. AcEST: BP919809 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D07 283 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D07. BP919809 - Show BP91980...is mRNA. clone: YMU001_000129_D07. Accession BP919809 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919809|Adiantum capillus...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919809|Adiantum capillus-veneris mRNA, clone: YMU001_000129_

  9. AcEST: BP919806 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_D04 576 Adiantum capillus-veneris mRNA. clone: YMU001_000129_D04. BP919806 - Show BP91980...is mRNA. clone: YMU001_000129_D04. Accession BP919806 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP919806|Adiantum capillus-veneris mRNA, clone: YMU001_000129_D04....ms, Nucleic Acids Res. 25:3389-3402. Query= BP919806|Adiantum capillus-veneris mR

  10. AcEST: BP919800 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C10 406 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C10. BP919800 - Show BP91980...is mRNA. clone: YMU001_000129_C10. Accession BP919800 Tissue type prothallium Developmental stage - Contig I... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919800|Adiantum capillus-veneri...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919800|Adiantum capillus-veneris mRNA, clon

  11. AcEST: BP921010 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E04 526 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E04. BP921010 - Show BP921010...is mRNA. clone: YMU001_000144_E04. Accession BP921010 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA...programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA, clone: YMU001_000...002030-PA (Fragment) OS=Anopheles gambiae GN=AGAP002030 PE=4 SV=4 Length = 2210 S

  12. AcEST: BP913000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_C05 322 Adiantum capillus-veneris mRNA. clone: YMU001_000025_C05. BP913000... CL1177Contig1 Show BP913000 Clone id YMU001_000025_C05 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000025_C05. Accession BP913000 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP913000|Adiantum capillus-veneris mRNA, clone: YMU001_000025_C05. (322 letters) Data...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913000|Adiantum capill

  13. AcEST: BP921016 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E10 528 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E10. BP92101...6 CL35Contig1 Show BP921016 Clone id YMU001_000144_E10 Library YMU01 Length 528 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_E10. Accession BP921016 Tissue type prothallium Developmental stage ... Res. 25:3389-3402. Query= BP921016|Adiantum capillus-veneris mRNA, clone: YMU001... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921016|Adia

  14. AcEST: BP919713 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C09 384 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C09. BP919713 - Show BP91971...is mRNA. clone: YMU001_000128_C09. Accession BP919713 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919713|Adiantum capillus-veneris mRNA, c...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919713|Adiantum capillus-veneris

  15. AcEST: BP911971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_E04 469 Adiantum capillus-veneris mRNA. clone: YMU001_000011_E04. BP911971... CL204Contig1 Show BP911971 Clone id YMU001_000011_E04 Library YMU01 Length 469 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000011_E04. Accession BP911971 Tissue type prothallium Developmental stage..., Nucleic Acids Res. 25:3389-3402. Query= BP911971|Adiantum capillus-veneris mRNA...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911971|Adiantum capillus-veneris mRNA,

  16. AcEST: BP919715 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C11 494 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C11. BP91971...5 CL3828Contig1 Show BP919715 Clone id YMU001_000128_C11 Library YMU01 Length 494 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_C11. Accession BP919715 Tissue type prothallium Developmental stag...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91971... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919715|Adia

  17. AcEST: BP919717 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_D01 387 Adiantum capillus-veneris mRNA. clone: YMU001_000128_D01. BP919717 - Show BP91971...is mRNA. clone: YMU001_000128_D01. Accession BP919717 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919717|Adiantum capill... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919717|Adiantum capillus-veneris mRNA, clone: YMU001_00

  18. AcEST: BP919711 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C07 523 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C07. BP919711 - Show BP91971...is mRNA. clone: YMU001_000128_C07. Accession BP919711 Tissue type prothallium Developmental stage - Contig I...eic Acids Res. 25:3389-3402. Query= BP919711|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C07. (523 ... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919711|Adiantum capillus-ven

  19. AcEST: BP914460 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B08 541 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B08. BP914460 - Show BP9144...is mRNA. clone: YMU001_000059_B08. Accession BP914460 Tissue type prothallium Developmental stage - Contig I...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914460|Adiantum capil...VVFASKVPNDRMSLFSIECKEQGNLHQRDEFFLKSDDANC 143 Query: 383 LLLFPMRTSHLASPFQETTSCS 448 L H P+ +CS Sbjct: 144 YLY

  20. AcEST: BP914403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E06 616 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E06. BP914403 - Show BP9144...is mRNA. clone: YMU001_000058_E06. Accession BP914403 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91440... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914403|Adiantum capillus-veneris mRNA, clone: YM

  1. AcEST: BP914472 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_C09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000059_C09. BP9144...72 CL1425Contig1 Show BP914472 Clone id YMU001_000059_C09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_C09. Accession BP914472 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914472|Adiantum capillus-ve...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  2. AcEST: BP914492 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_E05 529 Adiantum capillus-veneris mRNA. clone: YMU001_000059_E05. BP914492 - Show BP9144...is mRNA. clone: YMU001_000059_E05. Accession BP914492 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914492|Adiantum capillus-ven

  3. AcEST: BP914495 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_E08 565 Adiantum capillus-veneris mRNA. clone: YMU001_000059_E08. BP914495 - Show BP9144...is mRNA. clone: YMU001_000059_E08. Accession BP914495 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914495|Adiantum capillus-veneris mRNA, clone: YMU001_...VAAEAKDDELKANIQDVE-------KDEDGKEHKDT 144 Query: 394 SFRLYDGKSEPESLQSSDQDSFKKPTEIS...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914495|Adiantum capillus-ve

  4. AcEST: BP914410 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_F01 608 Adiantum capillus-veneris mRNA. clone: YMU001_000058_F01. BP914410 - Show BP9144...is mRNA. clone: YMU001_000058_F01. Accession BP914410 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  5. AcEST: BP918144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_A12 555 Adiantum capillus-veneris mRNA. clone: YMU001_000110_A12. BP918144 - Show BP918144...is mRNA. clone: YMU001_000110_A12. Accession BP918144 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918144|Adiantum capillus-veneris mRNA, clone: YMU001_000110_... Nucleic Acids Res. 25:3389-3402. Query= BP918144|Adiantum capillus-veneris mRNA, clone: YMU001_000110_A12.

  6. AcEST: BP914423 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_G03 431 Adiantum capillus-veneris mRNA. clone: YMU001_000058_G03. BP914423 - Show BP9144...is mRNA. clone: YMU001_000058_G03. Accession BP914423 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP914423|Adiantum capillus-veneris mRNA, clone: YM... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914423|Adiantum capillus-veneris mRNA,

  7. AcEST: BP921144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_C05 517 Adiantum capillus-veneris mRNA. clone: YMU001_000146_C05. BP921144 - Show BP921144...is mRNA. clone: YMU001_000146_C05. Accession BP921144 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921144... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921144|Adiant

  8. AcEST: BP914464 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B12 450 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B12. BP914464 - Show BP9144...is mRNA. clone: YMU001_000059_B12. Accession BP914464 Tissue type prothallium Developmental stage - Contig I...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...Nucleic Acids Res. 25:3389-3402. Query= BP914464|Adiantum capillus-veneris mRNA, clone: YMU001_000059_B12. (

  9. AcEST: BP914427 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_G07 481 Adiantum capillus-veneris mRNA. clone: YMU001_000058_G07. BP914427 - Show BP9144...is mRNA. clone: YMU001_000058_G07. Accession BP914427 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...CVPADI 473 Query: 284 AEPGKLDEMFERMDTNNDGRVSFEEFKDAMQLDQSLRKAVLSPLERV 144 EPGKLDE+F++MD N+DG V+F+EFK AMQ D S...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914427|Adiantum ca

  10. AcEST: BP914463 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B11 587 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B11. BP9144...63 CL3104Contig1 Show BP914463 Clone id YMU001_000059_B11 Library YMU01 Length 587 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_B11. Accession BP914463 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914463|Adiantu...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914463|Adiantum capillus-veneris

  11. AcEST: BP914450 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A10 499 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A10. BP9144...50 CL3143Contig1 Show BP914450 Clone id YMU001_000059_A10 Library YMU01 Length 499 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_A10. Accession BP914450 Tissue type prothallium Developmental stag...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  12. AcEST: BP914476 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_D01 391 Adiantum capillus-veneris mRNA. clone: YMU001_000059_D01. BP9144...76 CL2162Contig1 Show BP914476 Clone id YMU001_000059_D01 Library YMU01 Length 391 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_D01. Accession BP914476 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914476|Adiantu...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914476

  13. AcEST: BP916144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_F08 124 Adiantum capillus-veneris mRNA. clone: YMU001_000083_F08. BP916144... CL2703Contig1 Show BP916144 Clone id YMU001_000083_F08 Library YMU01 Length 124 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000083_F08. Accession BP916144 Tissue type prothallium Developmental stag...Res. 25:3389-3402. Query= BP916144|Adiantum capillus-veneris mRNA, clone: YMU001_...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916144|Adi

  14. AcEST: BP915144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_A07 184 Adiantum capillus-veneris mRNA. clone: YMU001_000067_A07. BP915144... CL2423Contig1 Show BP915144 Clone id YMU001_000067_A07 Library YMU01 Length 184 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000067_A07. Accession BP915144 Tissue type prothallium Developmental stag...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915144...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915144|Adiantum capillus

  15. AcEST: BP914486 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_D11 638 Adiantum capillus-veneris mRNA. clone: YMU001_000059_D11. BP914486 - Show BP9144...is mRNA. clone: YMU001_000059_D11. Accession BP914486 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP914486|Adiantum capillus-veneris mRNA, clone: YMU001_000059_D11. (613...ms, Nucleic Acids Res. 25:3389-3402. Query= BP914486|Adiantum capillus-veneris mRNA, clone: YMU001_000059_D1

  16. AcEST: BP914467 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_C03 510 Adiantum capillus-veneris mRNA. clone: YMU001_000059_C03. BP914467 - Show BP9144...is mRNA. clone: YMU001_000059_C03. Accession BP914467 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...Res. 25:3389-3402. Query= BP914467|Adiantum capillus-veneris mRNA, clone: YMU001_

  17. AcEST: BP911440 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000005_A06 228 Adiantum capillus-veneris mRNA. clone: YMU001_000005_A06. BP911440 - Show BP91144...is mRNA. clone: YMU001_000005_A06. Accession BP911440 Tissue type prothallium Developmental stage - Contig I...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91144...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91144

  18. AcEST: BP914466 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_C02 620 Adiantum capillus-veneris mRNA. clone: YMU001_000059_C02. BP914466 - Show BP9144...is mRNA. clone: YMU001_000059_C02. Accession BP914466 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914466|Adiantum capillus-vener... Acids Res. 25:3389-3402. Query= BP914466|Adiantum capillus-veneris mRNA, clone:

  19. AcEST: BP914462 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B10 524 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B10. BP914462 - Show BP9144...is mRNA. clone: YMU001_000059_B10. Accession BP914462 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  20. AcEST: BP914474 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_C11 492 Adiantum capillus-veneris mRNA. clone: YMU001_000059_C11. BP9144...74 CL2234Contig1 Show BP914474 Clone id YMU001_000059_C11 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_C11. Accession BP914474 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914474|Adiantum capillus-veneris mRNA, cl

  1. AcEST: BP914456 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B04 299 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B04. BP9144...56 CL787Contig1 Show BP914456 Clone id YMU001_000059_B04 Library YMU01 Length 299 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000059_B04. Accession BP914456 Tissue type prothallium Developmental stage... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914456|Adiantum capillus-ven

  2. AcEST: BP914452 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A12 535 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A12. BP914452 - Show BP9144...is mRNA. clone: YMU001_000059_A12. Accession BP914452 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP914452|Adiantum capillus-veneris mRNA, clone: YMU001_000059_A12. (535...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914452|Adiantum ca

  3. AcEST: BP914444 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A03 493 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A03. BP9144...44 CL1628Contig1 Show BP914444 Clone id YMU001_000059_A03 Library YMU01 Length 493 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_A03. Accession BP914444 Tissue type prothallium Developmental stag...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914444|Adiantum capillus-veneri

  4. AcEST: BP914454 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_B02 618 Adiantum capillus-veneris mRNA. clone: YMU001_000059_B02. BP914454 - Show BP9144...is mRNA. clone: YMU001_000059_B02. Accession BP914454 Tissue type prothallium Developmental stage - Contig I...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...ms, Nucleic Acids Res. 25:3389-3402. Query= BP914454|Adiantum capillus-veneris mR

  5. AcEST: BP914488 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_E01 492 Adiantum capillus-veneris mRNA. clone: YMU001_000059_E01. BP9144...88 CL2008Contig1 Show BP914488 Clone id YMU001_000059_E01 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_E01. Accession BP914488 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914488|Ad

  6. AcEST: BP914487 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_D12 521 Adiantum capillus-veneris mRNA. clone: YMU001_000059_D12. BP914487 - Show BP9144...is mRNA. clone: YMU001_000059_D12. Accession BP914487 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914487|...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  7. AcEST: BP914496 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_E09 561 Adiantum capillus-veneris mRNA. clone: YMU001_000059_E09. BP9144...96 CL1745Contig1 Show BP914496 Clone id YMU001_000059_E09 Library YMU01 Length 561 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_E09. Accession BP914496 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914496|Adiantu...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914496|Adiantum capillus-veneris

  8. AcEST: BP914443 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A02 529 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A02. BP9144...43 CL1901Contig1 Show BP914443 Clone id YMU001_000059_A02 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_A02. Accession BP914443 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9144

  9. AcEST: BP912219 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E07 496 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E07. BP912219 - Show BP912219...is mRNA. clone: YMU001_000016_E07. Accession BP912219 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912219...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912219|Adiantum capillus-veneris mRNA, clone: Y

  10. AcEST: BP917432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_G02 450 Adiantum capillus-veneris mRNA. clone: YMU001_000100_G02. BP917432... CL1686Contig1 Show BP917432 Clone id YMU001_000100_G02 Library YMU01 Length 450 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_G02. Accession BP917432 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP917432|Adiantum capillus-veneris mRNA, clone: Y...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917432|Adiantum capillu

  11. AcEST: BP914326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F07 599 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F07. BP91432...6 CL274Contig1 Show BP914326 Clone id YMU001_000057_F07 Library YMU01 Length 599 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000057_F07. Accession BP914326 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914326...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  12. AcEST: BP914321 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F02. BP914321 - Show BP91432...is mRNA. clone: YMU001_000057_F02. Accession BP914321 Tissue type prothallium Developmental stage - Contig I... 25:3389-3402. Query= BP914321|Adiantum capillus-veneris mRNA, clone: YMU001_000057_F02. (534 letters) Datab...leic Acids Res. 25:3389-3402. Query= BP914321|Adiantum capillus-veneris mRNA, clone: YMU001_000057_F02. (534

  13. AcEST: BP914432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_G12 488 Adiantum capillus-veneris mRNA. clone: YMU001_000058_G12. BP914432... CL2573Contig1 Show BP914432 Clone id YMU001_000058_G12 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000058_G12. Accession BP914432 Tissue type prothallium Developmental stag...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914432|...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914432|Adiantum ca

  14. AcEST: BP914324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F05 457 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F05. BP91432...4 CL2609Contig1 Show BP914324 Clone id YMU001_000057_F05 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000057_F05. Accession BP914324 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914324|Adiantum capillus-vener...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  15. AcEST: BP914328 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F09 454 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F09. BP914328 - Show BP91432...is mRNA. clone: YMU001_000057_F09. Accession BP914328 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  16. AcEST: BP914320 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F01 393 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F01. BP914320 - Show BP91432...is mRNA. clone: YMU001_000057_F01. Accession BP914320 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914320|Adiantum capillus-veneris mRNA, clone: Y...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  17. AcEST: BP920432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_A06 513 Adiantum capillus-veneris mRNA. clone: YMU001_000137_A06. BP920432 - Show BP920432...is mRNA. clone: YMU001_000137_A06. Accession BP920432 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920432...eic Acids Res. 25:3389-3402. Query= BP920432|Adiantum capillus-veneris mRNA, clone: YMU001_000137_A06. (513

  18. AcEST: BP918432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D10 502 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D10. BP918432... CL2516Contig1 Show BP918432 Clone id YMU001_000113_D10 Library YMU01 Length 502 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D10. Accession BP918432 Tissue type prothallium Developmental stag...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918432...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918432|

  19. AcEST: BP921521 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000150_H10 495 Adiantum capillus-veneris mRNA. clone: YMU001_000150_H10. BP921521... CL1722Contig1 Show BP921521 Clone id YMU001_000150_H10 Library YMU01 Length 495 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000150_H10. Accession BP921521 Tissue type prothallium Developmental stag... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521|Adia

  20. AcEST: BP921821 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_E10 497 Adiantum capillus-veneris mRNA. clone: YMU001_000154_E10. BP921821 - Show BP921821...is mRNA. clone: YMU001_000154_E10. Accession BP921821 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capill...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capillus-veneris mRNA, clone: Y...ct: 159 PTSLIQPSIVTSKKEETGIDEIIRGMRDLQIKFAKLEEKGQSPRISTKQKPRLMEGVVHR 218 Query: 237 CIWCDSTDHGRRDC 196 C+WCD+ DH RR+C Sbjct: 21

  1. AcEST: BP921211 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A08 189 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A08. BP921211 - Show BP92121...is mRNA. clone: YMU001_000147_A08. Accession BP921211 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921211|Adiantum capillus-veneris... 25:3389-3402. Query= BP921211|Adiantum capillus-veneris mRNA, clone: YMU001_000147_A08. (189 letters) Datab

  2. AcEST: BP921219 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B05 600 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B05. BP92121...9 CL3191Contig1 Show BP921219 Clone id YMU001_000147_B05 Library YMU01 Length 600 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000147_B05. Accession BP921219 Tissue type prothallium Developmental stag...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921219|Adiantum capillus-...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  3. AcEST: BP921021 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_F03 449 Adiantum capillus-veneris mRNA. clone: YMU001_000144_F03. BP921021... CL4025Contig1 Show BP921021 Clone id YMU001_000144_F03 Library YMU01 Length 449 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_F03. Accession BP921021 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRNA, clone: Y...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRN

  4. AcEST: BP921216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B01 347 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B01. BP921216 - Show BP92121...is mRNA. clone: YMU001_000147_B01. Accession BP921216 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP921216|Adiantum capillus-veneris mRNA, clone: YMU001_00...tities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 116 LLQTLIVTGYISFDEHLHNPHLSKHSALHITK 21 L LI...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  5. AcEST: BP917474 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_C07 287 Adiantum capillus-veneris mRNA. clone: YMU001_000101_C07. BP917474... CL2332Contig1 Show BP917474 Clone id YMU001_000101_C07 Library YMU01 Length 287 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000101_C07. Accession BP917474 Tissue type prothallium Developmental stag...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917474|Adiantum capil...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917474|Adiantum capillus-veneris mRNA, clone: YMU001_

  6. AcEST: BP915910 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D05 543 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D05. BP915910 - Show BP91591...is mRNA. clone: YMU001_000079_D05. Accession BP915910 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP915910|Adiantum capillus-veneris mRNA, clone: YMU001_000079_D05. (543 letters) Data...s Res. 25:3389-3402. Query= BP915910|Adiantum capillus-veneris mRNA, clone: YMU00

  7. AcEST: BP915915 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D11 468 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D11. BP915915 - Show BP91591...is mRNA. clone: YMU001_000079_D11. Accession BP915915 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP915915|Adiantum capillus-ven...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91591

  8. AcEST: BP915919 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_E03 400 Adiantum capillus-veneris mRNA. clone: YMU001_000079_E03. BP91591...9 CL3486Contig1 Show BP915919 Clone id YMU001_000079_E03 Library YMU01 Length 400 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000079_E03. Accession BP915919 Tissue type prothallium Developmental stag...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91591...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915919|Adiant

  9. AcEST: BP921591 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000151_H01 458 Adiantum capillus-veneris mRNA. clone: YMU001_000151_H01. BP921591 - Show BP921591...is mRNA. clone: YMU001_000151_H01. Accession BP921591 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP921591|Adiantum capillus-veneris mRNA, clone: YMU001_000151_H0...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921591

  10. AcEST: BP915913 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D08 427 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D08. BP915913 - Show BP91591...is mRNA. clone: YMU001_000079_D08. Accession BP915913 Tissue type prothallium Developmental stage - Contig I...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91591...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91591

  11. AcEST: BP915917 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_E01 288 Adiantum capillus-veneris mRNA. clone: YMU001_000079_E01. BP915917 - Show BP91591...is mRNA. clone: YMU001_000079_E01. Accession BP915917 Tissue type prothallium Developmental stage - Contig I...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915917|Adiantum capillus-veneris mR...s Res. 25:3389-3402. Query= BP915917|Adiantum capillus-veneris mRNA, clone: YMU00

  12. AcEST: BP915911 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D06 571 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D06. BP91591...1 CL46Contig1 Show BP915911 Clone id YMU001_000079_D06 Library YMU01 Length 571 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000079_D06. Accession BP915911 Tissue type prothallium Developmental stage ...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915911|Adi... Res. 25:3389-3402. Query= BP915911|Adiantum capillus-veneris mRNA, clone: YMU001

  13. AcEST: BP915912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D07 482 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D07. BP915912 - Show BP91591...is mRNA. clone: YMU001_000079_D07. Accession BP915912 Tissue type prothallium Developmental stage - Contig I...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915912|Adiantum capillus-veneris mR...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2...5:3389-3402. Query= BP915912|Adiantum capillus-veneris mRNA, clone: YMU001_000079_D07. (482 letters) Databas

  14. AcEST: BP911591 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000006_G06 296 Adiantum capillus-veneris mRNA. clone: YMU001_000006_G06. BP911591 - Show BP911591...is mRNA. clone: YMU001_000006_G06. Accession BP911591 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911591|Adiantum capil...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911591|Adiantum capillus-vene

  15. AcEST: BP919218 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E11 400 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E11. BP919218 - Show BP91921...is mRNA. clone: YMU001_000122_E11. Accession BP919218 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919218|Adiantum capillus-ven...leic Acids Res. 25:3389-3402. Query= BP919218|Adiantum capillus-veneris mRNA, clo

  16. AcEST: BP919216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E09 388 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E09. BP919216 - Show BP91921...is mRNA. clone: YMU001_000122_E09. Accession BP919216 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919216|Adiantum cap...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919216|Adiantum capillus-veneris

  17. AcEST: BP919213 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E06 293 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E06. BP919213 - Show BP91921...is mRNA. clone: YMU001_000122_E06. Accession BP919213 Tissue type prothallium Developmental stage - Contig I...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919213|Adiantu...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91921

  18. AcEST: BP919211 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E04 158 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E04. BP919211 - Show BP91921...is mRNA. clone: YMU001_000122_E04. Accession BP919211 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP919211|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E04. (1...Nucleic Acids Res. 25:3389-3402. Query= BP919211|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E04. (

  19. AcEST: BP919214 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E07 486 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E07. BP919214 - Show BP91921...is mRNA. clone: YMU001_000122_E07. Accession BP919214 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919214|Adiantum c...Nucleic Acids Res. 25:3389-3402. Query= BP919214|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E07. (

  20. AcEST: BP919215 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E08 525 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E08. BP919215 - Show BP91921...is mRNA. clone: YMU001_000122_E08. Accession BP919215 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP919215|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E08. (...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91921

  1. AcEST: BP919217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E10 547 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E10. BP91921...7 CL1907Contig1 Show BP919217 Clone id YMU001_000122_E10 Library YMU01 Length 547 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000122_E10. Accession BP919217 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919217|Adiantum capillus-ven...ds Res. 25:3389-3402. Query= BP919217|Adiantum capillus-veneris mRNA, clone: YMU001_000122_E10. (547 letters

  2. AcEST: BP921220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B06 550 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B06. BP921220 - Show BP921220...is mRNA. clone: YMU001_000147_B06. Accession BP921220 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, clone...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, c

  3. AcEST: BP913220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_G12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000027_G12. BP913220 - Show BP913220...is mRNA. clone: YMU001_000027_G12. Accession BP913220 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP913220|Adiantum capillus-veneris...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913220

  4. AcEST: BP915220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_H10 510 Adiantum capillus-veneris mRNA. clone: YMU001_000067_H10. BP915220 - Show BP915220...is mRNA. clone: YMU001_000067_H10. Accession BP915220 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220|Adiantum capillus-veneris mRNA, clone: YMU

  5. AcEST: BP912220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E08 357 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E08. BP912220 - Show BP912220...is mRNA. clone: YMU001_000016_E08. Accession BP912220 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220

  6. AcEST: BP912209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D06 540 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D06. BP912209 - Show BP91220...is mRNA. clone: YMU001_000016_D06. Accession BP912209 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris... programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris mRNA, clone: YMU001_00

  7. AcEST: BP912206 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D03 484 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D03. BP912206 - Show BP91220...is mRNA. clone: YMU001_000016_D03. Accession BP912206 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912206|Adiantum capi...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220

  8. AcEST: BP917220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_G09 125 Adiantum capillus-veneris mRNA. clone: YMU001_000097_G09. BP917220 - Show BP917220...is mRNA. clone: YMU001_000097_G09. Accession BP917220 Tissue type prothallium Developmental stage - Contig I...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220|Adiantum capillus-veneris

  9. AcEST: BP912207 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D04 249 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D04. BP912207 - Show BP91220...is mRNA. clone: YMU001_000016_D04. Accession BP912207 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220

  10. AcEST: BP912200 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_C08 572 Adiantum capillus-veneris mRNA. clone: YMU001_000016_C08. BP91220...0 CL3270Contig1 Show BP912200 Clone id YMU001_000016_C08 Library YMU01 Length 572 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_C08. Accession BP912200 Tissue type prothallium Developmental stag...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-veneris mRNA, clo...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-vener

  11. AcEST: BP919411 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G09 152 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G09. BP919411 - Show BP91941...is mRNA. clone: YMU001_000124_G09. Accession BP919411 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP919411|Adiantum capillus-veneris mRNA, clone: YMU...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919411

  12. AcEST: BP919412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G10 434 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G10. BP91941...2 CL2856Contig1 Show BP919412 Clone id YMU001_000124_G10 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000124_G10. Accession BP919412 Tissue type prothallium Developmental stag...ids Res. 25:3389-3402. Query= BP919412|Adiantum capillus-veneris mRNA, clone: YMU... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919412|Adiant

  13. AcEST: BP919415 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H01 568 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H01. BP919415 - Show BP91941...is mRNA. clone: YMU001_000124_H01. Accession BP919415 Tissue type prothallium Developmental stage - Contig I...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP919415|Adiantum capillus-veneris mRNA, clone: YMU001_00012...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91941

  14. AcEST: BP919416 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H02 461 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H02. BP91941...6 CL1302Contig1 Show BP919416 Clone id YMU001_000124_H02 Library YMU01 Length 461 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000124_H02. Accession BP919416 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919416|Adiantum capillus-ven...leic Acids Res. 25:3389-3402. Query= BP919416|Adiantum capillus-veneris mRNA, clo

  15. AcEST: BP919418 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H05 528 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H05. BP919418 - Show BP91941...is mRNA. clone: YMU001_000124_H05. Accession BP919418 Tissue type prothallium Developmental stage - Contig I...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91941...Acids Res. 25:3389-3402. Query= BP919418|Adiantum capillus-veneris mRNA, clone: Y

  16. AcEST: BP919417 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_H03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000124_H03. BP919417 - Show BP91941...is mRNA. clone: YMU001_000124_H03. Accession BP919417 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919417|Adiantum capillus-veneris mRNA, clone: YMU001_00.... 25:3389-3402. Query= BP919417|Adiantum capillus-veneris mRNA, clone: YMU001_000124_H03. (445 letters) Data

  17. AcEST: BP919413 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G11 518 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G11. BP919413 - Show BP91941...is mRNA. clone: YMU001_000124_G11. Accession BP919413 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919413|Adiantum capillu...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91941

  18. AcEST: BP920041 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D04 403 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D04. BP920041 - Show BP92004...is mRNA. clone: YMU001_000132_D04. Accession BP920041 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92004...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920041|Adiantum capillus

  19. AcEST: BP920048 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D11 495 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D11. BP920048 - Show BP92004...is mRNA. clone: YMU001_000132_D11. Accession BP920048 Tissue type prothallium Developmental stage - Contig I...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92004... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920048|Adia

  20. AcEST: BP920040 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D03. BP920040 - Show BP92004...is mRNA. clone: YMU001_000132_D03. Accession BP920040 Tissue type prothallium Developmental stage - Contig I...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920040|Adiantum...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920040|Adiantum capillus-veneris

  1. AcEST: BP920046 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D09 477 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D09. BP92004...6 CL809Contig1 Show BP920046 Clone id YMU001_000132_D09 Library YMU01 Length 477 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_D09. Accession BP920046 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920046|Adiantum capillus-vener... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92004

  2. AcEST: BP920049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D12 529 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D12. BP92004...9 CL2156Contig1 Show BP920049 Clone id YMU001_000132_D12 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000132_D12. Accession BP920049 Tissue type prothallium Developmental stag...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920049|Adiantum capillus-veneris mRNA, clone: ...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920049|Adiantum ca

  3. AcEST: BP920042 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D05 442 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D05. BP920042 - Show BP92004...is mRNA. clone: YMU001_000132_D05. Accession BP920042 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92004...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9200

  4. AcEST: BP920044 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D07 191 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D07. BP920044 - Show BP92004...is mRNA. clone: YMU001_000132_D07. Accession BP920044 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920044|Ad...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920044|Adiantum capillus-veneris mRNA, clone: YMU001_

  5. AcEST: BP920043 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_D06 452 Adiantum capillus-veneris mRNA. clone: YMU001_000132_D06. BP920043 - Show BP92004...is mRNA. clone: YMU001_000132_D06. Accession BP920043 Tissue type prothallium Developmental stage - Contig I..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92004...25:3389-3402. Query= BP920043|Adiantum capillus-veneris mRNA, clone: YMU001_00013...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res.

  6. AcEST: BP912004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H08 340 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H08. BP912004... CL875Contig1 Show BP912004 Clone id YMU001_000011_H08 Library YMU01 Length 340 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000011_H08. Accession BP912004 Tissue type prothallium Developmental stage... Nucleic Acids Res. 25:3389-3402. Query= BP912004|Adiantum capillus-veneris mRNA, clone: YMU001_000011_H08. ...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912004|Adiantum capi

  7. AcEST: BP918818 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_G09 538 Adiantum capillus-veneris mRNA. clone: YMU001_000117_G09. BP918818 - Show BP918818...is mRNA. clone: YMU001_000117_G09. Accession BP918818 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP918818|Adiantum capillus-veneris mRNA, clone: YMU001_000117_G09. (525 letters) Dat...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918818|Adiantum capillus-veneris mRNA, clon

  8. AcEST: BP912581 [AcEST

    Lifescience Database Archive (English)

    Full Text Available wiss-Prot sp_hit_id P03594 Definition sp|P03594|ORF2A_BMV RNA-directed RNA polyme...g significant alignments: (bits) Value sp|P03594|ORF2A_BMV RNA-directed RNA polym...sp|A6T691|LIPB_KLEP7 Octanoyltransferase OS=Klebsiella pneumonia... 29 9.1 >sp|P03594|ORF2A_BMV RNA-directed

  9. AcEST: BP920877 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ss-Prot sp_hit_id Q39090 Definition sp|Q39090|UFO_ARATH Protein UNUSUAL FLORAL OR...g significant alignments: (bits) Value sp|Q39090|UFO_ARATH Protein UNUSUAL FLORAL... 6.7 sp|P41951|PQN25_CAEEL Prion-like-(Q/N-rich) domain-bearing prote... 30 6.8 >sp|Q39090|UFO_ARATH Protein UNUSUAL

  10. Dicty_cDB: FC-BP14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BP14 (Link to dictyBase) - - - Contig-U15220-1 FC-BP14P (Li...nk to Original site) FC-BP14F 507 FC-BP14Z 675 FC-BP14P 1182 - - Show FC-BP14 Library FC (Link to library) Clone ID FC-BP1...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BP/FC-BP14Q.Seq.d/ Repr...esentative seq. ID FC-BP14P (Link to Original site) Representative DNA sequence >FC-BP14 (FC-BP14Q) /CSM/FC/FC-BP/FC-BP1... CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-BP14 (FC-BP14Q) /CSM/FC/FC-BP/FC-BP1

  11. Genome sequencing and annotation of Stenotrophomonas sp. SAM8

    Directory of Open Access Journals (Sweden)

    Samy Selim

    2015-12-01

    Full Text Available We report draft genome sequence of Stenotrophomonas sp. strain SAM8, isolated from environmental water. The draft genome size is 3,665,538 bp with a G + C content of 67.2% and contains 6 rRNA sequence (single copies of 5S, 16S & 23S rRNA. The genome sequence can be accessed at DDBJ/EMBL/GenBank under the accession no. LDAV00000000.

  12. Non-contiguous finished genome sequence and description of Brevibacterium senegalense sp. nov.

    OpenAIRE

    Kokcha, Sahare; Ramasamy, Dhamodharan; Lagier, Jean-Christophe; Robert, Catherine; Raoult, Didier; Fournier, Pierre-Edouard

    2012-01-01

    Brevibacterium senegalense strain JC43T sp. nov. is the type strain of Brevibacterium senegalense sp. nov., a new species within the Brevibacterium genus. This strain, whose genome is described here, was isolated from the fecal flora of a healthy Senegalese patient. B. senegalense is an aerobic rod-shaped Gram-positive bacterium. Here we describe the features of this organism, together with the complete genome sequence and annotation. The 3,425,960 bp long genome (1 chromosome but no plasmid)...

  13. Genome Sequence of Marine Bacterium Idiomarina sp. Strain 28-8, Isolated from Korean Ark Shells.

    Science.gov (United States)

    Kim, Woo-Jin; Kim, Young-Ok; Kim, Dong-Gyun; Nam, Bo-Hye; Kong, Hee Jeong; Jung, Hyungtaek; Lee, Sang-Jun; Kim, Dong-Wook; Kim, Dae-Soo; Chae, Sung-Hwa

    2013-10-03

    Idiomarina sp. strain 28-8 is an aerobic, Gram-negative, flagellar bacterium isolated from the bodies of ark shells (Scapharca broughtonii) collected from underwater sediments in Gangjin Bay, South Korea. Here, we present the draft genome sequence of Idiomarina sp. 28-8 (2,971,606 bp, with a G+C content of 46.9%), containing 2,795 putative coding sequences.

  14. Genome Sequence of Rhodococcus sp. Strain BCP1, a Biodegrader of Alkanes and Chlorinated Compounds

    Science.gov (United States)

    Cappelletti, M.; Di Gennaro, P.; D’Ursi, P.; Orro, A.; Mezzelani, A.; Landini, M.; Fedi, S.; Frascari, D.; Presentato, A.; Milanesi, L.

    2013-01-01

    Rhodococcus sp. strain BCP1 cometabolizes chlorinated compounds and mineralizes a broad range of alkanes, as it is highly tolerant to them. The high-quality draft genome sequence of Rhodococcus sp. strain BCP1, consisting of 6,231,823 bp, with a G+C content of 70.4%, 5,902 protein-coding genes, and 58 RNA genes, is presented here. PMID:24158549

  15. AcEST: BP919303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1.2 sp|Q6P6V7|EAPA2_RAT Experimental autoimmune prostatitis antigen ... 32 1.6 sp|Q28FN6|OTX2_XENTR Homeobox...32 2.7 sp|Q6QR59|EAPA2_MOUSE Experimental autoimmune prostatitis antige... 32 2.7 sp|Q91813|OTX2A_XENLA Home...TTASPAGY 49 >sp|Q6P6V7|EAPA2_RAT Experimental autoimmune prostatitis antigen 2 ho...SVPTIASSSAPVSIWSPASISPLSDPLSTS---------SSCMQRSYPMTYTQAS 183 >sp|Q6QR59|EAPA2_MOUSE Experimental autoimmune p

  16. AcEST: BP919646 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Link to BlastX Result : Swiss-Prot sp_hit_id Q60847 Definition sp|Q60847|COCA1_MO...Sequences producing significant alignments: (bits) Value sp|Q60847|COCA1_MOUSE Co...llagen alpha-1(XII) chain OS=Mus musculu... 31 2.8 sp|Q99715|COCA1_HUMAN Collagen alpha-1(XII) chain OS=Homo...STRCO L-asparagine oxygenase OS=Streptomyces coel... 30 6.0 >sp|Q60847|COCA1_MOUS... 352 +++S++ +G D+ L EL+SGEE+++P Sbjct: 311 EIISQVCSGVDEQLGELVSGEEVIEP 336 >sp|Q99715|COCA1_HUMAN Collagen al

  17. Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?

    Directory of Open Access Journals (Sweden)

    K. M. Usrey

    2014-01-01

    Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.

  18. AcEST: BP921774 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_A05 442 Adiantum capillus-veneris mRNA. clone: YMU001_000154_A05. BP921774 - Show BP92177...is mRNA. clone: YMU001_000154_A05. Accession BP921774 Tissue type prothallium Developmental stage - Contig I...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25...: 414 TDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEVALDQKGL 473 Query: 177 IADRMLIFIDSNNDLYIACIVK----...bjct: 414 TDILNAQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEIALDQKGL 473 Query: 177 IADRMLIFIDSNNDLYIACIVK

  19. AcEST: BP915659 [AcEST

    Lifescience Database Archive (English)

    Full Text Available protein ZO-1 OS=Mus musculus ... 32 1.3 sp|O02491|HMEN_ANOGA Segmentation polarity homeobox protein engr......QAIHRIDSPGLKPASQQKAEASSPVPYLSP 934 >sp|O02491|HMEN_ANOGA Segmentation polarity ho

  20. AcEST: BP914721 [AcEST

    Lifescience Database Archive (English)

    Full Text Available protein ZO-1 OS=Mus musculus ... 32 1.3 sp|O02491|HMEN_ANOGA Segmentation polarity homeobox protein engr......QAIHRIDSPGLKPASQQKAEASSPVPYLSP 934 >sp|O02491|HMEN_ANOGA Segmentation polarity ho

  1. AcEST: BP912197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _CICAR Metallothionein-like protein 1 OS=Cicer arie... 31 4.9 sp|O02671|LEPR_PIG Leptin...jct: 12 CGDQCKCNKRSGLSYVEAGETTETVVLGVGPTKIHFEGAEMSVAAEDGGCKCGSSCTC 69 >sp|O02671|LEPR_PIG Leptin receptor OS

  2. AcEST: BP918428 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ophilum GN=... 32 1.1 sp|Q46444|QHED_COMTE Quinohaemoprotein ethanol dehydrogenas...WDVGYKLDL-SKTSGLPKWAL----TELIKGKPVKIGDRIITPEEVADPAHK 181 >sp|Q46444|QHED_COMTE Quinohaemoprotein ethanol deh

  3. AcEST: BP920976 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 89|TPM_CHLNI Tropomyosin OS=Chlamys nipponensis akazara P... 43 6e-04 sp|Q60952|C...448 EKEASEKAQWQNEKDRINQIQQLKIDIEELKFQADRAERE 487 >sp|O02389|TPM_CHLNI Tropomyosin OS=Chlamys nipponensis akazara

  4. AcEST: BP920304 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q0AAM1 Definition sp|Q0AAM1|IHFA_ALHEH Integration... Value sp|Q0AAM1|IHFA_ALHEH Integration host factor subunit alpha OS=Al... 30 4.9 sp|Q4ZUG1|IHFA_PSEU2 Integration... host factor subunit alpha OS=Ps... 29 6.4 sp|Q883H6|IHFA_PSESM Integration... host factor subunit alpha OS=Ps... 29 6.4 sp|Q3KEX6|IHFA_PSEPF Integration host factor subunit alpha OS=Ps...... 29 6.4 sp|Q4KEV8|IHFA_PSEF5 Integration host factor subunit alpha OS=Ps... 29 6.4 sp|Q1IC09|IHFA_PSEE4 Integration

  5. AcEST: BP913980 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Value sp|Q9SZJ5|GLYM_ARATH Serine hydroxymethyltransferase, mitochondr... 160 4e-39 sp|P34897|GLYM_HUMAN Ser...ine hydroxymethyltransferase, mitochondr... 157 4e-38 sp|Q3SZ20|GLYM_BOVIN Serine hydroxymethyltransferase, mitochondr....hondria... 156 6e-38 sp|P14519|GLYM_RABIT Serine hydroxymethyltransferase, mitochondr... 153 4e-37 sp|P50433...|GLYM_SOLTU Serine hydroxymethyltransferase, mitochondr... 150 3e-36 sp|P50432|GLYC_CAEEL Serine hydroxymeth...2e-31 sp|Q6FQ44|GLYM_CANGA Serine hydroxymethyltransferase, mitochondr... 125 9e-29 sp|O13425|GLYM_CANAL Ser

  6. AcEST: BP914438 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ibosome biogenesis protein BOP1 OS=Homo sa... 105 1e-22 sp|O74399|YOCD_SCHPO Unch... WR V D ++ LT ++ ++ + G++ Sbjct: 166 RDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQF 212 >sp|O74399|YOCD_SCH

  7. AcEST: BP918091 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ult : Swiss-Prot sp_hit_id O60306 Definition sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sap...producing significant alignments: (bits) Value sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo s...api... 102 6e-31 sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus muscu... 102 6e-31 sp|O94508|CWF...protein 6 homolog 2 ... 32 2.1 sp|Q8TUI2|CDC62_METAC Cell division control protein 6 homolog 2 ... 32 2.1 >sp|O60306|AQR_HUMAN Intro... WL DIILGYGDP +A Sbjct: 670 LETIRNLMNTDCVVPDWLHDIILGYGDPSSA 700 >sp|Q8CFQ3|AQR_MOUSE Intron-binding protein

  8. Levan fructotransferase from Arthrobacter oxydans J17-21 catalyzes the formation of the di-D-fructose dianhydride IV from levan.

    Science.gov (United States)

    Jang, Ki-Hyo; Ryu, Eun-Ja; Park, Buem-Seek; Song, Ki-Bang; Kang, Soon Ah; Kim, Chul Ho; Uhm, Tai-Boong; Park, Yong-Il; Rhee, Sang-Ki

    2003-04-23

    A new levan fructotransferase (LFTase) isolated from Arthrobacter oxydans J17-21 was characterized for the production of difructose dianhydride IV (DFA IV). LFTase was purified to apparent homogeneity by Q-Sepharose ion exchange chromatography, Mono-Q HR 5/5 column chromatography, and gel permeation chromatography. The enzyme had an apparent molecular mass of 54000 Da. The optimum pH for the enzyme-catalyzed reaction was pH 6.5, and the optimum temperature was observed at 45 degrees C. The LFTase was activated by the presence of CaCl(2) and EDTA-2Na but inhibited strongly by MnCl(2) and CuSO(4) at 1 mM and completely by FeSO(4) and Ag(2)SO(4) at 1 mM. A bacterial levan from Zymomonas mobilis was incubated with an LFTase; final conversion yield from the levan to DFA IV was 35%. Neither inulin, levanbiose, sucrose, dextran, nor starch was hydrolyzed by LFTase. DFA IV was very stable at acidic pH and high temperature, thus indicating that DFA IV may be suitable for the food industry and related areas. PMID:12696949

  9. Interaction mechanism between Arthrobacter oxydans and BaP-Cd%氧化节杆菌与苯并[a]芘-镉交互作用机理

    Institute of Scientific and Technical Information of China (English)

    邓军; 尹华; 叶锦韶; 彭辉; 秦华明; 龙焰; 何宝燕; 张娜

    2010-01-01

    利用HPLC、FTIR分析技术,研究了氧化节杆菌(Arthrobacter oxydans)对水体中苯并[a]芘(BaP)-镉(Cd)复合污染物交互作用机理.结果表明,BaP、Cd及BaP-Cd复合污染均对菌株的正常生长产生影响,其影响程度为:BaP-Cd>Cd>BaP;使用该菌投加到BaP、Cd浓度均为1 mg·L~(-1)的BaP-Cd复合污染无机盐溶液中,30 ℃、130 r·min~(-1),培养5 d后,体系BaP、Cd的残留量分别为0.39、0.65 mg·L~(-1);添加一定浓度的H_2O_2并保持体系呈偏碱性更适于该复合污染的处理.红外扫描分析显示,在微生物作用下,BaP的结构发生改变,菌株降解BaP和吸附Cd的过程主要与羟基、CC键、酰胺基团和C-H键有关.

  10. Toxicity screening of soils from different mine areas—A contribution to track the sensitivity and variability of Arthrobacter globiformis assay

    Energy Technology Data Exchange (ETDEWEB)

    Marques, Catarina R., E-mail: crmarques@ua.pt [Departamento de Biologia and CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus Universitário de Santiago, 3810-193 Aveiro (Portugal); Caetano, Ana L. [Departamento de Biologia and CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus Universitário de Santiago, 3810-193 Aveiro (Portugal); Haller, Andreas [ECT Oekotoxikologie GmbH, Böttgerstraße 2–14, D-65439 Flörsheim a. M. (Germany); Gonçalves, Fernando [Departamento de Biologia and CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus Universitário de Santiago, 3810-193 Aveiro (Portugal); Pereira, Ruth [Faculdade de Ciências da Universidade do Porto, Rua do Campo Alegre, s/n, 4169-007 Porto (Portugal); Interdisciplinary Centre of Marine and Environmental Research (CIIMAR/CIMAR), Universidade do Porto, Rua dos Bragas 289, P 4050-123 Porto (Portugal); Römbke, Jörg [ECT Oekotoxikologie GmbH, Böttgerstraße 2–14, D-65439 Flörsheim a. M. (Germany)

    2014-06-01

    Highlights: • The assay gave rapid and feasible discrimination of toxic soils to A. globiformis. • Sensitive and low variability response to soils from different regions. • Soil properties may interfere with metal toxicity and fluorescence measurements. • Proposal of a toxicity threshold for the contact assay regarding soils. • A. globiformis assay should be included in the Tier I of risk assessment frameworks. - Abstract: This study used the Arthrobacter globiformis solid-contact test for assessing the quality of soils collected in areas subjected to past and present mine activities in Europe (uranium mine, Portugal) and North Africa (phosphogypsum pile, Tunisia; iron mine, Morocco). As to discriminate the influence of soils natural variability from the effect of contaminants, toxicity thresholds were derived for this test, based on the dataset of each study area. Furthermore, the test sensitivity and variability was also evaluated. As a result, soils that inhibited A. globiformis dehydrogenase activity above 45% or 50% relatively to the control, were considered to be toxic. Despite the soil metal content determined, the properties of soils seemed to influence dehydrogenase activity. Overall, the contact test provided a coherent outcome comparing to other more time-consuming and effort-demanding ecotoxicological assays. Our results strengthened the feasibility and ecological relevance of this assay, which variability was quite reduced hence suggesting its potential integration within the test battery of tier 1 of soil risk assessment schemes.

  11. Characteristics of an organic solvent-tolerant β-fructofuranosidase from Arthrobacter arilaitensis NJEM01 and efficient synthesis of prebiotic kestose.

    Science.gov (United States)

    Chu, Jianlin; Wu, Xueming; Wu, Bin; Wang, Rui; He, Bingfang

    2014-06-18

    An organic solvent-tolerant β-fructofuranosidase (β-FFase) from Arthrobacter arilaitensis NJEM01 was purified, characterized, cloned, and overexpressed in Escherichia coli. The mature β-FFase contained 495 amino acid residues with an estimated molecular mass of 55 kDa. The purified β-FFase from strain NJEM01 was very stable in the buffer systems (pH 5.0-9.5) and showed high stability below 45 °C. Furthermore, the enzyme exhibited relatively high solvent stability in various aqueous organic mixtures and retained nearly 100% of its initial activity after incubation for 10 days in 20% (v/v) DMSO. In addition, the β-FFase exhibited high transfructosylation activity, synthesized prebiotic products of mainly 6-kestose (up to 476 g/L), and showed fructosyl receptor specificity to C-glucosyl flavone. A relatively high yield of FOS was achieved by the β-FFase from bacterium with a high concentration of sucrose. It made the β-FFase an exploitable biocatalyst for the production of glycosides of natural products and prebiotic kestose. PMID:24854707

  12. Cloning, nucleotide sequence and expression of a new L-N-carbamoylase gene from Arthrobacter aurescens DSM 3747 in E. coli.

    Science.gov (United States)

    Wilms, B; Wiese, A; Syldatk, C; Mattes, R; Altenbuchner, J; Pietzsch, M

    1999-02-19

    An L-N-carbamoyl amino acid amidohydrolase (L-N-carbamoylase) from Arthrobacter aurescens DSM 3747 was cloned in E. coli and the nucleotide sequence was determined. After expression of the gene in E. coli the enzyme was purified to homogeneity and characterized. The enzyme was shown to be strictly L-specific and exhibited the highest activity in the hydrolysis of beta-aryl substituted N alpha-carbamoyl-alanines as e.g. N-carbamoyl-tryptophan. Carbamoyl derivatives of beta-alanine and charged aliphatic amino acids were not accepted as substrates. The N-carbamoylase of A. aurescens DSM 3747 differs from all known enzymes with respect to its substrate specificity although amino acid sequence identity scores of 35-38% to other N-carbamoylases have been detected. The enzyme consists of two subunits of 44,000 Da, and has an isoelectric point of 4.3. The optima of temperature and pH were determined to be 50 degrees C and pH 8.5 respectively. At 37 degrees C the enzyme was completely stable for several days. PMID:10194852

  13. AcEST: BP912073 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_G04 498 Adiantum capillus-veneris mRNA. clone: YMU001_000012_G04. BP9120...73 CL1947Contig1 Show BP912073 Clone id YMU001_000012_G04 Library YMU01 Length 498 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_G04. Accession BP912073 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  14. AcEST: BP912049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_D12 483 Adiantum capillus-veneris mRNA. clone: YMU001_000012_D12. BP9120...49 CL4160Contig1 Show BP912049 Clone id YMU001_000012_D12 Library YMU01 Length 483 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_D12. Accession BP912049 Tissue type prothallium Developmental stag... Acids Res. 25:3389-3402. Query= BP912049|Adiantum capillus-veneris mRNA, clone: YMU001_000012_D12. (483 let...ILGGGAG RLYPLTKKRAKPAVPLGAN Sbjct: 61 RRNPIIVSPKAVSDSQNSQTCLDPDASSSVLGIILGGGAGTRLYPLTKKRAKPAVPLGAN 120 Query

  15. AcEST: BP912069 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_F12 581 Adiantum capillus-veneris mRNA. clone: YMU001_000012_F12. BP912069 - Show BP9120...is mRNA. clone: YMU001_000012_F12. Accession BP912069 Tissue type prothallium Developmental stage - Contig I... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912069|Adiantum capillus-veneris mRNA, ...= 25/38 (65%), Positives = 28/38 (73%) Frame = -3 Query: 120 LIHGPPGTGKTVTVVEAILQ...= 50.1 bits (118), Expect = 8e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -3 Query: 120 LI

  16. AcEST: BP912070 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_G01 565 Adiantum capillus-veneris mRNA. clone: YMU001_000012_G01. BP9120...70 CL211Contig1 Show BP912070 Clone id YMU001_000012_G01 Library YMU01 Length 565 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000012_G01. Accession BP912070 Tissue type prothallium Developmental stage...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912070|Adiantum capillus-veneris mRNA...Sbjct: 1060 AISNQLYEEAFAIFKKFDVNTSAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQ 1119 Query: 25 GLVSDAIE 2 GLV +AI+ Sbjct: 1120

  17. AcEST: BP912090 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_A03 514 Adiantum capillus-veneris mRNA. clone: YMU001_000015_A03. BP9120...90 CL2391Contig1 Show BP912090 Clone id YMU001_000015_A03 Library YMU01 Length 514 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_A03. Accession BP912090 Tissue type prothallium Developmental stag...programs, Nucleic Acids Res. 25:3389-3402. Query= BP912090|Adiantum capillus-veneris mRNA, clone: YMU001_000...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  18. AcEST: BP912123 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

  19. AcEST: BP912126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

  20. AcEST: BP912912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

  1. AcEST: BP912712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

  2. AcEST: BP912212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

  3. AcEST: BP912312 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

  4. AcEST: BP912612 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

  5. AcEST: BP912128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

  6. AcEST: BP917417 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_E10 489 Adiantum capillus-veneris mRNA. clone: YMU001_000100_E10. BP917417... CL856Contig1 Show BP917417 Clone id YMU001_000100_E10 Library YMU01 Length 489 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000100_E10. Accession BP917417 Tissue type prothallium Developmental stage...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917417...Positives = 30/52 (57%) Frame = -2 Query: 176 MLDRSKRPKVESKLLQKRPVCKVFLLALEAPVRKAREEYDQIMLAGKAALGE 21 ++DR+

  7. AcEST: BP917517 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_G11 472 Adiantum capillus-veneris mRNA. clone: YMU001_000101_G11. BP917517... CL2571Contig1 Show BP917517 Clone id YMU001_000101_G11 Library YMU01 Length 472 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000101_G11. Accession BP917517 Tissue type prothallium Developmental stag...ams, Nucleic Acids Res. 25:3389-3402. Query= BP917517|Adiantum capillus-veneris m...= +3 Query: 81 CAGCDLWACLCTM*NVLRRRREKLSLRPGNA 173 C GC W + + N+ R+RR+ + LRPG A S

  8. AcEST: BP917172 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_B10 520 Adiantum capillus-veneris mRNA. clone: YMU001_000097_B10. BP917172 - Show BP91717...is mRNA. clone: YMU001_000097_B10. Accession BP917172 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91717...a GN=At2g31440 PE=2 SV=2 Length = 250 Score = 30.8 bits (68), Expect = 4.0 Identities = 17/50 (34%), Positiv...169 G H FFC SL + T +V +VP+FLI ++A+ F+ I + Sbjct: 123 GHGVAHAVFFCLSLLTPAFGPATFYVERCSKVPFFLISAIIALAFVTIHT 172

  9. AcEST: BP917017 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000094_G05 462 Adiantum capillus-veneris mRNA. clone: YMU001_000094_G05. BP917017 - Show BP917017...is mRNA. clone: YMU001_000094_G05. Accession BP917017 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP917017|Adiantum capillus-veneris mRNA, clone: YMU0... Sbjct: 182 SALFGSPVYQNYGTIMAEQKFEPAGFKMSLGLKDTNLALAAAKRVSANLPLAELAKSHFE 241 Query: 226 MMIEKGDVEEDMEELLNC 17...AKGVLRSKVGAGTGVKFTPSLAFVLDKVPDAAREME 110 Query: 187 ELL 179 ELL Sbjct: 111 ELL 11

  10. AcEST: BP921717 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000153_C10 427 Adiantum capillus-veneris mRNA. clone: YMU001_000153_C10. BP921717... CL2111Contig1 Show BP921717 Clone id YMU001_000153_C10 Library YMU01 Length 427 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000153_C10. Accession BP921717 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP921717|Adiantum capillus-veneris mRNA, clone: YMU001_000... Expect = 4.1 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -1 Query: 172 LERRWKILILQHKVNQQTIRGW

  11. AcEST: BP920720 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000140_F08 378 Adiantum capillus-veneris mRNA. clone: YMU001_000140_F08. BP920720... CL2798Contig1 Show BP920720 Clone id YMU001_000140_F08 Library YMU01 Length 378 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000140_F08. Accession BP920720 Tissue type prothallium Developmental stag...ort BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Ji...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920720|Adiantum capillus-

  12. AcEST: BP920620 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000139_D03 185 Adiantum capillus-veneris mRNA. clone: YMU001_000139_D03. BP920620 - Show BP920620...is mRNA. clone: YMU001_000139_D03. Accession BP920620 Tissue type prothallium Developmental stage - Contig I...hit_id - Definition - Align length - Score (bit) - E-value - Report BLASTX 2.2.19 [Nov-02-20...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920620|Adiantum...core (bit) - E-value - Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, St

  13. AcEST: BP920204 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_C07 410 Adiantum capillus-veneris mRNA. clone: YMU001_000134_C07. BP92020...4 CL2814Contig1 Show BP920204 Clone id YMU001_000134_C07 Library YMU01 Length 410 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_C07. Accession BP920204 Tissue type prothallium Developmental stag...port BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, J...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920204|Adiantum capillus

  14. AcEST: BP914149 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_E02 350 Adiantum capillus-veneris mRNA. clone: YMU001_000042_E02. BP914149 - Show BP91414...is mRNA. clone: YMU001_000042_E02. Accession BP914149 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP914149|Adiantum capillus-veneris mRNA, clone: YMU001_000042_E02. (350 letters) Dat...abase: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching...9), Expect = 1.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Que

  15. AcEST: BP914114 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_A08 473 Adiantum capillus-veneris mRNA. clone: YMU001_000042_A08. BP914114... CL737Contig1 Show BP914114 Clone id YMU001_000042_A08 Library YMU01 Length 473 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000042_A08. Accession BP914114 Tissue type prothallium Developmental stage... programs, Nucleic Acids Res. 25:3389-3402. Query= BP914114|Adiantum capillus-ven...eris mRNA, clone: YMU001_000042_A08. (473 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,

  16. AcEST: BP914145 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D08 359 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D08. BP91414...5 CL2779Contig1 Show BP914145 Clone id YMU001_000042_D08 Library YMU01 Length 359 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000042_D08. Accession BP914145 Tissue type prothallium Developmental stag...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914145|Adiantum capillus-veneris mRNA, clone...: YMU001_000042_D08. (359 letters) Database: uniprot_sprot.fasta 412,525 sequences; 14

  17. AcEST: BP914914 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000064_C12 612 Adiantum capillus-veneris mRNA. clone: YMU001_000064_C12. BP914914... CL739Contig1 Show BP914914 Clone id YMU001_000064_C12 Library YMU01 Length 612 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000064_C12. Accession BP914914 Tissue type prothallium Developmental stage... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914914...prot.fasta 412,525 sequences; 148,809,765 total letters Searching................

  18. AcEST: BP921414 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000149_E11 396 Adiantum capillus-veneris mRNA. clone: YMU001_000149_E11. BP921414 - Show BP921414... Clone id YMU001_000149_E11 Library YMU01 Length 396 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000149_E11. Accession BP921414 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921414|Adiantum capillus-ven...eris mRNA, clone: YMU001_000149_E11. (396 letters) Database: uniprot_sprot.fasta 412,525 sequences; 14

  19. AcEST: BP914614 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000061_A04 563 Adiantum capillus-veneris mRNA. clone: YMU001_000061_A04. BP914614 - Show BP914614...is mRNA. clone: YMU001_000061_A04. Accession BP914614 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP914614|Adiantum capillus-veneris mRNA, clone: YMU001_000061_A04. ...(550 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching.............79/185 (42%), Gaps = 27/185 (14%) Frame = -3 Query: 536 SQLRAVVRTLGHQNEECETKL----------KEAFELELRKRTDEAAQKVAT

  20. AcEST: BP914144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D07 330 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D07. BP914144 - Show BP91414...is mRNA. clone: YMU001_000042_D07. Accession BP914144 Tissue type prothallium Developmental stage - Contig I...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91414...rot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching..............KEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPS 149 Query: 240 TGSTSKPGKFLCKLW