WorldWideScience

Sample records for arthrobacter sp bp

  1. Arthrobacter equi sp. nov., isolated from veterinary clinical material.

    Science.gov (United States)

    Yassin, A F; Spröer, C; Siering, C; Hupfer, H; Schumann, P

    2011-09-01

    A Gram-positive-staining, catalase-positive, non-spore-forming, rod-shaped bacterium, strain IMMIB L-1606(T), isolated from genital swabs of a horse, was characterized using a polyphasic approach. Comparative 16S rRNA gene sequence analysis showed that the organism was related to members of the genus Arthrobacter, displaying sequence similarities of 93.5-99.1 % with the type strains of recognized species of the genus. Cell-wall analysis revealed peptidoglycan type A3α L-Lys-L-Ser-L-Thr-L-Ala. DNA-DNA hybridization data and biochemical characterization of strain IMMIB L-1606(T) enabled the isolate to be differentiated genotypically and phenotypically from phylogenetically closely related species of the genus Arthrobacter. Therefore, it is concluded that strain IMMIB L-1606(T) represents a novel species of the genus Arthrobacter, for which the name Arthrobacter equi sp. nov. is proposed. The type strain of Arthrobacter equi sp. nov. is IMMIB L-1606(T) ( = DSM 23395(T) = CCUG 59597(T)).

  2. Complete genome sequence and metabolic potential of the quinaldine-degrading bacterium Arthrobacter sp. Rue61a

    Directory of Open Access Journals (Sweden)

    Niewerth Heiko

    2012-10-01

    Full Text Available Abstract Background Bacteria of the genus Arthrobacter are ubiquitous in soil environments and can be considered as true survivalists. Arthrobacter sp. strain Rue61a is an isolate from sewage sludge able to utilize quinaldine (2-methylquinoline as sole carbon and energy source. The genome provides insight into the molecular basis of the versatility and robustness of this environmental Arthrobacter strain. Results The genome of Arthrobacter sp. Rue61a consists of a single circular chromosome of 4,736,495 bp with an average G + C content of 62.32%, the circular 231,551-bp plasmid pARUE232, and the linear 112,992-bp plasmid pARUE113 that was already published. Plasmid pARUE232 is proposed to contribute to the resistance of Arthrobacter sp. Rue61a to arsenate and Pb2+, whereas the linear plasmid confers the ability to convert quinaldine to anthranilate. Remarkably, degradation of anthranilate exclusively proceeds via a CoA-thioester pathway. Apart from quinaldine utilization, strain Rue61a has a limited set of aromatic degradation pathways, enabling the utilization of 4-hydroxy-substituted aromatic carboxylic acids, which are characteristic products of lignin depolymerization, via ortho cleavage of protocatechuate. However, 4-hydroxyphenylacetate degradation likely proceeds via meta cleavage of homoprotocatechuate. The genome of strain Rue61a contains numerous genes associated with osmoprotection, and a high number of genes coding for transporters. It encodes a broad spectrum of enzymes for the uptake and utilization of various sugars and organic nitrogen compounds. A. aurescens TC-1 is the closest sequenced relative of strain Rue61a. Conclusions The genome of Arthrobacter sp. Rue61a reflects the saprophytic lifestyle and nutritional versatility of the organism and a strong adaptive potential to environmental stress. The circular plasmid pARUE232 and the linear plasmid pARUE113 contribute to heavy metal resistance and to the ability to degrade

  3. Arthrobacter pityocampae sp. nov., isolated from Thaumetopoea pityocampa (Lep., Thaumetopoeidae).

    Science.gov (United States)

    İnce, İkbal Agah; Demirbağ, Zihni; Katı, Hatice

    2014-10-01

    A bacterium (strain Tp2(T)) was isolated from a caterpillar of the pine processionary moth, Thaumetopoea pityocampa (Den. & Schiff.) (Lepidoptera: Thaumetopoeidae), a destructive pine forest pest. The bacterium is a Gram-stain-positive, red-pigmented coccus, oxidase-negative, nitrate-reducing, non-motile and non-spore-forming. Strain Tp2(T) was subjected to a taxonomic study using polyphasic approach that included morphological and biochemical characterizations, 16S rRNA gene sequence analysis, DNA-DNA hybridization, DNA G+C content analysis, comparative fatty acid profiles, and analyses of quinones and polar lipids. The 16S rRNA gene sequence of strain Tp2(T) revealed that Arthrobacter agilis DSM 20550(T) was the closest known strain (98% 16S rRNA gene sequence similarity). DNA-DNA hybridization of A. agilis DSM 20550(T) and strain Tp2(T) resulted in a DNA-DNA relatedness value of 11.9% (20.2% reciprocal). The DNA base composition of strain Tp2(T) was 69.5 mol%, which is consistent with the other recognized members of Actinobacteria that have a high G+C content in their genome. The polar lipid pattern of strain Tp2(T) consisted of diphosphatidylglycerol (major), phosphatidylglycerol and phosphatidylinositol and unknown glycolipids. The cellular fatty acids were anteiso C15:0 and anteiso C17:0 and the major menaquinone was MK-9(II-H2). The peptidoglycan type was A3α with an L-Lys-L-Thr-L-Ala3 interpeptide bridge. The above-mentioned characterization qualifies strain Tp2(T) as genotypically and phenotypically distinct from closely related species of the genus Arthrobacter with validly published names. Strain Tp2(T) is therefore proposed to represent a novel species of the genus Arthrobacter, described as Arthrobacter pityocampae sp. nov. The type strain is Tp2(T) ( = DSM 21719(T) = NCCB 100254(T)).

  4. 2,3-Dihydroxybiphenyl dioxygenase gene was first discovered in Arthrobacter sp. strain P J3

    Institute of Scientific and Technical Information of China (English)

    YANG MeiYing; MA PengDa; LI WenMing; LIU JinYing; LI Liang; ZHU XiaoJuan; WANG XingZhi

    2007-01-01

    Bacterium strain PJ3, isolated from wastewater and identified as Arthrobacter sp. bacterium based on its 16S rDNA gene, could use carbazole as the sole carbon, nitrogen and energy source. The genomic libraryof strain PJ3 was constructed and a positive clone JM109 (pUCW402) was screened out for the expression of dioxygenase by the ability to form yellow ring-fission product. A 2,3-dihydroxybiphenyl dioxygenase (23DHBD) gene of 933 bp was found in the 3360 bp exogenous fragment of pUCW402 by GenSCAN software and BLAST analysis. The phylogenetic analysis showed that 23DHBD from strain PJ3 formed a deep branch separate from a cluster containing most known 23DHBD in GenBank.Southern hybridization confirmed for the first time that the 23DHBD gene was from the genomic DNA of Arthrobacter sp. PJ3. In order to test the gene function, recombinant bacterium BL21 (pETW-8) was constructed to express 23DHBD. The expression level in BL21 (pETW-8) was highest compared with the recombinant bacteria JM109 (pUCW402) and strain PJ3. We observed that 23DHBD was not absolute specific. The enzyme activity was higher with 2,3-dihydroxybiphenyl as a substrate than with catechol.The substrate specificity assay suggested that 23DHBD was essential for cleavage of bi-cyclic aromatic compounds during the course of aromatic compound biodegradation in Arthrobacter sp. strain PJ3.

  5. Adhesion of an Amylolytic Arthrobacter sp. to Starch-Containing Plastic Films

    OpenAIRE

    1990-01-01

    Cells of the amylolytic bacterium KB-1 (thought to be an Arthrobacter sp.) adhered (∼70%) to the surface of plastic films composed of starch-poly (methylacrylate) graft copolymer (starch-PMA), but did not adhere (

  6. Degradation of 4-chlorobenzoic acid by Arthrobacter sp

    Energy Technology Data Exchange (ETDEWEB)

    Marks, T.S.; Smith, A.R.W.; Quirk, A.V.

    1984-11-01

    A mixed population, enriched and established in a defined medium, from a sewage sludge inoculum was capable of complete mineralization of 4-chlorobenzoate. An organism, identified as Arthrobacter sp., was isolated from the consortium and shown to be capable of utilizing 4-chlorobenzoate as the sole carbon and energy source in pure culture. This organism (strain TM-1), dehalogenated 4-chlorobenzoate as the initial step in the degradative pathway. The production, 4-hydroxybenzoate, was further metabolized via protocatechuate. The ability of strain TM-1 to degrade 4-chlorobenzoate in liquid medium at 25/sup 0/C was improved by the use of continuous culture and repeated sequential subculturing. Other chlorinated benzoates and the parent compound benzoate did not support growth of strain TM-1. An active cell extract was prepared and shown to dehalogenate 4-chloro-, 4-fluoro-, and 4-bromobenzoate. Dehalogenase activity had an optimum pH of 6.8 and an optimum temperature of 20/sup 0/C and was inhibited by dissolved oxygen and stimulated by manganese (Mn/sup 2 +/). Strain improvement resulted in an increase in the specific activity of the cell extract from 0.09 to 0.85 nmol of 4-hydroxybenzoate per min per mg of protein and a decrease in the doubling time of the organism from 50 to 1.6 h. 18 references, 3 figures, 2 tables.

  7. Potential Degradation of Swainsonine by Intracellular Enzymes of Arthrobacter sp. HW08

    Directory of Open Access Journals (Sweden)

    Haili Li

    2013-11-01

    Full Text Available Swainsonine (SW is a toxin produced by locoweeds and harmful to the livestock industry. Degrading SW by Arthrobacter sp. HW08 was demonstrated as a promising way to deal with SW poisoning. However, it is unknown which part of the subcellular enzymes in Arthrobacter sp. HW08 is responsible for biodegrading SW and whether the metabolites are atoxic. In this study, intracellular and extracellular enzymes of Arthrobacter sp. HW08 were isolated and their enzyme activity was evaluated. The metabolites were fed to mice, and physiological and histological properties of the treated mice were investigated. The results showed that only intracellular enzyme of Arthrobacter sp. HW08 (IEHW08 could degrade SW efficiently. Compared with mice in SW treatment group, mice in SW + IEHW08 treatment group (1 increased their body weights; (2 showed higher number of platelets and lower number of white blood cells; (3 decreased the levels of creatinine, urea nitrogen, alanine transaminase and aspartate aminotransferase in serum; (4 reduced the number of vacuolated cells in cerebellum, liver and kidney. All these data demonstrate that IEHW08 was potentially safe for mice, while keeping the capacity of degrading SW. This study indicates a possible application of IEHW08 as an additive in the livestock industry to protect animals from SW poisoning.

  8. Isolation and characteristics of Arthrobacter sp. strain CW-1 for biodegradation of PAEs

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Isolation of new bacterial strains and recognition of their metabolic activities are highly desirable for sustainability of natural ecosystems. Biodegradation of dimethyl phthalate (DMP) under anoxic conditions has been shown to occur as a series of sequential steps using strain CW-1 isolated from digested sludge of Sibao Wastewater Treatment Plant in Hangzhou, China. The microbial colony on LB medium was yellowish, 3~5 mm in diameter, convex in the center, and embedded in mucous externally.The individual cells of strain CW-1 are irregular rods, measuring (0.6~0.7)×(0.9~1.0) μm, V-shaped, with clubbed ends, Gram positive and without any filaments. 16S rDNA (1438 bp) sequence analysis showed that the strain was related to Arthrobacter sp.CW-1 and can degrade PAEs utilizing nitrate as electron acceptor, but cannot mineralize DMP completely. The degradation pathway was recommended as: dimethyl phthalate (DMP)→monomethyl phthalate (MMP)→phthalic acid (PA). DMP biodegradation was a first order reaction with degradation rate constant of 0.3033 d-1 and half-life 2.25 d. The DMP conversion to PA by CW-1 could be described by using sequential kinetic model.

  9. Arthrobacter enclensis sp. nov., isolated from sediment sample

    Digital Repository Service at National Institute of Oceanography (India)

    Dastager, S.G.; Qin, L.; Tang, S.K.; Krishnamurthi, S.; Lee, J.C.; Li, W.J.

    , genomic DNA was extracted and purified according to the method of Mar- mur (1961) with additional RNAse treatment. DNA–DNA hybridization was carried out based on principles and equa- tions described by De Ley et al. (1970) under the consid- eration.... Chin J Oceanol Lim- nol 26:166–177 De Ley J, Cattoir H, Reynaerts A (1970) The quantitative measure- ment of DNA hybridization from renaturation rates. Eur J Bio- chem 12:133–142 Ding L, Hirose T, Yokota A (2009) Four novel Arthrobacter spe- cies...

  10. Isolation, purification and characterization of xylanase produced by Arthrobacter sp. MTCC 5214 when grown in solid-state fermentation

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, R.; Bhosle, N.B.

    Thermoalkalophilic Arthrobacter sp. produced extracellular xylanase, when wheat bran, rice husk, rice bran and bagassae were used as carbon source under solid-state fermentation (SSF). The xylanase enzyme was isolated by ammonium sulfate (80...

  11. Improving the Survival of Arthrobacter sp., CW9 during Spray Drying Monitored by Scan Electric Microscope

    Directory of Open Access Journals (Sweden)

    Zhenqiang Xia

    2014-03-01

    Full Text Available The culture of an aquaculture probiotic, i.e., Arthrobacter sp., CW9, was spray dried with different carriers/protectants, in which Scan Electric Microscope (SEM was used to analyze the surface of micro-paticles produced by spray-drying. Matrix of protectants, inlet temperature and feed rate were optimized according to the survival rate after spray drying. Scanning electron micrographs showed that cracks formed on the particle surface were a key factor in enhancing bacteria survival during spray-drying. Span-60 had synergism with Skim Milk Powder (SMP: trehalose (7.5%: 7.5%, w/v in protecting Arthrobacter sp., CW9 bacteria from heat injury, unlike SMP with trehalose. Particle size is an important factor influencing bacteria survival during spray drying and particle size itself was influenced by certain additives.

  12. Improving the Survival of Arthrobacter sp., CW9 during Spray Drying Monitored by Scan Electric Microscope

    OpenAIRE

    Zhenqiang Xia; Ming Zhu; Yanqiu Zhang

    2014-01-01

    The culture of an aquaculture probiotic, i.e., Arthrobacter sp., CW9, was spray dried with different carriers/protectants, in which Scan Electric Microscope (SEM) was used to analyze the surface of micro-paticles produced by spray-drying. Matrix of protectants, inlet temperature and feed rate were optimized according to the survival rate after spray drying. Scanning electron micrographs showed that cracks formed on the particle surface were a key factor in enhancing bacteria survival during s...

  13. Biosorption of Lead(II) by Arthrobacter sp. 25: Process Optimization and Mechanism.

    Science.gov (United States)

    Jin, Yu; Wang, Xin; Zang, Tingting; Hu, Yang; Hu, Xiaojing; Ren, Guangming; Xu, Xiuhong; Qu, Juanjuan

    2016-08-28

    In the present work, Arthrobacter sp. 25, a lead-tolerant bacterium, was assayed to remove lead(II) from aqueous solution. The biosorption process was optimized by response surface methodology (RSM) based on the Box-Behnken design. The relationships between dependent and independent variables were quantitatively determined by second-order polynomial equation and 3D response surface plots. The biosorption mechanism was explored by characterization of the biosorbent before and after biosorption using atomic force microscopy (AFM), scanning electron microscopy, energy dispersive X-ray spectroscopy, X-ray diffraction, and Fourier transform infrared spectroscopy. The results showed that the maximum adsorption capacity of 9.6 mg/g was obtained at the initial lead ion concentration of 108.79 mg/l, pH value of 5.75, and biosorbent dosage of 9.9 g/l (fresh weight), which was close to the theoretically expected value of 9.88 mg/g. Arthrobacter sp. 25 is an ellipsoidalshaped bacterium covered with extracellular polymeric substances. The biosorption mechanism involved physical adsorption and microprecipitation as well as ion exchange, and functional groups such as phosphoryl, hydroxyl, amino, amide, carbonyl, and phosphate groups played vital roles in adsorption. The results indicate that Arthrobacter sp. 25 may be potentially used as a biosorbent for low-concentration lead(II) removal from wastewater.

  14. New metabolic pathway for degradation of 2-nitrobenzoate by Arthrobacter sp. SPG

    Directory of Open Access Journals (Sweden)

    Pankaj Kumar Arora

    2015-06-01

    Full Text Available Arthrobacter sp. SPG utilized 2-nitrobenzoate as its sole source of carbon and energy and degraded it with accumulation of stoichiometric amounts of nitrite ions. Salicylate and catechol were detected as metabolites of the 2-nitrobenzoate degradation using high performance liquid chromatography and gas chromatography-mass spectrometry. Enzyme activities for 2-nitrobenzoate-2-monooxygenase, salicylate hydroxylase, and catechol-1,2-dioxygenase were detected in the crude extracts of the 2-nitrobenzoate-induced cells of strain SPG. The 2-nitrobenzoate-monooxygenase activity resulted in formation of salicylate and nitrite from 2-nitrobenzoate whereas salicylate hydroxylase catalyzed the conversion of salicylate to catechol. The ring-cleaving enzyme, catechol-1,2-dioxygenase cleaved catechol to cis, cis-muconic acid. Cells of strain SPG were able to degrade 2-nitrobenzoate in sterile as well as non-sterile soil microcosms. The results of microcosm studies showed that strain SPG degraded more than 90% of 2-nitrobenzoate within 10-12 days. This study clearly shows that Arthrobacter sp. SPG degraded 2-nitrobenzoate via a new pathway with formation of salicylate and catechol as metabolites. Arthrobacter sp. SPG may be used for bioremediation of 2-nitrobenzoate-contaminated sites due to its ability to degrade 2-nitrobenzoate in soil.

  15. New metabolic pathway for degradation of 2-nitrobenzoate by Arthrobacter sp. SPG

    Science.gov (United States)

    Arora, Pankaj K.; Sharma, Ashutosh

    2015-01-01

    Arthrobacter sp. SPG utilized 2-nitrobenzoate as its sole source of carbon and energy and degraded it with accumulation of stoichiometric amounts of nitrite ions. Salicylate and catechol were detected as metabolites of the 2-nitrobenzoate degradation using high performance liquid chromatography and gas chromatography–mass spectrometry. Enzyme activities for 2-nitrobenzoate-2-monooxygenase, salicylate hydroxylase, and catechol-1,2-dioxygenase were detected in the crude extracts of the 2-nitrobenzoate-induced cells of strain SPG. The 2-nitrobenzoate-monooxygenase activity resulted in formation of salicylate and nitrite from 2-nitrobenzoate, whereas salicylate hydroxylase catalyzed the conversion of salicylate to catechol. The ring-cleaving enzyme, catechol-1,2-dioxygenase cleaved catechol to cis,cis-muconic acid. Cells of strain SPG were able to degrade 2-nitrobenzoate in sterile as well as non-sterile soil microcosms. The results of microcosm studies showed that strain SPG degraded more than 90% of 2-nitrobenzoate within 10–12 days. This study clearly shows that Arthrobacter sp. SPG degraded 2-nitrobenzoate via a new pathway with formation of salicylate and catechol as metabolites. Arthrobacter sp. SPG may be used for bioremediation of 2-nitrobenzoate-contaminated sites due to its ability to degrade 2-nitrobenzoate in soil. PMID:26082768

  16. Characterization of a novel phenol hydroxylase in indoles biotransformation from a strain Arthrobacter sp. W1 [corrected].

    Directory of Open Access Journals (Sweden)

    Yuanyuan Qu

    Full Text Available BACKGROUND: Indigoids, as popular dyes, can be produced by microbial strains or enzymes catalysis. However, the new valuable products with their transformation mechanisms, especially inter-conversion among the intermediates and products have not been clearly identified yet. Therefore, it is necessary to investigate novel microbial catalytic processes for indigoids production systematically. FINDINGS: A phenol hydroxylase gene cluster (4,606 bp from Arthrobacter sp. W1 (PH(w1 was obtained. This cluster contains six components in the order of KLMNOP, which exhibit relatively low sequence identities (37-72% with known genes. It was suggested that indole and all the tested indole derivatives except for 3-methylindole were transformed to various substituted indigoid pigments, and the predominant color products derived from indoles were identified by spectrum analysis. One new purple product from indole, 2-(7-oxo-1H-indol-6(7H-ylidene indolin-3-one, should be proposed as the dimerization of isatin and 7-hydroxylindole at the C-2 and C-6 positions. Tunnel entrance and docking studies were used to predict the important amino acids for indoles biotransformation, which were further proved by site-directed mutagenesis. CONCLUSIONS/SIGNIFICANCE: We showed that the phenol hydroxylase from genus Arthrobacter could transform indoles to indigoids with new chemical compounds being produced. Our work should show high insights into understanding the mechanism of indigoids bio-production.

  17. Biofiltration of trimethylamine, dimethylamine, and methylamine by immobilized Paracoccus sp. CP2 and Arthrobacter sp. CP1.

    Science.gov (United States)

    Ho, Kuo-Ling; Chung, Ying-Chien; Lin, Yueh-Hsien; Tseng, Ching-Ping

    2008-05-01

    A biofilter using granular activated carbon with immobilized Paracoccus sp. CP2 was applied to the elimination of 10-250 ppm of trimethylamine (TMA), dimethylamine (DMA), and methylamine (MA). The results indicated that the system effectively treated MA (>93%), DMA (>90%), and TMA (>85%) under high loading conditions, and the maximum degradation rates were 1.4, 1.2, and 0.9g-Nkg(-1) GAC d(-1). Among the three different amines treated, TMA was the most difficult to degrade and resulted in ammonia accumulation. Further study on TMA removal showed that the optimal pH was near neutral (6.0-8.0). The supply of high glucose (>0.1%) inhibited TMA removal, maybe due to substrate competition. However, complete TMA degradation was achieved under the co-immobilization of Paracoccus sp. CP2 and Arthrobacter sp. CP1 ( approximately 96%). Metabolite analysis results demonstrated that the metabolite NH(4)(+) concentrations decreased by a relatively small 27% while the metabolite NO(2)(-) apparently increased by heterotrophic nitrification of Arthrobacter sp. CP1 in the co-immobilization biofilter.

  18. Growth of Arthrobacter sp. strain JBH1 on nitroglycerin as the sole source of carbon and nitrogen.

    Science.gov (United States)

    Husserl, Johana; Spain, Jim C; Hughes, Joseph B

    2010-03-01

    Arthrobacter sp. strain JBH1 was isolated from nitroglycerin-contaminated soil by selective enrichment. Detection of transient intermediates and simultaneous adaptation studies with potential intermediates indicated that the degradation pathway involves the conversion of nitroglycerin to glycerol via 1,2-dinitroglycerin and 1-mononitroglycerin, with concomitant release of nitrite. Glycerol then serves as the source of carbon and energy.

  19. Analysis of Two Gene Clusters Involved in the Degradation of 4-Fluorophenol by Arthrobacter sp Strain IF1

    NARCIS (Netherlands)

    Ferreira, Maria Isabel M.; Iida, Toshiya; Hasan, Syed A.; Nakamura, Kaoru; Fraaije, Marco W.; Janssen, Dick B.; Kudo, Toshiaki

    2009-01-01

    Arthrobacter sp. strain IF1 is able to grow on 4-fluorophenol (4-FP) as a sole source of carbon and energy. To clone the 4-FP degradation genes, DNA libraries were constructed and screened with a probe obtained by PCR using primers designed on the basis of conserved regions of aromatic two-component

  20. Arthrobacter cupressi sp. nov., an actinomycete isolated from the rhizosphere soil of Cupressus sempervirens.

    Science.gov (United States)

    Zhang, Jian; Ma, Yuchao; Yu, Huimin

    2012-11-01

    An actinobacterial strain, designated D48(T), was isolated from the rhizosphere soil of a cypress tree collected from Mianyang in Sichuan province, China. The strain was Gram-stain-positive, catalase-positive, oxidase-negative and non-motile, with lysine as the peptidoglycan diagnostic diamino acid and acetyl as the peptidoglycan acyl type. The predominant menaquinone was MK-9(H(2)); small amounts of MK-7(H(2)), MK-10(H(2)) and MK-6 were also present. The major fatty acids were anteiso-C(15:0), anteiso-C(17:0) and iso-C(16:0). The isolate underwent a rod-coccus morphological cycle, had a high DNA G+C content, was aerobic and grew between 12 and 37 °C (optimum, 28 °C). On the basis of the phenotypic and chemotaxonomic analyses, 16S rRNA gene sequence comparisons and DNA-DNA hybridization data, the isolate represents a novel species of the genus Arthrobacter, for which the name Arthrobacter cupressi sp. nov. is proposed. The type strain is D48(T) (=DSM 24664(T)=CGMCC 1.10783(T)).

  1. Biodegradation of p-nitrophenol via 1,2,4-benzenetriol by an Arthrobacter sp.

    Energy Technology Data Exchange (ETDEWEB)

    Jain, R.K.; Spain, J.C. [Armstrong Lab., Tyndall Air Force Base, FL (United States); Dreisbach, J.H. [Univ. of Scranton, PA (United States)

    1994-08-01

    The degradation of p-nitrophenol (PNP) by Moraxella and Pseudomonas spp. involves an initial monooxygenase-catalyzed removal of the nitro group. The resultant hydroquinone is subject to ring fission catalyzed by a dioxygenase enzyme. A strain of an Arthrobacter sp. JS443, capable of degrading PNP with stoichiometric release of nitrite has been isolated. During induction of the enzymes required for growth on PNP, 1,2,4-benzenetriol was identified as an intermediate by gas chromatography-mass spectroscopy and radiotracer studies. 1,2,4-Benzenetriol was converted to maleylacetic acid, which was further degraded by the beta-ketoadipate pathway. Conversion of PNP to 1,2,4-benzenetriol is catalyzed by a monooxygenase system in strain JS443 through the formation of 4-nitrocatechol, 4-nitroresorcinol, or both. Results clearly indicate the existence of an alternative pathway for the biodegradation of PNP. 15 refs, 2 figs., 2 tabs.

  2. Combined bioremediation of atrazine-contaminated soil by Pennisetum and Arthrobacter sp. strain DNS10.

    Science.gov (United States)

    Zhang, Ying; Ge, Shijie; Jiang, Mingyue; Jiang, Zhao; Wang, Zhigang; Ma, Bingbing

    2014-05-01

    Strain DNS10 was isolated from the black soil collected from the northeast of China which had been cultivated with atrazine as the sole nitrogen source. Pennisetum is a common plant in Heilongjiang Province of China. The main objective of this paper was to evaluate the efficiency of plant-microbe joint interactions (Arthrobacter sp. DNS10 + Pennisetum) in atrazine degradation compared with single-strain and single-plant effects. Plant-microbe joint interactions degraded 98.10 % of the atrazine, while single strain and single plant only degraded 87.38 and 66.71 % after a 30-day experimental period, respectively. The results indicated that plant-microbe joint interactions had a better degradation effect. Meanwhile, we found that plant-microbe joint interactions showed a higher microbial diversity. The results of microbial diversity illustrated that the positive effects of cropping could improve soil microbial growth and activity. In addition, we planted atrazine-sensitive plants (soybean) in the soil after repair. The results showed that soybean growth in soil previously treated with the plant-microbe joint interactions treatment was better compared with other treatments after 20 days of growth. This was further proved that the soil is more conducive for crop cultivation. Hence, plant-microbe joint interactions are considered to be a potential tool in the remediation of atrazine-contaminated soil.

  3. Characterization and flocculation mechanism of an alkali-activated polysaccharide flocculant from Arthrobacter sp. B4.

    Science.gov (United States)

    Li, Yumei; Li, Qiang; Hao, Dakui; Hu, Zhiheng; Song, Dongxue; Yang, Min

    2014-10-01

    The characterization and flocculation mechanism of a bioflocculant produced by Arthrobacter sp. B4 were investigated. The bioflocculant's active ingredient was a polysaccharide (B4-PS) that consisted of three main fractions corresponding to the molecular weights of approximately 3.97×10(4)Da, 6.84×10(3)Da and 5.9×10(6)Da, respectively. These fractions were composed of galactose, glucose, mannose and glucuronic acid. Flocculation experiments showed that B4-PS could spontaneously flocculate in the presence of Ca(2+) ions at a high pH (>12.0), followed by the pH reduction to ∼6.0. The self-flocculation of B4-PS may be mediated by ionization and charge neutralization mechanism. Furthermore, B4-PS exhibited excellent capabilities for pollutant removal and pH reduction in alkaline wastewater. These data suggest B4-PS may be a promising tool for use in industrial alkaline wastewater pretreatment.

  4. Biodegradation of nitroglycerin in porous media and potential for bioaugmentation with Arthrobacter sp. strain JBH1.

    Science.gov (United States)

    Husserl, Johana; Hughes, Joseph B

    2013-07-01

    Nitroglycerin (NG) is a toxic explosive found as a contaminant of soil and groundwater. Several microbial strains are capable of partially reducing the NG molecule to dinitro or mononitroesters. Recently, a strain capable of growing on NG as the sole source of carbon and nitrogen (Arthrobacter sp. strain JBH1) was isolated from contaminated soil. Despite the widespread presence of microbial strains capable of transforming NG in contaminated soils and sediments, the extent of NG biodegradation at contaminated sites is still unknown. In this study column experiments were conducted to investigate the extent of microbial degradation of NG in saturated porous media, specifically after bioaugmentation with JBH1. Initial experiments using sterile, low sorptivity sand, showed mineralization of NG after bioaugmentation with JBH1 in the absence of sources of carbon and nitrogen other than NG. Results could be modeled using a first order degradation rate of 0.14d(-1). Further experiments conducted using contaminated soil with high organic carbon content (highly sorptive) resulted in column effluents that did not contain NG although high dinitroester concentrations were observed. Bioaugmentation with JBH1 in sediments containing strains capable of partial transformation of NG resulted in complete mineralization of NG and faster degradation rates.

  5. Crystal structure of a lactosucrose-producing enzyme, Arthrobacter sp. K-1 β-fructofuranosidase.

    Science.gov (United States)

    Tonozuka, Takashi; Tamaki, Akiko; Yokoi, Gaku; Miyazaki, Takatsugu; Ichikawa, Megumi; Nishikawa, Atsushi; Ohta, Yukari; Hidaka, Yuko; Katayama, Kinya; Hatada, Yuji; Ito, Tetsuya; Fujita, Koki

    2012-12-10

    Arthrobacter sp. K-1 β-fructofuranosidase (ArFFase), a glycoside hydrolase family 68 enzyme, catalyzes the hydrolysis and transfructosylation of sucrose. ArFFase is useful for producing a sweetener, lactosucrose (4(G)-β-D-galactosylsucrose). The primary structure of ArFFase is homologous to those of levansucrases, although ArFFase catalyzes mostly hydrolysis when incubated with sucrose alone, even at high concentration. Here, we determined the crystal structure of ArFFase in unliganded form and complexed with fructose. ArFFase consisted of a five-bladed β-propeller fold as observed in levansucrases. The structure of ArFFase was most similar to that of Gluconacetobacter diazotrophicus levansucrase (GdLev). The structure of the catalytic cleft of ArFFase was also highly homologous to that of GdLev. However, two amino acid residues, Tyr232 and Pro442 in ArFFase, were not conserved between them. A tunnel observed at the bottom of the catalytic cleft of ArFFase may serve as a water drain or its reservoir.

  6. s-triazine degrading bacterial isolate Arthrobacter sp. AK-YN10, a candidate for bioaugmentation of atrazine contaminated soil.

    Science.gov (United States)

    Sagarkar, Sneha; Bhardwaj, Pooja; Storck, Veronika; Devers-Lamrani, Marion; Martin-Laurent, Fabrice; Kapley, Atya

    2016-01-01

    The Arthrobacter sp. strain AK-YN10 is an s-triazine pesticide degrading bacterium isolated from a sugarcane field in Central India with history of repeated atrazine use. AK-YN10 was shown to degrade 99 % of atrazine in 30 h from media supplemented with 1000 mg L(-1) of the herbicide. Draft genome sequencing revealed similarity to pAO1, TC1, and TC2 catabolic plasmids of the Arthrobacter taxon. Plasmid profiling analyses revealed the presence of four catabolic plasmids. The trzN, atzB, and atzC atrazine-degrading genes were located on a plasmid of approximately 113 kb.The flagellar operon found in the AK-YN10 draft genome suggests motility, an interesting trait for a bioremediation agent, and was homologous to that of Arthrobacter chlorophenolicus. The multiple s-triazines degradation property of this isolate makes it a good candidate for bioremediation of soils contaminated by s-triazine pesticides.

  7. Optimization of Endoglucanase Production from a Novel Bacterial Isolate, Arthrobacter sp. HPG166 and Characterization of Its Properties

    Directory of Open Access Journals (Sweden)

    Shengwei Huang

    2015-10-01

    Full Text Available ABSTRACTIn this study, a potential novel cellulolytic bacteriumArthrobacter sp. HPG166 was isolated from the hindgut of root-feeding larvaeHolotrichia parallela. Optimization of fermentation factors for endoglucanase production byArthrobacter sp. HPG166 was carried out via response surface methodology. Sodium carboxymethylcellulose 1.19% (w/v and beef extract 0.35% (w/v were the ideal combination of carbon and nitrogen sources for enzyme production; the optimum temperature and pH for cellulase production were 34°C and pH 8.0 respectively. Under the optimized fermentation conditions, the maximum endoglucanase activity of 1.411 U mL-1 was obtained. The crude endoglucanase was thermotolerant as it retained 50.31% of its activity after incubation at 70°C for an hour. Metal profile of the enzyme indicated that Mg2+ and Na+ were strong stimulators while Mn2+ and Co+ drastically inhibited its activity. Due to its particular characteristics, this enzyme could have potential for industrial applications.

  8. Biodegradation of 2-methyl, 2-ethyl, and 2-hydroxypyridine by an Arthrobacter sp. isolated from subsurface sediment.

    Science.gov (United States)

    O'Loughlin, E J; Sims, G K; Traina, S J

    1999-04-01

    A bacterium capable of degrading 2-methylpyridine was isolated by enrichment techniques from subsurface sediments collected from an aquifer located at an industrial site that had been contaminated with pyridine and pyridine derivatives. The isolate, identified as an Arthrobacter sp., was capable of utilizing 2-methylpyridine, 2-ethylpyridine, and 2-hydroxypyridine as primary C, N, and energy sources. The isolate was also able to utilize 2-, 3-, and 4-hydroxybenzoate, gentisic acid, protocatechuic acid and catechol, suggesting that it possesses a number of enzymatic pathways for the degradation of aromatic compounds. Degradation of 2-methylpyridine, 2-ethylpyridine, and 2-hydroxypyridine was accompanied by growth of the isolate and release of ammonium into the medium. Degradation of 2-methylpyridine was accompanied by overproduction of riboflavin. A soluble blue pigment was produced by the isolate during the degradation of 2-hydroxypyridine, and may be related to the diazadiphenoquinones reportedly produced by other Arthrobacter spp. when grown on 2-hydroxypyridine. When provided with 2-methylpyridine, 2-ethylpyridine, and 2-hydroxypyridine simultaneously, 2-hydroxypyridine was rapidly and preferentially degraded; however there was no apparent biodegradation of either 2-methylpyridine or 2-ethylpyridine until after a seven day lag. The data suggest that there are differences between the pathway for 2-hydroxypyridine degradation and the pathways(s) for 2-methylpyridine and 2-ethylpyridine.

  9. A method for the production of D-tagatose using a recombinant Pichia pastoris strain secreting β-D-galactosidase from Arthrobacter chlorophenolicus and a recombinant L-arabinose isomerase from Arthrobacter sp. 22c

    Directory of Open Access Journals (Sweden)

    Wanarska Marta

    2012-08-01

    Full Text Available Abstract Background D-Tagatose is a natural monosaccharide which can be used as a low-calorie sugar substitute in food, beverages and pharmaceutical products. It is also currently being tested as an anti-diabetic and obesity control drug. D-Tagatose is a rare sugar, but it can be manufactured by the chemical or enzymatic isomerization of D-galactose obtained by a β-D-galactosidase-catalyzed hydrolysis of milk sugar lactose and the separation of D-glucose and D-galactose. L-Arabinose isomerases catalyze in vitro the conversion of D-galactose to D-tagatose and are the most promising enzymes for the large-scale production of D-tagatose. Results In this study, the araA gene from psychrotolerant Antarctic bacterium Arthrobacter sp. 22c was isolated, cloned and expressed in Escherichia coli. The active form of recombinant Arthrobacter sp. 22c L-arabinose isomerase consists of six subunits with a combined molecular weight of approximately 335 kDa. The maximum activity of this enzyme towards D-galactose was determined as occurring at 52°C; however, it exhibited over 60% of maximum activity at 30°C. The recombinant Arthrobacter sp. 22c L-arabinose isomerase was optimally active at a broad pH range of 5 to 9. This enzyme is not dependent on divalent metal ions, since it was only marginally activated by Mg2+, Mn2+ or Ca2+ and slightly inhibited by Co2+ or Ni2+. The bioconversion yield of D-galactose to D-tagatose by the purified L-arabinose isomerase reached 30% after 36 h at 50°C. In this study, a recombinant Pichia pastoris yeast strain secreting β-D-galactosidase Arthrobacter chlorophenolicus was also constructed. During cultivation of this strain in a whey permeate, lactose was hydrolyzed and D-glucose was metabolized, whereas D-galactose was accumulated in the medium. Moreover, cultivation of the P. pastoris strain secreting β-D-galactosidase in a whey permeate supplemented with Arthrobacter sp. 22c L-arabinose isomerase resulted in a 90% yield

  10. Taxonomic identification, phenanthrene uptake activity, and membrane lipid alterations of the PAH degrading Arthrobacter sp. strain Sphe3

    Energy Technology Data Exchange (ETDEWEB)

    Kallimanis, A.; Drainas, C.; Koukkou, A.I. [Ioannina Univ. (Greece). Sector of Organic Chemistry and Biochemistry; Frillingos, S. [Ioannina Univ. (Greece). Lab. of Biological Chemistry

    2007-09-15

    This report describes phenanthrene uptake as well as the effect of phenanthrene on the membrane phospholipid and fatty acid composition in a newly isolated bacterial strain, Sphe3, that we taxonomically identified as Arthrobacter sp. Strain Sphe3 is able to utilize phenanthrene as a carbon source at high rates and appears to internalize phenanthrene with two mechanisms: a passive diffusion when cells are grown on glucose, and an inducible active transport system when cells are grown on phenanthrene as a sole carbon source. Active transport followed Michaelis-Menten kinetics, and it was amenable to inhibition by 2,4-dinitrophenol and sodium azide. Evidence provided here indicates that apart from inducing an active PAH uptake, the presence of phenanthrene elicits significant changes in membrane fluidity.

  11. Complete genome sequence of Arthrobacter sp. ERGS1:01, a putative novel bacterium with prospective cold active industrial enzymes, isolated from East Rathong glacier in India.

    Science.gov (United States)

    Kumar, Rakshak; Singh, Dharam; Swarnkar, Mohit Kumar; Singh, Anil Kumar; Kumar, Sanjay

    2015-11-20

    We report the complete genome sequence of Arthrobacter sp. ERGS1:01, a novel bacterium which produces industrial enzymes at low temperature. East Rathong glacier in Sikkim Himalayas is untouched and unexplored for microbial diversity though it has a rich source of glaciers, alpine and meadows. Genome sequence has provided the basis for understanding its adaptation under harsh condition of Himalayan glacier, its ability to produce cold active industrial enzymes and has unlocked opportunities for microbial bioprospection from East Rathong glacier.

  12. Degradation of Swainsonine by the NADP-Dependent Alcohol Dehydrogenase A1R6C3 in Arthrobacter sp. HW08

    Directory of Open Access Journals (Sweden)

    Yan Wang

    2016-05-01

    Full Text Available Swainsonine is an indolizidine alkaloid that has been found in locoweeds and some fungi. Our previous study demonstrated that Arthrobacter sp. HW08 or its crude enzyme extract could degrade swainsonie efficiently. However, the mechanism of swainsonine degradation in bacteria remains unclear. In this study, we used label-free quantitative proteomics method based on liquid chromatography-electrospray ionization-tandem mass spectrometry to dissect the mechanism of swainsonine biodegradation by Arthrobacter sp. HW08. The results showed that 129 differentially expressed proteins were relevant to swainsonine degradation. These differentially expressed proteins were mostly related to the biological process of metabolism and the molecular function of catalytic activity. Among the 129 differentially expressed proteins, putative sugar phosphate isomerase/epimerase A1R5X7, Acetyl-CoA acetyltransferase A0JZ95, and nicotinamide adenine dinucleotide phosphate (NADP-dependent alcohol dehydrogenase A1R6C3 were found to contribute to the swainsonine degradation. Notably, NADP-dependent alcohol dehyrodgenase A1R6C3 appeared to play a major role in degrading swainsonine, but not as much as Arthrobacter sp. HW08 did. Collectively, our findings here provide insights to understand the mechanism of swainsonine degradation in bacteria.

  13. Production of Xylanase from Arthrobacter sp. MTCC 6915 Using Saw Dust As Substrate under Solid State Fermentation

    Directory of Open Access Journals (Sweden)

    Sevanan Murugan

    2011-01-01

    Full Text Available Saw dust was used as substrate for xylanase production from Arthrobacter sp. MTCC 6915. The study of period of incubation, temperature, pH, carbon, and nitrogen sources for xylanase production was optimized. Xylanase production was found to be optimum at an incubation period of 96 hrs (117.0 U/mL, temperature 30°C (105.0 U/mL, and pH 9.0 (102.9 U/mL. The results showed that the xylanase production was found to be higher in the presence of carboxymethylcellulose (176.4 U/mL and dextrose (126.0 U/mL. It was also observed that peptone (170.1 U/mL and beef extract (161.7 U/mL supported maximum xylanase production.The enzyme was characterized and found to be fairly active at pH 9 (764.4 U/mL and temperature 60°C (819 U/mL. Even in the present study, a major difference in the production temperature (30°C and optimal temperature (60°C of the enzyme activity was observed. However, the pH of the production media and the enzyme activity were found to be the same (pH 9.

  14. Isolation and characterization of atrazine-degrading Arthrobacter sp. AD26 and use of this strain in bioremediation of contaminated soil

    Institute of Scientific and Technical Information of China (English)

    LI Qingyan; LI Ying; ZHU Xikun; CAI Baoli

    2008-01-01

    A bacterial strain (AD26) capable of utilizing atrazine as a sole nitrogen source for growth was isolated from an industrial wastewatersample by enrichment culture. The 16S rRNA gene sequencing identified AD26 as anArthrobacter sp. PCR assays indicated that AD26contained atrazine-degrading genes trzN and atzBC. The trzN gene of AD26 only differs from the trzN ofArthrobacter aurescens TC1by one base (A→T at 907) and one amino acid (Met→Leu at 303). The specific activity of trzN of AD26 in crude cell extract was0.28 U/mg, which was 1.2 times that of TC 1. This strain has shown faster growth and atrazine-degradation rates in atrazine-containingminimal media than two well characterized atrazine-degrading bacteria, Pseudomonas sp. ADP and Arthrobacter aurescens TC 1. Afterincubating for 48 h at 30℃, the OD600 of AD26 reached 2.6 compared with 1.33 of ADP. AD26 was capable of degrading 500 mg/Lof atrazine in minimal medium at 95% in 72 h, while the degradative rates by TC1 and ADP were only 90% and 86%, respectively. Abioremediation trial of contaminated soil has indicated that AD26 can degrade as high as 98% of atrazine contained in soil (300 mg/kg)after incubating for 20 d at 26℃, nominating this strain as a good candidate for use in bioremediation programs.

  15. Identification of a recombinant inulin fructotransferase (difructose dianhydride III forming) from Arthrobacter sp. 161MFSha2.1 with high specific activity and remarkable thermostability.

    Science.gov (United States)

    Wang, Xiao; Yu, Shuhuai; Zhang, Tao; Jiang, Bo; Mu, Wanmeng

    2015-04-08

    Difructose dianhydride III (DFA III) is a functional carbohydrate produced from inulin by inulin fructotransferase (IFTase, EC 4.2.2.18). In this work, an IFTase gene from Arthrobacter sp. 161MFSha2.1 was cloned and expressed in Escherachia coli. The recombinant enzyme was purified by metal affinity chromatography. It showed significant inulin hydrolysis activity, and the produced main product from inulin was determined as DFA III by nuclear magnetic resonance analysis. The molecular mass of the purified protein was calculated to be 43 and 125 kDa by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and gel filtration, respectively, suggesting the native enzyme might be a homotrimer. The recombinant enzyme showed maximal activity as 2391 units/mg at pH 6.5 and 55 °C. It displayed the highest thermostability among previously reported IFTases (DFA III forming) and was stable up to 80 °C for 4 h of incubation. The smallest substrate was determined as nystose. The conversion ratio of inulin to DFA III reached 81% when 100 g/L inulin was catalyzed by 80 nM recombinant enzyme for 20 min at pH 6.5 and 55 °C. All of these data indicated that the IFTase (DFA III forming) from Arthrobacter sp. 161MFSha2.1 had great potential for industrial DFA III production.

  16. A new cold-adapted β-D-galactosidase from the Antarctic Arthrobacter sp. 32c – gene cloning, overexpression, purification and properties

    Directory of Open Access Journals (Sweden)

    Kur Józef

    2009-07-01

    Full Text Available Abstract Background The development of a new cold-active β-D-galactosidases and microorganisms that efficiently ferment lactose is of high biotechnological interest, particularly for lactose removal in milk and dairy products at low temperatures and for cheese whey bioremediation processes with simultaneous bio-ethanol production. Results In this article, we present a new β-D-galactosidase as a candidate to be applied in the above mentioned biotechnological processes. The gene encoding this β-D-galactosidase has been isolated from the genomic DNA library of Antarctic bacterium Arthrobacter sp. 32c, sequenced, cloned, expressed in Escherichia coli and Pichia pastoris, purified and characterized. 27 mg of β-D-galactosidase was purified from 1 L of culture with the use of an intracellular E. coli expression system. The protein was also produced extracellularly by P. pastoris in high amounts giving approximately 137 mg and 97 mg of purified enzyme from 1 L of P. pastoris culture for the AOX1 and a constitutive system, respectively. The enzyme was purified to electrophoretic homogeneity by using either one step- or a fast two step- procedure including protein precipitation and affinity chromatography. The enzyme was found to be active as a homotrimeric protein consisting of 695 amino acid residues in each monomer. Although, the maximum activity of the enzyme was determined at pH 6.5 and 50°C, 60% of the maximum activity of the enzyme was determined at 25°C and 15% of the maximum activity was detected at 0°C. Conclusion The properties of Arthrobacter sp. 32cβ-D-galactosidase suggest that this enzyme could be useful for low-cost, industrial conversion of lactose into galactose and glucose in milk products and could be an interesting alternative for the production of ethanol from lactose-based feedstock.

  17. Crystallization and X-ray diffraction analysis of nylon hydrolase (NylC) from Arthrobacter sp. KI72.

    Science.gov (United States)

    Nagai, Keisuke; Yasuhira, Kengo; Tanaka, Yusuke; Kato, Dai-ichiro; Takeo, Masahiro; Higuchi, Yoshiki; Negoro, Seiji; Shibata, Naoki

    2013-10-01

    Nylon hydrolase (NylC) encoded by Arthrobacter plasmid pOAD2 (NylCp2) was expressed in Escherichia coli JM109 and purified by ammonium sulfate fractionation, anion-exchange column chromatography and gel-filtration chromatography. NylCp2 was crystallized by the sitting-drop vapour-diffusion method with ammonium sulfate as a precipitant in 0.1 M HEPES buffer pH 7.5 containing 0.2 M NaCl and 25% glycerol. Diffraction data were collected from the native crystal to a resolution of 1.60 Å. The obtained crystal was spindle shaped and belonged to the C-centred orthorhombic space group C2221, with unit-cell parameters a=70.84, b=144.90, c=129.05 Å. A rotation and translation search gave one clear solution containing two molecules per asymmetric unit.

  18. Enhanced U(VI) release from autunite mineral by aerobic Arthrobacter sp. in the presence of aqueous bicarbonate

    Energy Technology Data Exchange (ETDEWEB)

    Katsenovich, Yelena; Carvajal, Denny A.; Wellman, Dawn M.; Lagos, Leonel

    2012-04-20

    The bacterial effect on U(VI) leaching from the autunite mineral (Ca[(UO{sub 2})(PO{sub 4})]{sub 2} {center_dot} 3H{sub 2}O) was investigated to provide a more comprehensive understanding into important microbiological processes affecting autunite stability within subsurface bicarbonate-bearing environments. Experiments were performed in a culture of G975 Arthrobacter oxydans strain, herein referred to as G975, a soil bacterium previously isolated from Hanford Site soil. 91 mg of autunite powder and 50 mL of phosphorus-limiting sterile media were amended with bicarbonate ranging between 1-10 mM in glass reactor bottles and inoculated with G975 strain after the dissolution of autunite was at steady state. SEM observations indicated G975 formed a biofilm on the autunite surface and penetrated the mineral cleavages. The mineral surface colonization by bacteria tended to increase concomitantly with bicarbonate concentrations. Additionally, a sterile cultureware with inserts was used in non-contact bioleaching experiments where autunite and bacteria cells were kept separately. The data suggest the G975 bacteria is able to enhance U(VI) leaching from autunite without the direct contact with the mineral. In the presence of bicarbonate, the damage to bacterial cells caused by U(VI) toxicity was reduced, yielding similar values for total organic carbon (TOC) degradation and cell density compared to U(VI)-free controls. The presence of active bacterial cells greatly enhanced the U(VI) bioleaching from autunite in bicarbonate-amended media.

  19. Enhanced U(VI) release from autunite mineral by aerobic Arthrobacter sp. in the presence of aqueous bicarbonate

    Energy Technology Data Exchange (ETDEWEB)

    Katsenovich, Yelena P.; Carvajal, Denny A.; Wellman, Dawn M.; Lagos, Leonel E.

    2012-05-01

    The bacterial effect on U(VI) release from the autunite mineral (Ca[(UO2)(PO4)]2•3H2O) was investigated to provide a more comprehensive understanding of the important microbiological processes affecting autunite stability within subsurface bicarbonate-bearing environments. Experiments were performed in a culture of the Arthrobacter oxydans G975 strain, herein referred to as G975, a soil bacterium previously isolated from Hanford Site soil. 91 mg of autunite powder and 50 mL of phosphorous-limiting sterile media were amended with bicarbonate (ranging between 1 and 10 mM) in glass reactor bottles and inoculated with the G975 strain after the dissolution of autunite was at steady state. SEM observations indicated that G975 formed a biofilm on the autunite surface and penetrated the mineral cleavages. The mineral surface colonization by bacteria tended to increase concomitantly with bicarbonate concentrations. Additionally, a sterile culture-ware with inserts was used in non-contact dissolution experiments where autunite and bacteria cells were kept separately. The data suggest that G975 bacteria is able to enhance the release of U(VI) from autunite without direct contact with the mineral. In the presence of bicarbonate, the damage to bacterial cells caused by U(VI) toxicity was reduced, yielding similar values for total organic carbon (TOC) degradation and cell density compared to U(VI)-free controls. The presence of active bacterial cells greatly enhanced the release of U(VI) from autunite in bicarbonate-amended media.

  20. Probing the Role of Two Critical Residues in Inulin Fructotransferase (DFA III-Producing) Thermostability from Arthrobacter sp. 161MFSha2.1.

    Science.gov (United States)

    Yu, Shuhuai; Wang, Xiao; Zhang, Tao; Jiang, Bo; Mu, Wanmeng

    2016-08-10

    Inulin fructotransferase (IFTase) is an important enzyme that produces di-d-fructofuranose 1,2':2,3' dianhydride (DAF III), which is beneficial for human health. Present investigations mainly focus on screening and characterizing IFTase, including catalytic efficiency and thermostability, which are two important factors for enzymatic industrial applications. However, few reports aimed to improve these two characteristics based on the structure of IFTase. In this work, a structural model of IFTase (DFA III-producing) from Arthrobacter sp. 161MFSha2.1 was constructed through homology modeling. Analysis of this model reveals that two residues, Ser-309 and Ser-333, may play key roles in the structural stability. Therefore, the functions of the two residues were probed by site-directed mutagenesis combined with the Nano-DSC method and assays for residual activity. In contrast to other mutations, single mutation of serine 309 (or serine 333) to threonine did not decrease the enzymatic stability, whereas double mutation (serine 309 and serine 333 to threonine) can enhance thermostability (by approximately 5 °C). The probable mechanisms for this enhancement were investigated.

  1. The arthrobacter arilaitensis Re117 genome sequence reveals its genetic adaptation to the surface of cheese.

    Directory of Open Access Journals (Sweden)

    Christophe Monnet

    Full Text Available Arthrobacter arilaitensis is one of the major bacterial species found at the surface of cheeses, especially in smear-ripened cheeses, where it contributes to the typical colour, flavour and texture properties of the final product. The A. arilaitensis Re117 genome is composed of a 3,859,257 bp chromosome and two plasmids of 50,407 and 8,528 bp. The chromosome shares large regions of synteny with the chromosomes of three environmental Arthrobacter strains for which genome sequences are available: A. aurescens TC1, A. chlorophenolicus A6 and Arthrobacter sp. FB24. In contrast however, 4.92% of the A. arilaitensis chromosome is composed of ISs elements, a portion that is at least 15 fold higher than for the other Arthrobacter strains. Comparative genomic analyses reveal an extensive loss of genes associated with catabolic activities, presumably as a result of adaptation to the properties of the cheese surface habitat. Like the environmental Arthrobacter strains, A. arilaitensis Re117 is well-equipped with enzymes required for the catabolism of major carbon substrates present at cheese surfaces such as fatty acids, amino acids and lactic acid. However, A. arilaitensis has several specificities which seem to be linked to its adaptation to its particular niche. These include the ability to catabolize D-galactonate, a high number of glycine betaine and related osmolyte transporters, two siderophore biosynthesis gene clusters and a high number of Fe(3+/siderophore transport systems. In model cheese experiments, addition of small amounts of iron strongly stimulated the growth of A. arilaitensis, indicating that cheese is a highly iron-restricted medium. We suggest that there is a strong selective pressure at the surface of cheese for strains with efficient iron acquisition and salt-tolerance systems together with abilities to catabolize substrates such as lactic acid, lipids and amino acids.

  2. In Silico Approach to Support that p-Nitrophenol Monooxygenase from Arthrobacter sp. Strain JS443 Catalyzes the Initial Two Sequential Monooxygenations.

    Science.gov (United States)

    Kallubai, Monika; Amineni, Umamaheswari; Mallavarapu, Megharaj; Kadiyala, Venkateswarlu

    2015-06-01

    p-Nitrophenol (PNP), used primarily for manufacturing pesticides and dyes, has been recognized as a priority environmental pollutant. It is therefore important to reduce the input of this toxicant into the environment and to establish approaches for its removal from the contaminated sites. PNP monooxygenase, a novel enzyme from Gram-positive bacteria like Arthrobacter sp. and Bacillus sp., that comprises two components, a flavoprotein reductase and an oxygenase, catalyzes the initial two sequential monooxygenations to convert PNP to trihydroxybenzene. Accurate and reliable prediction of this enzyme-substrate interactions and binding affinity are of vital importance in understanding these catalytic mechanisms of the two sequential reactions. As crystal structure of the enzyme has not yet been published, we built a homology model for PNP monooxygenase using crystallized chlorophenol 4-monooxygenase from Burkholderia cepacia AC1100 (3HWC) as the template. The model was assessed for its reliability using PROCHECK, ERRAT and ProSA. Molecular docking of the physiological substrates, PNP and 4-nitrocatechol (4-NC), was carried out using Glide v5.7 implemented in Maestro v9.2, and the binding energies were calculated to substantiate the prediction. Docking complexes formed by molecular level interactions of PNP monooxygenase-PNP/4-NC without or with the cofactors, FAD and NADH, showed good correlation with the established experimental evidence that the two-component PNP monooxygenase catalyzes both the hydroxylation of PNP and the oxidative release of nitrite from 4-NC in B. sphaericus JS905. Furthermore, molecular dynamics simulations performed for docking complexes using Desmond v3.0 showed stable nature of the interactions as well.

  3. Influence of pH and inorganic phosphate on toxicity of zinc to Arthrobacter sp. isolated from heavy-metal-contaminated sediments.

    Science.gov (United States)

    Moberly, James G; Staven, Ari; Sani, Rajesh K; Peyton, Brent M

    2010-10-01

    Because of its high solubility over a wide range of pH conditions, zinc is found in many natural and human-impacted systems. Zinc speciation is critical in assessing zinc toxicity to microorganisms because it varies considerably with pH and is dependent on other aqueous constituents. Combined results of thermodynamic modeling, statistical analysis, and batch culture studies using Arthrobacter sp. JM018 suggest that the toxic species may not be solely limited to the free ion, but also includes ZnHPO(4)(0)(aq). Cellular uptake of ZnHPO(4)(0)(aq) through the inorganic phosphate transporter (Pit family), which requires a neutral metal phosphate complex for phosphate transport, may explain the observed toxicity. Based on visual MINTEQ (v3.0) modeling, at 50 μM total zinc, ZnHPO(4)(0)(aq) constitutes 33, 70, and 76% of the neutral metal phosphate pool at pH 6, 7, and 8, respectively. At 50 μM total zinc, cultures supplied with organic phosphate (glycerol-3-phosphate) show no significant response to pH (p = 0.13) while inhibition of inorganic phosphate-supplemented cultures, whose neutral metal phosphates are increasingly dominated by ZnHPO(4)(0)(aq), show significant pH dependence (p = 9.45 × 10(-7)). Using sodium to decrease the distribution of ZnHPO(4)(0)(aq) in the neutral metal phosphate pool also decreased the pH dependent toxicity, further supporting this mechanism. These findings show the important role of minor zinc species in organism toxicity and have wider implications because the Pit inorganic phosphate transport system is widely distributed in Bacteria, Archaea, and Eukarya.

  4. Purification and characterization of alpha-L-arabinofuranosidase from Arthrobacter sp. MTCC 5214 in solid-state fermentation

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, R.; Numan, M.T.H.; Mukherjee, B.; Satwekar, A.; Bhosle, N.B.

    acetobutylicum [6] and Bacillus pumilus PS213 [16], which were 92, 94 and 60 kDa, respectively. High molecular mass a-L-AFases with multiple subunits isolated from Streptomyces purpurascens [32], Butyrivibrio fibrisolvens GS113 [33] and Thermotoga maritime [39... was not observed with pNPAF tested up to 6.8 mmol l C01 concentration. The efficiency of a-L-AFase (V max /K m ) from Arthro- bacter sp. was less than that shown by the a-L-AFase produced by Bacillus stearothermophilus[9] andB. pumilus PS213[16].However...

  5. 阿特拉津降解茵FM326(Arthrobacter sp.)的分离筛选、鉴定和生物学特性%Isolation, Screening and Identification of Atrazine-degrading Bacterium FM326(Arthrobacter sp.)

    Institute of Scientific and Technical Information of China (English)

    李明锐; 祖艳群; 陈建军; 湛方栋; 何永美; 李元

    2011-01-01

    采集除草剂阿特拉津污染的土壤,通过直接涂布法和富集驯化培养分离法,分别获得6株和5株能够降解阿特拉津的细菌.通过降解效率和降解动态试验,筛选到1株高效降解阿特拉津的菌株FM326,该菌株能以阿特拉津为唯一的碳源和氮源生长,培养96 h后对1000 mg· L-1阿特拉津降解效率达到97%.通过生理生化鉴定和16S rDNA序列分析,菌株FM326鉴定为节杆菌属(Arthrobacter sp.)细菌.该菌株表现出最适生长温度30~35℃,最适生长pH值5~9,好氧生长的生长特性.%The Iriazine herbicide atrazine(2-chloro-4-ethylamino-6-isopropyl-amino-s-triazine) is one of the most used pesticides. Atrazine is principally used for control of certain annual broadleaf and grass weeds, primarily in com but also in sorghum, sugarcane, and other crops. Although atrazine has relatively low persistency in soil, its remanets have been found in many higher concentrations even years after application due to widespread use. Microbial remediation is an effective and economic method to control the environment that has been polluted by atrazine. From herbicide contaminated soil, 5 atrazine degrading bacterial strains were isolated by enrichment culture, and 6 a- trazine-degrading bacterial strains were isolated by direct coating method. In the 11 strains, FM326 was screened out as the most highly efficient degradation bacteria by degradation test and could use atrazine as the sole carbon and nitrogen sources for growth. The degradation efficiency of strain FM326 was up to 97% within 96 hours while atrazine concentration was 1 000 mg-L"'. Strain FM326 was identified as Arthrobacter sp. According to physiological and biochemical tests and the phylogenic tree established by means of 16S rDNA sequencing. Moreover, strain FM326 was aerobic bacteria, its optimum temperature and pH value for growth was 30-35 t and 5~9, respectively. Strain of highly efficient degrading atrazine was found from soils

  6. Key enzymes enabling the growth of Arthrobacter sp. strain JBH1 with nitroglycerin as the sole source of carbon and nitrogen.

    Science.gov (United States)

    Husserl, Johana; Hughes, Joseph B; Spain, Jim C

    2012-05-01

    Flavoprotein reductases that catalyze the transformation of nitroglycerin (NG) to dinitro- or mononitroglycerols enable bacteria containing such enzymes to use NG as the nitrogen source. The inability to use the resulting mononitroglycerols limits most strains to incomplete denitration of NG. Recently, Arthrobacter strain JBH1 was isolated for the ability to grow on NG as the sole source of carbon and nitrogen, but the enzymes and mechanisms involved were not established. Here, the enzymes that enable the Arthrobacter strain to incorporate NG into a productive pathway were identified. Enzyme assays indicated that the transformation of nitroglycerin to mononitroglycerol is NADPH dependent and that the subsequent transformation of mononitroglycerol is ATP dependent. Cloning and heterologous expression revealed that a flavoprotein catalyzes selective denitration of NG to 1-mononitroglycerol (1-MNG) and that 1-MNG is transformed to 1-nitro-3-phosphoglycerol by a glycerol kinase homolog. Phosphorylation of the nitroester intermediate enables the subsequent denitration of 1-MNG in a productive pathway that supports the growth of the isolate and mineralization of NG.

  7. Bioavailability of Ag(I) with Arthrobacter oxidas and Arthrobacter globiformis

    CERN Document Server

    Gelagutashvili, E; Ginturi, E; Bagdavadze, N; Kuchava, N; Tsakadze, K; Janjalia, M

    2012-01-01

    The biosorption of Ag(I)_ Arthrobacter species (Arthrobacter globiformis 151B and Arthrobacter oxidas 61B) was studied at simultaneous application of dialysis and atomic absorption analysis. The biosorption constants and nature of interaction for Ag(I) -Arthrobacter oxidas and Ag(I) -Arthrobacter globiformis were determined. The biosorption constants for Ag(I)- -Arthrobacter globiformis and for Ag(I) -Arthrobacter oxidas equal to 65.0 x10-4 and 35.0 x10-4 respectively.

  8. Cloning and sequencing of the trpE gene from Arthrobacter globiformis ATCC 8010 and several related subsurface Arthrobacter isolates

    Energy Technology Data Exchange (ETDEWEB)

    Chernova, T.; Viswanathan, V.K.; Austria, N.; Nichols, B.P.

    1998-09-01

    Tryptophan dependent mutants of Arthrobacter globiformis ATCC 8010 were isolated and trp genes were cloned by complementation and marker rescue of the auxotrophic strains. Rescue studies and preliminary sequence analysis reveal that at least the genes trpE, trpC, and trpB are clustered together in this organism. In addition, sequence analysis of the entire trpE gene, which encodes component I of anthranilate synthase, is described. Segments of the trpE gene from 17 subsurface isolates of Arthrobacter sp. were amplified by PCR and sequenced. The partial trpE sequences from the various strains were aligned and subjected to phylogenetic analysis. The data suggest that in addition to single base changes, recombination and genetic exchange play a major role in the evolution of the Arthrobacter genome.

  9. Degradation of the Phosphonate Herbicide Glyphosate by Arthrobacter atrocyaneus ATCC 13752

    OpenAIRE

    Pipke, Rüdiger; Amrhein, Nikolaus

    1988-01-01

    Of nine authentic Arthrobacter strains tested, only A. atrocyaneus ATCC 13752 was capable of using the herbicide glyphosate [N-(phosphonomethyl)glycine] as its sole source of phosphorus. Contrary to the previously isolated Arthrobacter sp. strain GLP-1, which degrades glyphosate via sarcosine, A. atrocyaneus metabolized glyphosate to aminomethylphosphonic acid. The carbon of aminomethylphosphonic acid was entirely converted to CO2. This is the first report on glyphosate degradation by a bacte...

  10. Pb2 + Tolerance and Adsorption of Arthrobacter sp. 12-1 Isolated from Lead-zinc Mine Tailing Dam%铅锌矿尾矿坝分离节杆菌12-1对Pb2+的耐受和吸附性能研究

    Institute of Scientific and Technical Information of China (English)

    陈志; 邹情雅; 潘晓鸿; 林璋; 关雄

    2014-01-01

    The extensive exploitation and usage of lead resources have caused serious environmental pollution problems currently. Bioremediation of Pb2 + contaminated water and soil environments using microbes is regarded as a promising technology due to the advantages of its cost-effective, easy operation and environmental-friendly properties. In order to understand Pb2+ biosorption characterization of microbes, an indigenous lead-resistant bacterium-Arthrobacter sp. 12-1(GenBank No. KM362724) was isolated from lead-zinc mine tailing dam, and the process and mechanism of Pb2+ biosorption by Arthrobacter sp. 12-1 were furtherly investigated in this study. Study on the growth of Arthrobacter sp. 12-1 in LB medium containing different concentration of Pb2+suggested that the highest Pb2+tolerant concentration of Arthrobacter sp. 12-1 was 800 mg/L. In water solution, 105 mg/L of Pb2+could be reduced to 2.17 mg/L by Arthrobacter sp. 12-1 within 24 h with biosorption rate of 97.93%. Microscopic investigation (atomic force microscopy and scanning electronic microscopy) combined with energy dispersive X-ray spectroscopy analysis showed that lead containing mineral was formed on the surface of cell after Pb2+sorption by Arthrobacter sp. 12-1. Further fourier transform infrared (FT- IR) analysis revealed that carboxyl, amide and phosphate groups of Arthrobacter sp. 12-1 might be involved in Pb2 + biosorption process. The results demonstrated that the Arthrobacter sp. 12-1 isolated from lead-zinc mine tailing dam had strong ability of Pb2 + resistance and biosorption, indicating an attractive prospect of practical applications in bioremediation Pb2+ contaminated water and soil environments. The present work provides much fundamental information for help in constructing feasible strategies for Pb2+bioremediation in the environment.%当前铅资源的粗放式开采和使用对环境造成了严重的污染。利用微生物修复铅污染具有费用低、易操作、环境友好等优

  11. Purification and characterization of β-galactosidase from Arthrobacter sp%节杆菌β-半乳糖苷酶的分离纯化及酶学性质研究

    Institute of Scientific and Technical Information of China (English)

    李珍爱; 唐蕾; 毛忠贵; 张建华; 杨瑞金

    2011-01-01

    分离纯化了由节杆菌所产的fI-半乳糖苷酶(EC 3.2.1.23)并研究了其酶学性质.以乳糖发酵培养基培养,离心收集茵体,超声破碎细胞得到粗酶液;采用硫酸铵沉淀、Phenyl-Sepharose疏水、DEAE-Sepharose离子交换和p-aminobelazyl-1-thio-β-galactopyranoside(PABTG)亲和层析方法进行酶的分离纯化,纯化倍数达到31.4;经SDS-PAGE检测分子量为30 kD.酶学性质的研究表明:该酶最适pH值为6.6,最适反应温度为37℃,pH在5.5~8.0,温度低于30℃时,相对酶活在1 h内保持在50%以上,较为稳定.以邻硝基苯-β-吡喃半乳糖苷(ONPG)为底物,米氏常数为4.64 mmol/L.%The purification and characterization of β-galactosidase (EC 3.2.1.23) produced by Arthrobacter sp. Were investigated. The bacterial cells cultured were gathered by centrifugation and disrupted by ultrasonication. The crude enzyme solution was precipitated by ammonium sulphate. Further enzyme purification was carried out by Phenyl- Sepharose, DEAE-Sepharose and p-amino-benzyl-l-thio-β-Dgalactopyranoside (PABTG) affinity chromatography. The purified β-galactosiclase was illustrated as a single band in SDS-PAGE with a purification fold of 31.4 and an apparent molecular weight of 30 kD. The maximum activity of the enzyme was determined at pH 6.6 and 37 ℃. Above 50% of the maximum activity of the enzyme was detected at pH 5.5~8.0 and 30 ℃. The Km for ONPG was 4.64 mmol/L.

  12. Biodegradation kinetics of 4-fluorocinnamic acid by a consortium of Arthrobacter and Ralstonia strains

    NARCIS (Netherlands)

    Hasan, Syed A.; Wietzes, Piet; Janssen, Dick B.

    2012-01-01

    Arthrobacter sp. strain G1 is able to grow on 4-fluorocinnamic acid (4-FCA) as sole carbon source. The organism converts 4-FCA into 4-fluorobenzoic acid (4-FBA) and utilizes the two-carbon side-chain for growth with some formation of 4-fluoroacetophenone as a dead-end side product. We also have isol

  13. Human (Clovis)-gomphothere (Cuvieronius sp.) association ∼ 13,390 calibrated yBP in Sonora, Mexico.

    Science.gov (United States)

    Sanchez, Guadalupe; Holliday, Vance T; Gaines, Edmund P; Arroyo-Cabrales, Joaquín; Martínez-Tagüeña, Natalia; Kowler, Andrew; Lange, Todd; Hodgins, Gregory W L; Mentzer, Susan M; Sanchez-Morales, Ismael

    2014-07-29

    The earliest known foragers to populate most of North America south of the glaciers [∼ 11,500 to ≥ ∼ 10,800 (14)C yBP; ∼ 13,300 to ∼ 12,800 calibrated (Cal) years] made distinctive "Clovis" artifacts. They are stereotypically characterized as hunters of Pleistocene megamammals (mostly mammoth) who entered the continent via Beringia and an ice-free corridor in Canada. The origins of Clovis technology are unclear, however, with no obvious evidence of a predecessor to the north. Here we present evidence for Clovis hunting and habitation ∼ 11,550 yBP (∼ 13,390 Cal years) at "El Fin del Mundo," an archaeological site in Sonora, northwestern Mexico. The site also includes the first evidence to our knowledge for gomphothere (Cuvieronius sp.) as Clovis prey, otherwise unknown in the North American archaeological record and terminal Pleistocene paleontological record. These data (i) broaden the age and geographic range for Clovis, establishing El Fin del Mundo as one of the oldest and southernmost in situ Clovis sites, supporting the hypothesis that Clovis had its origins well south of the gateways into the continent, and (ii) expand the make-up of the North American megafauna community just before extinction.

  14. Human (Clovis)-gomphothere (Cuvieronius sp.) association ∼13,390 calibrated yBP in Sonora, Mexico

    Science.gov (United States)

    Sanchez, Guadalupe; Holliday, Vance T.; Gaines, Edmund P.; Arroyo-Cabrales, Joaquín; Martínez-Tagüeña, Natalia; Kowler, Andrew; Lange, Todd; Hodgins, Gregory W. L.; Mentzer, Susan M.; Sanchez-Morales, Ismael

    2014-07-01

    The earliest known foragers to populate most of North America south of the glaciers [∼11,500 to ≥ ∼10,800 14C yBP; ∼13,300 to ∼12,800 calibrated (Cal) years] made distinctive "Clovis" artifacts. They are stereotypically characterized as hunters of Pleistocene megamammals (mostly mammoth) who entered the continent via Beringia and an ice-free corridor in Canada. The origins of Clovis technology are unclear, however, with no obvious evidence of a predecessor to the north. Here we present evidence for Clovis hunting and habitation ∼11,550 yBP (∼13,390 Cal years) at "El Fin del Mundo," an archaeological site in Sonora, northwestern Mexico. The site also includes the first evidence to our knowledge for gomphothere (Cuvieronius sp.) as Clovis prey, otherwise unknown in the North American archaeological record and terminal Pleistocene paleontological record. These data (i) broaden the age and geographic range for Clovis, establishing El Fin del Mundo as one of the oldest and southernmost in situ Clovis sites, supporting the hypothesis that Clovis had its origins well south of the gateways into the continent, and (ii) expand the make-up of the North American megafauna community just before extinction.

  15. Human (Clovis)–gomphothere (Cuvieronius sp.) association ∼13,390 calibrated yBP in Sonora, Mexico

    Science.gov (United States)

    Sanchez, Guadalupe; Holliday, Vance T.; Gaines, Edmund P.; Arroyo-Cabrales, Joaquín; Martínez-Tagüeña, Natalia; Kowler, Andrew; Lange, Todd; Hodgins, Gregory W. L.; Mentzer, Susan M.; Sanchez-Morales, Ismael

    2014-01-01

    The earliest known foragers to populate most of North America south of the glaciers [∼11,500 to ≥ ∼10,800 14C yBP; ∼13,300 to ∼12,800 calibrated (Cal) years] made distinctive “Clovis” artifacts. They are stereotypically characterized as hunters of Pleistocene megamammals (mostly mammoth) who entered the continent via Beringia and an ice-free corridor in Canada. The origins of Clovis technology are unclear, however, with no obvious evidence of a predecessor to the north. Here we present evidence for Clovis hunting and habitation ∼11,550 yBP (∼13,390 Cal years) at “El Fin del Mundo,” an archaeological site in Sonora, northwestern Mexico. The site also includes the first evidence to our knowledge for gomphothere (Cuvieronius sp.) as Clovis prey, otherwise unknown in the North American archaeological record and terminal Pleistocene paleontological record. These data (i) broaden the age and geographic range for Clovis, establishing El Fin del Mundo as one of the oldest and southernmost in situ Clovis sites, supporting the hypothesis that Clovis had its origins well south of the gateways into the continent, and (ii) expand the make-up of the North American megafauna community just before extinction. PMID:25024193

  16. Mineralization of melamine and cyanuric acid as sole nitrogen source by newly isolated Arthrobacter spp. using a soil-charcoal perfusion method.

    Science.gov (United States)

    Hatakeyama, Takashi; Takagi, Kazuhiro; Yamazaki, Kenichi; Sakakibara, Futa; Ito, Koji; Takasu, Eiichi; Naokawa, Takuji; Fujii, Kunihiko

    2015-05-01

    Melamine belongs to the s-triazine family, and industrially used as raw product in many ways all over the world. Melamine has been reported for human harmful effects and detected from some crops, soil and water. To remove melamine from the polluted environment, the efficient melamine-mineralizing microorganisms have been needed. We newly isolated three melamine-degrading bacteria from the same upland soil sample using soil-charcoal perfusion method. These bacteria were classified as Arthrobacter sp. MCO, Arthrobacter sp. CSP and Microbacterium sp. ZEL by 16S rRNA genes sequencing analysis. Both Arthrobacter species completely degraded melamine within 2 days, and consumed melamine as a sole nitrogen source. Both strains also grew in cyanuric acid as sole nitrogen source, and released small quantities of ammonium ions. These strains are the first identified bacteria that can mineralize both melamine and cyanuric acid as sole initial nitrogen source in Arthrobacter sp. Although ammeline and ammelide intermediates were detected, these strains possess none of the known genes encoding melamine degrading enzymes. Since the Arthrobacter strains also degraded melamine in a high pH liquid medium, they present as potential bioremediation agents in melamine-polluted environments.

  17. Phycospheric Native Bacteria Pelagibaca bermudensis and Stappia sp. Ameliorate Biomass Productivity of Tetraselmis striata (KCTC1432BP) in Co-cultivation System through Mutualistic Interaction

    Science.gov (United States)

    Park, Jungsoo; Park, Bum Soo; Wang, Pengbin; Patidar, Shailesh K.; Kim, Jin Ho; Kim, Sae-Hee; Han, Myung-Soo

    2017-01-01

    Effective sustainable algal cultivation techniques are essential for mass production of the marine microalga Tetraselmis for biofuel and array of co-products. The phycospheric communities affect the microalgal growth and metabolism through various allelochemical and nutrient interactions; hence, their potential to affect the quantity and quality of both biomass and bioproducts is significant. In the present study, we have screened the phycospheric communities of biofuel producing Tetraselmis striata (KCTC1432BP). A total of 26 bacterial strains were isolated and identified from the phycosphere of T. striata mass culture. Then, each bacterial strain was tested in co-cultivation conditions with T. striata for evaluating its growth promoting and inhibitory effects. Among these all strains, two promising strains (Pelagibaca bermudensis KCTC 13073BP and Stappia sp. KCTC 13072BP) were selected because of their maximum growth promoting effects and mutualistic interactions. The growth rate, biomass productivity, lipid contents, and fatty acids were analyzed during their combined growth in O3 media and compared with axenic growth of T. striata. Later, growth promoting mechanisms in the co-cultivation environment were investigated for these promising bacterial strains under replete and limited conditions of nutrients (nitrate, phosphate, and vitamin B12). The growth promoting potential of P. bermudensis was illustrated by the two fold enhancement in biomass productivity. These bacteria are promising for microalgal cultivation without any negative effects on the native seawater bacterial communities, as revealed by next generation sequencing analysis. This study represents, to date, the first report highlighting the role of phycospheric growth promoting bacteria of promising biofuel feedstock T. striata. PMID:28321229

  18. Degradation of 4-fluorophenol by Arthrobacter sp strain IF1

    NARCIS (Netherlands)

    Ferreira, Maria Isabel M.; Marchesi, Julian R.; Janssen, Dick B.

    2008-01-01

    A Gram-positive bacterial strain capable of aerobic biodegradation of 4-fluorophenol (4-FP) as the sole source of carbon and energy was isolated by selective enrichment from soil samples collected near an industrial site. The organism, designated strain IF1, was identified as a member of the genus A

  19. Plasmid pP62BP1 isolated from an Arctic Psychrobacter sp. strain carries two highly homologous type II restriction-modification systems and a putative organic sulfate metabolism operon.

    Science.gov (United States)

    Lasek, Robert; Dziewit, Lukasz; Bartosik, Dariusz

    2012-05-01

    The complete nucleotide sequence of plasmid pP62BP1 (34,467 bp), isolated from Arctic Psychrobacter sp. DAB_AL62B, was determined and annotated. The conserved plasmid backbone is composed of several genetic modules, including a replication system (REP) with similarities to the REP region of the iteron-containing plasmid pPS10 of Pseudomonas syringae. The additional genetic load of pP62BP1 includes two highly related type II restriction-modification systems and a set of genes (slfRCHSL) encoding enzymes engaged in the metabolism of organic sulfates, plus a putative transcriptional regulator (SlfR) of the AraC family. The pP62BP1 slf locus has a compact and unique structure. It is predicted that the enzymes SlfC, SlfH, SlfS and SlfL carry out a chain of reactions leading to the transformation of alkyl sulfates into acyl-CoA, with dodecyl sulfate (SDS) as a possible starting substrate. Comparative analysis of the nucleotide sequences of pP62BP1 and other Psychrobacter spp. plasmids revealed their structural diversity. However, the presence of a few highly conserved DNA segments in pP62BP1, plasmid 1 of P. cryohalolentis K5 and pRWF-101 of Psychrobacter sp. PRwf-1 is indicative of recombinational shuffling of genetic information, and is evidence of lateral gene transfer in the Arctic environment.

  20. Genetic differentiation of Arthrobacter population from heavy metal-contaminated environment

    Institute of Scientific and Technical Information of China (English)

    ZHANG Hanbo; REN Weimin; SHAO Qiyong; DUAN Changqun

    2007-01-01

    Six samples containing extremely high concentration of Pb,Zn,and Cd were obtained from the layers of 5-10 cm and 25-30 cm three tailing piles,with ages of about 10,20 and more than 80 years,respectively.Then,48 bacterial strains were obtained from these samples,and subsequently their phylogenetic positions were determined by analysis on the partial sequence of 16S rRNA gene (fragment length ranging from 474 to 708 bp).These isolates were members of the Arthrobacter genus,phylogenetically close to A.keyseri and A.ureafaciens,with sequence ranging from 99.1%to 100%.Furthermore,genetic variation between subpopulations from different samples was revealed by analysis on their randomly amplified polymorphic DNA profile.Nei genetic distance showed that the greatest differentiation occurred between subpopulation A and C.Notably,either genetic distance between subpopulations from the layers of 5-10 cm and 25-30 cm of each tailing pile or between same layers of different tailing pile increased with the history of tailings.Moreover,correlation analysis showed that soluble Pb has a significantly negative relationship with Nei'gene diversity of subpopulation.It was assumed that soluble Pb may be responsible for the reduced genetic diversity of the Arthrobacter population.Our data provided evidence that genetic differentiation of microbial populations was consistent with the changes of environmental factors,particularly heavy metals.

  1. Biodegradation kinetics of 4-fluorocinnamic acid by a consortium of Arthrobacter and Ralstonia strains.

    Science.gov (United States)

    Hasan, Syed A; Wietzes, Piet; Janssen, Dick B

    2012-02-01

    Arthrobacter sp. strain G1 is able to grow on 4-fluorocinnamic acid (4-FCA) as sole carbon source. The organism converts 4-FCA into 4-fluorobenzoic acid (4-FBA) and utilizes the two-carbon side-chain for growth with some formation of 4-fluoroacetophenone as a dead-end side product. We also have isolated Ralstonia sp. strain H1, an organism that degrades 4-FBA. A consortium of strains G1 and H1 degraded 4-FCA with Monod kinetics during growth in batch and continuous cultures. Specific growth rates of strain G1 and specific degradation rates of 4-FCA were observed to follow substrate inhibition kinetics, which could be modeled using the kinetic models of Haldane-Andrew and Luong-Levenspiel. The mixed culture showed complete mineralization of 4-FCA with quantitative release of fluoride, both in batch and continuous cultures. Steady-state chemostat cultures that were exposed to shock loadings of substrate responded with rapid degradation and returned to steady-state in 10-15 h, indicating that the mixed culture provided a robust system for continuous 4-FCA degradation.

  2. Wide Distribution of Closely Related, Antibiotic-Producing Arthrobacter Strains throughout the Arctic Ocean

    DEFF Research Database (Denmark)

    Wietz, Matthias; Månsson, Maria; Bowman, Jeff S.

    2012-01-01

    We isolated 16 antibiotic-producing bacterial strains throughout the central Arctic Ocean, including seven Arthrobacter spp. with almost identical 16S rRNA gene sequences. These strains were numerically rare, as revealed using 454 pyrosequencing libraries. Arthrobacter spp. produced arthrobacilins...

  3. Isolation of Arthrobacter species from the phyllosphere and demonstration of their epiphytic fitness

    NARCIS (Netherlands)

    Scheublin, T.R.; Leveau, J.H.J.

    2013-01-01

    Bacteria of the genus Arthrobacter are common inhabitants of the soil environment, but can also be recovered from leaf surfaces (the phyllosphere). Using enrichment cultures on 4-chlorophenol, we succeeded in specifically isolating Arthrobacter bacteria from ground cover vegetation in an apple orcha

  4. Biosorption of Cr(VI)_ and Cr(III)_Arthrobacter species

    CERN Document Server

    Gelagutashvili, E; Gurielidze, M

    2011-01-01

    The biosorption of Cr(VI)_ and Cr(III)_ Arthrobacter species (Arthrobacter globiformis and Arthrobacter oxidas) was studied simultaneous application dialysis and atomic absorption analysis. Also biosorption of Cr(VI) in the presence of Zn(II) during growth of Arthrobacter species and Cr(III) in the presence of Mn(II) were discussed. Comparative Cr(VI)_ and Cr(III)_ Arthrobacter species shown, that Cr(III) was more effectively adsorbed by both bacterium than Cr(VI). The adsorption capacity is the same for both the Chromium-Arthrobacter systems. The biosorption constants for Cr(III) is higher than for Cr(VI) 5.7-5.9- fold for both species. Comparative Freundlich biosorption characteristics Cr(VI) Arthrobacter species of living and dry cells shown, that capacity(n) is in both cases the same(1.25,1.35). Dry cells have larger biosorption constant for both species, than living cells. Biosorption characteristics (K) and (n) for A. oxidas are without Mn(II) and in the presence of Mn(II) 2.6 x 10-4 (K), 1.37 (n) and 2...

  5. Ability of Cyanobacteria and Arthrobacter Species to Remove Gold Ions from Solution

    CERN Document Server

    Gelagutashvili, E; Rcheulichvili, A; Tsakadze, K; Bagdavadze, N; Kuchava, N; Djandjalia, M

    2012-01-01

    The biosorption of Au(III) - Spirulina platensis and Au(III) - Arthrobacter species (Arthrobacter globiformis and Arthrobacter oxidas) were studied at simultaneous application of dialysis and atomic absorption analysis. Also biosorption of Au(III) - Spirulina platensis at various pH were discussed. Biosorption constants for Au-cyanobacteris Spirulina platensis at different pH, and for Arthrobacter oxidas and Arthrobacter globiformis at pH=7.1 are : 1. K=3.91 x 10-4 (Au- Arthrobacter oxidas 61B, pH=7.1) 2. K=14.17 x 10-4 . (Au- Arthrobacter globiformis 151B, pH=7.1). 3. K=2.07x10-4 (Au- Spirulina platensis, pH=7.1) 4. K= 4.87x10-4 (Au- Spirulina platensis, pH=6.2) 5. K=8.7x10-4 (Au- Spirulina platensis, pH=8.4)

  6. Erythema caused by a localised skin infection with Arthrobacter mysorens

    Directory of Open Access Journals (Sweden)

    Chakraborty Trinad

    2010-12-01

    Full Text Available Abstract Background Skin erythemas of unknown origin are a frequent reason for consulting the general practitioner or dermatologist. Case presentation Here we report a case of an erythema resembling the erythema migrans manifestation of Lyme disease, but with atypical symptoms like persistent pruritus. The patient had no history of a recent tick-bite but displayed a positive serology for an advanced stage of Lyme borreliosis, which stood in contrast to the clinical manifestation of erythema migrans as a symptom of early Lyme disease. Three skin swabs and soil samples, collected in the area where the patient possibly acquired the infection, were examined by bacterial and fungal culture methods. Microorganisms were identified by using 16 S rRNA gene sequencing and bioinformatics. The patient and soil isolates were compared by employing RAPD analysis. The serum samples of the patient were examined by immunoblotting. Arthrobacter mysorens, a soil bacterium, was isolated from the collected skin and soil samples. The identity of both isolates was determined by molecular fingerprinting methods. A. mysorens was proven to be causative for the erythema by direct isolation from the affected skin and a positive serology, thus explaining the atypical appearance of the erythema compared to erythema migrans caused by Borrelia infection. Conclusions Infections with A.mysorens might be underreported and microbiological diagnostic techniques should be applied in cases of patients with unclear erythemas, resembling erythema migrans, without a history of tick bites.

  7. Review of the taxonomy of the genus Arthrobacter, emendation of the genus Arthrobacter sensu lato, proposal to reclassify selected species of the genus Arthrobacter in the novel genera Glutamicibacter gen. nov., Paeniglutamicibacter gen. nov., Pseudoglutamicibacter gen. nov., Paenarthrobacter gen. nov. and Pseudarthrobacter gen. nov., and emended description of Arthrobacter roseus.

    Science.gov (United States)

    Busse, Hans-Jürgen

    2016-01-01

    In this paper, the taxonomy of the genus Arthrobacter is discussed, from its first description in 1947 to the present state. Emphasis is given to intrageneric phylogeny and chemotaxonomic characteristics, concentrating on quinone systems, peptidoglycan compositions and polar lipid profiles. Internal groups within the genus Arthrobacter indicated from homogeneous chemotaxonomic traits and corresponding to phylogenetic grouping and/or high 16S rRNA gene sequence similarities are highlighted. Furthermore, polar lipid profiles and quinone systems of selected species are shown, filling some gaps concerning these chemotaxonomic traits. Based on phylogenetic groupings, 16S rRNA gene sequence similarities and homogeneity in peptidoglycan types, quinone systems and polar lipid profiles, a description of the genus Arthrobacter sensu lato and an emended description of Arthrobacter roseus are provided. Furthermore, reclassifications of selected species of the genus Arthrobacter into novel genera are proposed, namely Glutamicibacter gen. nov. (nine species), Paeniglutamicibacter gen. nov. (six species), Pseudoglutamicibacter gen. nov. (two species), Paenarthrobacter gen. nov. (six species) and Pseudarthrobacter gen. nov. (ten species).

  8. Reclassification of Arthrobacter sanguinis (Mages et al. 2009) as Haematomicrobium sanguinis gen. nov., comb. nov.

    Science.gov (United States)

    Schumann, Peter; Busse, Hans-Jürgen

    2016-12-29

    Due to its separate position within the genus Arthrobacter in many published phylogenetic trees and its incomplete chemotaxonomic characterization the type strain of Arthrobacter sanguinis was subjected to analysis of its chemotaxonomic traits including quinone system, polar lipid profile, peptidoglycan structure and fatty acid profile. The fatty acid profile consisted of the major compounds (>10 %) iso-C15:0, anteiso-C15:0 and anteiso-C17:0. It showed a quinone system with the predominating menaquinone MK-9(H2). Both, fatty acid profile and quinone system are in line with the description of the genus Arthrobacter. The peptidoglycan type was L-Lys - L-Ala - Gly (A11.50) which is unique within the genus Arthrobacter sensu lato and also among Arthrobacter species recently reclassified in the genera Sinomonas, Paenarthrobacter and Pseudarthrobacter. The polar lipid profile was very complex and unique among the group of taxa in containing relatively high proportions of several unidentified lipids. In conclusion from its phylogenetic position and its chemotaxonomic distinguishability from related taxa here the reclassification of A. sanguinis in a new genus and species, Haematomicrobium sanguinis gen. nov., comb. nov, is proposed. The type strain is 741T (=CCUG 46407T=DSM 21259T).

  9. Application of NAA Method to Study Chromium Uptake by Arthrobacter oxydans

    CERN Document Server

    Tsibakhashvili, N Ya; Kalabegishvili, T L; Kirkesali, E I; Frontasyeva, M V; Pomyakushina, E V; Pavlov, S S

    2002-01-01

    To study chromium uptake by Arthrobacter oxydans (Cr(VI)-reducer bacteria isolated from Columbia basalt rocks, USA) instrumental neutron activation analysis method was applied. It was established that chromate accumulation is dose-dependent and it is more intesive in the interval of concentrations of Cr(VI) (10-50 mg/l). At low concentrations of Cr(VI) (up to 50 mg/l) the most intensive formation of Cr(V) was also found (using ESR method). Besides, it was estimated that reduction from Cr(VI) to Cr(V) is faster process than the uptake of Cr(VI). According to ENAA measurements Cr(III), in constant to Cr(VI), is not accumulated in Arthrobacter oxydans cells up to concentration of 200 mg/l. Using epithermal neutron activation analysis the background levels of 17 major, minor and trace elements were determined in Arthrobacter oxydans.

  10. AcEST: BP921217 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B03 574 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B03. BP921217 - Show BP92121...is mRNA. clone: YMU001_000147_B03. Accession BP921217 Tissue type prothallium Developmental stage - Contig I...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121...containing protei... 100 5e-21 sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-con...... 89 2e-17 sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei...

  11. AcEST: BP916916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000093_E09 519 Adiantum capillus-veneris mRNA. clone: YMU001_000093_E09. BP916916... CL699Contig1 Show BP916916 Clone id YMU001_000093_E09 Library YMU01 Length 519 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000093_E09. Accession BP916916 Tissue type prothallium Developmental stage...Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id P16098 Definition sp|P16...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916916

  12. AcEST: BP918182 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E03. BP918182 - Show BP91818...is mRNA. clone: YMU001_000110_E03. Accession BP918182 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918... protei... 140 4e-33 sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 139 6e-33 sp|P93011|PP18...RPTDARRVFDEMDVRDSVSYNT 278 Query: 314 IIXXXXXXXXXXXALQLFHEMQKKCVKPDEVTYITVLNACSH 18

  13. Application of thermoalkalophilic xylanase from Arthrobacter sp. MTCC 5214 in biobleaching of kraft pulp

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, R.; Bhosle, N.B.

    released by enzyme treatment showed a characteristic peak at 280 nm indicating the presence of lignin in the released coloring matter. Enzymatic prebleaching of kraft pulp showed 20 % reduction in kappa number of the pulp without much change in viscosity...

  14. Arthrobacter luteus restriction endonuclease cleavage map of X174 RF DNA

    NARCIS (Netherlands)

    Vereijken, J.M.; Mansfeld, A.D.M. van; Baas, P.D.; Jansz, H.S.

    1975-01-01

    Cleavage of X174 RF DNA with the restriction endonuclease from Arthrobacter luteus (Alu I) produces 23 fragments of approximately 24–1100 base pairs in length. The order of most of these fragments has been established by digestion of Haemophilus influenzae Rd (Hind II) and Haemophilus aegyptius (Hae

  15. CLONING AND CHARACTERIZATION OF THE PHTHALATE CATABOLISM REGION OF PRE1 OF ARTHROBACTER KEYSERI 12B

    Science.gov (United States)

    o-Phthalate (benzene-1,2-dicarboxylate) is a central intermediate in the bacterial degradation of phthalate ester plasticizers as well as of a number of fused-ring polycyclic aromatic hydrocarbons found in fossil fuels. In Arthrobacter keyseri 12B, the genes encoding catabolism o...

  16. AcEST: BP913432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000030_B10 512 Adiantum capillus-veneris mRNA. clone: YMU001_000030_B10. BP913432 - Show BP913432...is mRNA. clone: YMU001_000030_B10. Accession BP913432 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913432|Adiantum ... TY A +T+C Sbjct: 1417 TTVSPKTYTTATVTQC 1432 >sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ4620...ucleic Acids Res. 25:3389-3402. Query= BP913432|Adiantum capillus-veneris mRNA, clone: YMU001_000030_B10. (5

  17. AcEST: BP913213 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_G05 514 Adiantum capillus-veneris mRNA. clone: YMU001_000027_G05. BP913213 - Show BP913213...is mRNA. clone: YMU001_000027_G05. Accession BP913213 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP913213|Adiantum capillus-veneris mRNA, clone: YMU001_000027_G05. (514 letters) Data...0 5e-09 sp|O07948|NUOF_RHOCA NADH-quinone oxidoreductase subunit F OS=Rh... 60 5e-09 sp|P29913... OS=My... 34 0.35 sp|P65568|NUOF_MYCBO NADH-quinone oxidoreductase subunit F OS=My... 34 0.35 sp|P56913

  18. Genome sequence of Arthrobacter antarcticus strain W2, isolated from a slaughterhouse

    DEFF Research Database (Denmark)

    Herschend, Jakob; Raghupathi, Prem Krishnan; Røder, Henriette Lyng;

    2016-01-01

    We report the draft genome sequence ofArthrobacter antarcticusstrain W2, which was isolated from a wall of a small slaughterhouse in Denmark. The 4.43-Mb genome sequence was assembled into 170 contigs....

  19. Bacteremia Due to Arthrobacter creatinolyticus in an Elderly Diabetic Man with Acute Cholangitis.

    Science.gov (United States)

    Yamamoto, Kei; Hayakawa, Kayoko; Nagamatsu, Maki; Fujiya, Yoshihiro; Mawatari, Momoko; Kutsuna, Satoshi; Takeshita, Nozomi; Tamura, Saeko; Mezaki, Kazuhisa; Ohmagari, Norio

    2017-03-24

    An 87-year-old man with poorly controlled diabetic mellitus presented with fever, bedsores, and elevated hepatobiliary enzyme levels. He was diagnosed with bacteremia with acute cholangitis due to Arthrobacter species, which are Gram-positive, aerobic, catalase-positive, coryneform bacteria belonging to the family Microbacteriaceae. Doripenem and subsequencial sulbactam/ampicillin treatment were used for the acute cholangitis, and the bacteremia was treated with a 2-week course of vancomycin. The bacteremia was misidentified by the phenotyping assay (API Coryne test), but was identified as Arthrobacter creatinolyticus by 16S rRNA and matrix-assisted laser-desorption/ionization time-of-flight mass spectrometry. To our knowledge, this is the first report of a human case of A. creatinolyticus bacteremia.

  20. An Arthrobacter spp. bacteremia leading to fetal death and maternal disseminated intravascular coagulation.

    Science.gov (United States)

    Shigeta, Naoya; Ozaki, Kimiaki; Hori, Kensuke; Ito, Kimihiko; Nakayama, Masahiro; Nakahira, Kumiko; Yanagihara, Itaru

    2013-02-01

    A 34-year-old parous woman developed high fever and threatened preterm labor after a 1-day trip, for which she was receiving prenatal care at a hospital. Three days after onset, at 24 4/7 weeks of gestation, she was transferred to our hospital in an emergency. Soon after the woman's arrival at our hospital, the infant was spontaneously stillborn via a transvaginal delivery. Laboratory tests revealed severe maternal disseminated intravascular coagulation with renal and liver insufficiency. Histopathologic examination of the placenta revealed vast fibrin deposition and remarkable neutrophilic infiltration in the intervillous space, suggesting a rare bacterial infection caused by Arthrobacter spp. The bacteria were predominantly detected in the placenta and maternal blood serum by common bacterial 16S rRNA sequencing after polymerase chain reaction amplification. We report the first case, to our knowledge, of bacteremia with Arthrobacter spp., which may lead to maternal disseminated intravascular coagulation and intrauterine fetal death.

  1. AcEST: BP921221 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B07 534 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B07. BP921221 - Show BP921221...is mRNA. clone: YMU001_000147_B07. Accession BP921221 Tissue type prothallium Developmental stage - Contig I... sp|Q944L7|Y1480_ARATH Uncharacterized protein At1g18480 OS=Arabidopsis thaliana Align length 90 Score (bit) 102.0 E-value 2.0e-21...Res. 25:3389-3402. Query= BP921221|Adiantum capillus-veneris mRNA, clone: YMU001_000147_B07. (534 letters) D... (bits) Value sp|Q944L7|Y1480_ARATH Uncharacterized protein At1g18480 OS=Arabi... 102 2e-21 sp|Q4R970|TRAD1_

  2. AcEST: BP916716 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000090_G02 586 Adiantum capillus-veneris mRNA. clone: YMU001_000090_G02. BP916716 - Show BP916716...is mRNA. clone: YMU001_000090_G02. Accession BP916716 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916716|Adiantum capillus-veneris ...b2253c OS=Mycobac... 42 0.002 sp|P64955|Y2228_MYCTU Uncharacterized protein Rv2228c/MT2287 OS=... 42 0.002 sp|P5416...EQMSGRWKVKHPDLLKLYVQAQALASQFRRINYEWVPRARNTYADRLAND 128 >sp|P54164|YPEP_BACSU Uncharacterized protein ypeP OS

  3. AcEST: BP916116 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_C12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000083_C12. BP916116 - Show BP916116...is mRNA. clone: YMU001_000083_C12. Accession BP916116 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP916116|Adiantum capillu...ocyte receptor cluster member 8 homolo... 39 0.016 sp|Q6NFC2|ISPF_CORDI 2-C-methyl-D-erythritol 2,4-cyclodip...diphosphat... 30 4.5 sp|Q8K387|UBP45_MOUSE Ubiquitin carboxyl-terminal hydrolase 45 O... 30 5.8 sp|P50165|TR

  4. AcEST: BP918305 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A02 488 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A02. BP918305 - Show BP91830...is mRNA. clone: YMU001_000112_A02. Accession BP918305 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91830... 32 1.5 sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protei... 32 2.0 sp|P58306|PPCK_THEVO Phos...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918305|Adiantum capillus-veneris mRNA, clo

  5. AcEST: BP915156 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B09 512 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B09. BP915156 - Show BP91515...is mRNA. clone: YMU001_000067_B09. Accession BP915156 Tissue type prothallium Developmental stage - Contig I...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915156|Adiantum...uery: 262 CLAKVEDKDSLMVQDNSKLKNLWIQ-LHQKMKKVTRVNIISMDKHELD 402 C ++ +K +LM QDN +L IQ LHQK K I+SM+ + +D Sbjct: 15...50 CKNQLSEKQTLMEQDNIQLNERIIQLLHQKTKHEN--EILSMESNIID 1595 >sp|Q8G1D1|CTAA_BRUS

  6. AcEST: BP912205 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D02 475 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D02. BP91220...5 CL3776Contig1 Show BP912205 Clone id YMU001_000016_D02 Library YMU01 Length 475 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D02. Accession BP912205 Tissue type prothallium Developmental stag...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912205|Adiantum capi...peat-containing protein 3 OS=Homo sapi... 38 0.020 sp|Q12220|UTP12_YEAST U3 small

  7. AcEST: BP916163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_A07 362 Adiantum capillus-veneris mRNA. clone: YMU001_000084_A07. BP91616...3 CL1121Contig1 Show BP916163 Clone id YMU001_000084_A07 Library YMU01 Length 362 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000084_A07. Accession BP916163 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916163|Adiantum capill... WD repeat-containing protei... 34 0.20 sp|O74419|YQ52_SCHPO Uncharacterized protein C16

  8. AcEST: BP916162 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_A06 417 Adiantum capillus-veneris mRNA. clone: YMU001_000084_A06. BP91616...2 CL1085Contig1 Show BP916162 Clone id YMU001_000084_A06 Library YMU01 Length 417 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000084_A06. Accession BP916162 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP916162|Adiantum capillus-veneris mRNA, clone...DNA-binding protein 1... 60 3e-09 sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-

  9. AcEST: BP916816 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000092_A01 509 Adiantum capillus-veneris mRNA. clone: YMU001_000092_A01. BP916816... CL1932Contig1 Show BP916816 Clone id YMU001_000092_A01 Library YMU01 Length 509 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000092_A01. Accession BP916816 Tissue type prothallium Developmental stag...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916816...PSD4_ABIGR Delta-selinene synthase OS=Abies grandis G... 35 0.16 sp|Q8WWX9|SELM_H

  10. AcEST: BP914814 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_B08 487 Adiantum capillus-veneris mRNA. clone: YMU001_000063_B08. BP914814 - Show BP914814...is mRNA. clone: YMU001_000063_B08. Accession BP914814 Tissue type prothallium Developmental stage - Contig I...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914814...|Adiantum capillus-veneris mRNA, clone: YMU001_000063_B08. (487 letters) Database: uniprot_sprot.f...-trehalose-phosphate sy... 60 7e-15 sp|O14081|TPSX_SCHPO Putative alpha,alpha-trehalose-phosphate sy... 79 1e-14

  11. AcEST: BP914014 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_H06 438 Adiantum capillus-veneris mRNA. clone: YMU001_000038_H06. BP914014 - Show BP914014...is mRNA. clone: YMU001_000038_H06. Accession BP914014 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914014|Adiantum ...sprot.fasta 412,525 sequences; 148,809,765 total letters Searching.............................................ed protein C17orf74 OS=Homo s... 32 0.76 sp|O14255|GCS1_SCHPO Probable mannosyl-oligosaccharide glucosida...

  12. AcEST: BP917173 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_B11 482 Adiantum capillus-veneris mRNA. clone: YMU001_000097_B11. BP91717...3 CL2027Contig1 Show BP917173 Clone id YMU001_000097_B11 Library YMU01 Length 482 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000097_B11. Accession BP917173 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91717...GVYGIIMAGWASNS 144 >sp|Q2RU33|NUOH_RHORT NADH-quinone oxidoreductase subunit H OS=Rhodospirillum rubrum (strain ATCC 1117

  13. AcEST: BP911818 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_E07 537 Adiantum capillus-veneris mRNA. clone: YMU001_000009_E07. BP911818... CL3769Contig1 Show BP911818 Clone id YMU001_000009_E07 Library YMU01 Length 537 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000009_E07. Accession BP911818 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911818|Adiantum c...MQ1|PP376_ARATH Pentatricopeptide repeat-containing protei... 47 6e-05 sp|Q9SFV9|PP218_ARATH Pentatricopepti

  14. Regulation and function of transaldolase isoenzymes involved in sugar and one-carbon metabolism in the ribulose monophosphate cycle methylotroph Arthrobacter P1

    NARCIS (Netherlands)

    Levering, P.R.; Dijkhuizen, Lubbert

    1986-01-01

    In the facultative methylotroph Arthrobacter P1 the enzyme transaldolase plays an important role in both the pentose phosphate pathway and in the ribulose monophosphate cycle of formaldehyde fixation. Among gluconate-negative mutants of Arthrobacter P1 strains occurred which also were unable to grow

  15. Impact of phenolic substrate and growth temperature on the arthrobacter chlorophenolicus proteome

    Energy Technology Data Exchange (ETDEWEB)

    Unell, Maria; Abraham, Paul E.; Shah, Manesh; Zhang, Bing; Ruckert, Christian; VerBerkmoes, Nathan C.; Jansson, Janet K.

    2009-02-15

    We compared the Arthrobacter chlorophenolicus proteome during growth on 4-chlorophenol, 4-nitrophenol or phenol at 5 C and 28 C; both for the wild type and a mutant strain with mass spectrometry based proteomics. A label free workflow employing spectral counting identified 3749 proteins across all growth conditions, representing over 70% of the predicted genome and 739 of these proteins form the core proteome. Statistically significant differences were found in the proteomes of cells grown under different conditions including differentiation of hundreds of unknown proteins. The 4-chlorophenol-degradation pathway was confirmed, but not that for phenol.

  16. 6-hydroxy-L-nicotine from Arthrobacter nicotinovorans facilitate spatial memory formation in rats

    OpenAIRE

    Lucian Hritcu; Marius Stefan; Marius Mihasan; Roderich Brandsch

    2010-01-01

    Effects of 6-hydroxy-L-nicotine derived from nicotine catabolism in Arthrobacter nicotinovorans on learning and memory processes were examined in adult male Wistar rats. 6-hydroxy-L-nicotine (0.3 mg/kg, i.p., 7 consecutive days chronic administration) significantly increased spontaneous alternation in Y-maze task and working memory in radial arm-maze task, suggesting effects on short-term memory, without affecting long-term memory, explored by reference memory in radial arm-maze t...

  17. Accumulation of rare earth elements by siderophore-forming Arthrobacter luteolus isolated from rare earth environment of Chavara, India

    Indian Academy of Sciences (India)

    E S Challaraj Emmanuel; T Ananthi; B Anandkumar; S Maruthamuthu

    2012-03-01

    In this study, Arthrobacter luteolus, isolated from rare earth environment of Chavara (Quilon district, Kerala, India), were found to produce catechol-type siderophores. The bacterial strain accumulated rare earth elements such as samarium and scandium. The siderophores may play a role in the accumulation of rare earth elements. Catecholate siderophore and low-molecular-weight organic acids were found to be present in experiments with Arthrobacter luteolus. The influence of siderophore on the accumulation of rare earth elements by bacteria has been extensively discussed.

  18. AcEST: BP920177 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A01 507 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A01. BP92017...7 CL2817Contig1 Show BP920177 Clone id YMU001_000134_A01 Library YMU01 Length 507 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_A01. Accession BP920177 Tissue type prothallium Developmental stag...Nucleic Acids Res. 25:3389-3402. Query= BP920177|Adiantum capillus-veneris mRNA, clone: YMU001_000134_A01. (...ynthase component 1 OS=Aquife... 132 7e-31 sp|P05378|TRPE_THET8 Anthranilate synthase component 1 OS=Thermu... 131 2e-30 sp|P2017

  19. AcEST: BP913136 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000026_H04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000026_H04. BP913136 - Show BP91313...is mRNA. clone: YMU001_000026_H04. Accession BP913136 Tissue type prothallium Developmental stage - Contig I...y search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id P23913... Definition sp|P23913|LBR_CHICK Lamin-B receptor OS=Gallus gallus Align length 37 Score (b...es. 25:3389-3402. Query= BP913136|Adiantum capillus-veneris mRNA, clone: YMU001_000026_H04. (562 letters) Da

  20. AcEST: BP913132 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000026_G12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000026_G12. BP913132 - Show BP91313...is mRNA. clone: YMU001_000026_G12. Accession BP913132 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP913132|Adiantum capillus-veneris mRNA, c...T-----GLADRWVIMGPGYNGEIKQGTAGETWCYPNSPVSGEIPTLS 113 >sp|Q08676|AERA_AERSA Aerolysin OS=Aeromonas salmonicida...TAGETWCYPNSPVSGEIPTLS 114 >sp|Q54DK4|AK1_DICDI Alpha-protein kinase 1 OS=Dictyostelium discoideum GN=ak1 PE=3 SV=1 Length = 13

  1. AcEST: BP915015 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_E05 538 Adiantum capillus-veneris mRNA. clone: YMU001_000065_E05. BP915015... CL1326Contig1 Show BP915015 Clone id YMU001_000065_E05 Library YMU01 Length 538 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000065_E05. Accession BP915015 Tissue type prothallium Developmental stag... sp_hit_id Q7G192 Definition sp|Q7G192|ALDO2_ARATH Aldehyde oxidase 2 OS=Arabidopsis thaliana Align length 15...Nucleic Acids Res. 25:3389-3402. Query= BP915015|Adiantum capillus-veneris mRNA, clone: YMU001_000065_E05. (

  2. AcEST: BP915415 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_C09 325 Adiantum capillus-veneris mRNA. clone: YMU001_000071_C09. BP915415 - Show BP915415...is mRNA. clone: YMU001_000071_C09. Accession BP915415 Tissue type prothallium Developmental stage - Contig I...997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2...5:3389-3402. Query= BP915415|Adiantum capillus-veneris mRNA, clone: YMU001_000071_C09. (325 letters) Databas...hatase OS=Shewanella ha... 33 0.44 sp|A8H157|UPPP_SHEPA Undecaprenyl-diphosphatase OS=Shewanella pe... 33 0.57 sp|Q15

  3. AcEST: BP915153 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B05 590 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B05. BP91515...3 CL2049Contig1 Show BP915153 Clone id YMU001_000067_B05 Library YMU01 Length 590 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000067_B05. Accession BP915153 Tissue type prothallium Developmental stag...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915153|... OS=C... 30 6.9 sp|P48656|NU5M_HORSE NADH-ubiquinone oxidoreductase chain 5 OS=E... 30 9.0 sp|P15173|MYOG_HU

  4. AcEST: BP912432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_E02 526 Adiantum capillus-veneris mRNA. clone: YMU001_000019_E02. BP912432 - Show BP912432...is mRNA. clone: YMU001_000019_E02. Accession BP912432 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912432...2|DEGP7_ARATH Protease Do-like 7 OS=Arabidopsis thaliana... 272 6e-73 sp|O74325|YH05_SCHPO PDZ domain-contai...KSIDSRTDKPKAVHIPRGTL 267 >sp|O74325|YH05_SCHPO PDZ domain-containing protein C1685.05 OS=Schizosaccharomyces

  5. AcEST: BP916220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_F11 460 Adiantum capillus-veneris mRNA. clone: YMU001_000084_F11. BP916220... CL2658Contig1 Show BP916220 Clone id YMU001_000084_F11 Library YMU01 Length 460 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000084_F11. Accession BP916220 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916220|Adiantum ... half LIM domains protein 3 OS=Bo... 36 0.091 sp|Q00PK1|TES_ATEAB Testin OS=Atelerix albiventris GN=TES PE=3 SV=1 35 0.16 sp|P22220

  6. AcEST: BP914220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000056_D11 584 Adiantum capillus-veneris mRNA. clone: YMU001_000056_D11. BP914220... CL836Contig1 Show BP914220 Clone id YMU001_000056_D11 Library YMU01 Length 584 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000056_D11. Accession BP914220 Tissue type prothallium Developmental stage...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914220|Adiantum capil....7 sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculu... 30 6.7 sp|P22059|OSBP1_HUMAN Oxystero

  7. AcEST: BP916165 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_A09 498 Adiantum capillus-veneris mRNA. clone: YMU001_000084_A09. BP916165 - Show BP91616...is mRNA. clone: YMU001_000084_A09. Accession BP916165 Tissue type prothallium Developmental stage - Contig I...omo sapiens Align length 165 Score (bit) 40.4 E-value 0.005 Report BLASTX 2.2.19 [Nov-02-2008] Reference: Al...eic Acids Res. 25:3389-3402. Query= BP916165|Adiantum capillus-veneris mRNA, clon...sx2-interacting protein OS=Mus musculus GN... 33 0.95 sp|P16150|LEUK_HUMAN Leukosialin OS=Homo sapiens GN=SP

  8. AcEST: BP914214 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000056_D04 404 Adiantum capillus-veneris mRNA. clone: YMU001_000056_D04. BP914214 - Show BP914214...is mRNA. clone: YMU001_000056_D04. Accession BP914214 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914214|Adiantum capillus-ven...eris mRNA, clone: YMU001_000056_D04. (388 letters) Database: uniprot_sprot.fasta 412,525 sequences; 14...l cation channel ... 29 8.4 sp|Q91WD2|TRPV6_MOUSE Transient receptor potential cation channe... 29 8.4 sp|P14

  9. AcEST: BP917917 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000107_C09 386 Adiantum capillus-veneris mRNA. clone: YMU001_000107_C09. BP917917... CL9Contig1 Show BP917917 Clone id YMU001_000107_C09 Library YMU01 Length 386 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000107_C09. Accession BP917917 Tissue type prothallium Developmental stage -...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917917|Adiantum capillus-veneris mR...1-alpha OS=Pisum sativum PE... 190 2e-48 sp|Q41803|EF1A_MAIZE Elongation factor 1-alpha OS=Zea mays GN=EF... 190 2e-48 sp|P17

  10. AcEST: BP917617 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000103_C03 527 Adiantum capillus-veneris mRNA. clone: YMU001_000103_C03. BP917617 - Show BP917617...is mRNA. clone: YMU001_000103_C03. Accession BP917617 Tissue type prothallium Developmental stage - Contig I...323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster Align leng..., Nucleic Acids Res. 25:3389-3402. Query= BP917617|Adiantum capillus-veneris mRNA, clone: YMU001_000103_C03....eukemia... 31 2.9 sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (... 31 2.9 sp|P317

  11. AcEST: BP918183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E04 482 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E04. BP918183 - Show BP91818...is mRNA. clone: YMU001_000110_E04. Accession BP918183 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP918183|Adiantum capillus-veneris mRNA, clone: ...5RBR7|LYPA1_PONAB Acyl-protein thioesterase 1 OS=Pongo abeli... 35 0.18 sp|O75608|LYPA1_HUMAN Acyl-protein t...hioesterase 1 OS=Homo sapien... 35 0.18 sp|Q750X7|APTH1_ASHGO Acyl-protein thioesterase 1 OS=Ashbya goss... 35 0.18

  12. AcEST: BP918018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP918018...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM..._ARATH Probable alpha,alpha-trehalose-phosphate sy... 190 3e-48 sp|Q9LRA7|TPS9_ARATH Probable alpha,alpha-tr...ehalose-phosphate sy... 189 3e-48 sp|Q0WUI9|TPS8_ARATH Probable alpha,alpha-trehalose-phosphate sy... 18

  13. AcEST: BP921111 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000145_G08 481 Adiantum capillus-veneris mRNA. clone: YMU001_000145_G08. BP921111... CL446Contig1 Show BP921111 Clone id YMU001_000145_G08 Library YMU01 Length 481 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000145_G08. Accession BP921111 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921111...V=4 32 1.9 sp|Q6NUV0|RB3GP_DANRE Rab3 GTPase-activating protein catalytic s... 32 1.9 sp|Q3E8Y7|FK114_ARATH

  14. Transcriptional profiling of Gram-positive Arthrobacter in the phyllosphere: induction of pollutant degradation genes by natural plant phenolic compounds

    NARCIS (Netherlands)

    Scheublin, T.R.; Deusch, S.; Moreno-Forero, S.K.; Müller, J.A.; van der Meer, J.R.; Leveau, J.H.J.

    2014-01-01

    Arthrobacter chlorophenolicus A6 is a Gram-positive, 4-chlorophenol degrading soil bacterium that was recently shown to be an effective colonizer of plant leaf surfaces. The genetic basis for this phyllosphere competency is unknown. In this paper, we describe the genome-wide expression profile of A.

  15. Nitrogen metabolism in the facultative methylotroph Arthrobacter P1 grown with various amines or ammonia as nitrogen sources

    NARCIS (Netherlands)

    de Boer, L.; Brouwer, J.W.; Hassel, C.W. van; Levering, Pieter; Dijkhuizen, L.

    1989-01-01

    The metabolism of trimethylamine (TMA) and dimethylamine (DMA) in Arthrobacter P1 involved the enzymes TMA monooxygenase and trimethylamine-N-oxide (TMA-NO) demethylase, and DMA monooxygenase, respectively. The methylamine and formaldehyde produced were further metabolized via a primary amine oxidas

  16. Class 1 integrons and tetracycline resistance genes in Alcaligenes, Arthrobacter, and Pseudomonas spp. isolated from pigsties and manured soil

    DEFF Research Database (Denmark)

    Agersø, Yvonne; Sandvang, Dorthe

    2005-01-01

    Escherichia coli, Enterobacter spp., Arthrobacter spp., Alcaligenes spp., Pseudomonas spp., and Corynebacterium glutamicum. The 257 isolates were screened for in-1. Eighty-one of the gram-negative isolates were also screened for the Tc-r genes tet(A), tet(B), and tet(C), and all (n = 72) gram...

  17. AcEST: BP912053 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E04 538 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E04. BP912053 - Show BP9120...is mRNA. clone: YMU001_000012_E04. Accession BP912053 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...IMDELFQDR 188 >sp|A7MTT7|SURE_VIBHB 5'-nucleotidase surE OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912053|Adiantum capillus-veneris m

  18. AcEST: BP919488 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9488 - Show BP919488 Clone id YMU001_000125_F07 Library YMU01 Length 93 Definition Adiantum capillus-veneris...iss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - ...nce too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  19. AcEST: BP921019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1019 - Show BP921019 Clone id YMU001_000144_F01 Library YMU01 Length 95 Definition Adiantum capillus-veneris...Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value ...uence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  20. AcEST: BP920885 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0885 - Show BP920885 Clone id YMU001_000143_A01 Library YMU01 Length 93 Definition Adiantum capillus-veneris...iss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - ...nce too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  1. AcEST: BP917598 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7598 - Show BP917598 Clone id YMU001_000102_H07 Library YMU01 Length 98 Definition Adiantum capillus-veneris... : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-val...Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  2. AcEST: BP915869 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5869 - Show BP915869 Clone id YMU001_000078_G08 Library YMU01 Length 92 Definition Adiantum capillus-veneris...ss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - R...ce too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  3. AcEST: BP915154 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B07 539 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B07. BP91515...4 CL2743Contig1 Show BP915154 Clone id YMU001_000067_B07 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000067_B07. Accession BP915154 Tissue type prothallium Developmental stag...y search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id P9815...8 Definition sp|P98158|LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattu

  4. AcEST: BP921616 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000152_B08 522 Adiantum capillus-veneris mRNA. clone: YMU001_000152_B08. BP921616... CL689Contig1 Show BP921616 Clone id YMU001_000152_B08 Library YMU01 Length 522 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000152_B08. Accession BP921616 Tissue type prothallium Developmental stage... - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id O28640 Definition sp|O28640|Y16...33_ARCFU Uncharacterized protein AF_1633 OS=Archaeoglobus fulgidus Align length 33 S

  5. Cloning of rat sp56, the homologue of mouse sperm ZP3 receptor-sp56

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    Mouse sp56 is considered as one of the candidates for mouse zona pellucida 3 (mZP3) receptor. Up to date, its homologue has only been cloned from guinea pig, namely AM67. Based on the cDNA sequence of mouse sp56, we designed a pair of primer to amplify its homologue from rat testis cDNA. Using RT-PCR,two fragments of 743 bp and 938 bp were amplified. The PCR products show very high homology to mouse sp56. However, the 743 bp product completely lacks one of the seven Sushi domains of mouse sp56. Using the 743 bp product as the probe to detect the expression profile of sp56 in rat tissues, Northern blot shows that a ~2.0 kb mRNA expresses specifically in testis. Employed the RACE method, two full cDNA sequences of rat sp56 were obtained. A Mr ~42 KD band was detected in denatured and non-reducing protein sample of rat testis and sperm with anti-mouse sp56 monoclonal antibody by Western blot method. Rat sp56was localized on rat sperm head by the indirect immunofiuorescence method. Rat sp56 immunoreactivitywas detected from the early pachytene spermatocytes and throughout the spermatogenesis. Its cloning willfurther our understanding of the mechanism of the sperm-egg recognition and binding.

  6. AcEST: BP921212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29

  7. AcEST: BP912127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi

  8. AcEST: BP920209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_C12 539 Adiantum capillus-veneris mRNA. clone: YMU001_000134_C12. BP920209 - Show BP92020...is mRNA. clone: YMU001_000134_C12. Accession BP920209 Tissue type prothallium Developmental stage - Contig I...ATCC 700264) Align length 82 Score (bit) 35.4 E-value 0.18 Report BLASTX 2.2.19 [Nov-02-2008] Reference: Alt...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920209|Adiantum capillus-veneris mRNA, clone...LVAB Tyrosine-protein kinase transforming protein... 32 1.5 sp|P00520|ABL1_MOUSE

  9. AcEST: BP920200 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_C02 274 Adiantum capillus-veneris mRNA. clone: YMU001_000134_C02. BP920200 - Show BP92020...is mRNA. clone: YMU001_000134_C02. Accession BP920200 Tissue type prothallium Developmental stage - Contig I... Score (bit) 116.0 E-value 3.0e-26 Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thoma...cleic Acids Res. 25:3389-3402. Query= BP920200|Adiantum capillus-veneris mRNA, clone: YMU001_000134_C02. (27...satchenk... 31 2.2 sp|Q9V773|C6A20_DROME Probable cytochrome P450 6a20 OS=Drosoph

  10. AcEST: BP915005 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D06 524 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D06. BP91500...5 CL1952Contig1 Show BP915005 Clone id YMU001_000065_D06 Library YMU01 Length 524 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000065_D06. Accession BP915005 Tissue type prothallium Developmental stag...ids Res. 25:3389-3402. Query= BP915005|Adiantum capillus-veneris mRNA, clone: YMU001_000065_D06. (524 letter...39_HUMAN Solute carrier family 25 member 39 OS=Homo... 42 0.002 sp|P23500|MRS4_YEAST Mitochondrial RNA-splic

  11. AcEST: BP914343 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_H02 543 Adiantum capillus-veneris mRNA. clone: YMU001_000057_H02. BP914343 - Show BP914343... Clone id YMU001_000057_H02 Library YMU01 Length 543 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000057_H02. Accession BP914343 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP914343|Adiantum capillus-veneris mRNA, clone: YMU001_000057_H02. (543 lette..._RAT von Willebrand factor (Fragment) OS=Rattus nor... 31 3.4 sp|P14300|DRAG_RHORU ADP-ribosyl-[dinitrogen r

  12. AcEST: BP918384 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_H04 262 Adiantum capillus-veneris mRNA. clone: YMU001_000112_H04. BP9183...84 CL2272Contig1 Show BP918384 Clone id YMU001_000112_H04 Library YMU01 Length 262 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_H04. Accession BP918384 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918384|Adiantum capill...main-containing protein 9 ho... 49 8e-06 sp|Q11183|TXND9_CAEEL Thioredoxin domain-containing protein 9 ho...

  13. AcEST: BP912085 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_H06 509 Adiantum capillus-veneris mRNA. clone: YMU001_000012_H06. BP9120...85 CL1352Contig1 Show BP912085 Clone id YMU001_000012_H06 Library YMU01 Length 509 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_H06. Accession BP912085 Tissue type prothallium Developmental stag...eic Acids Res. 25:3389-3402. Query= BP912085|Adiantum capillus-veneris mRNA, clone: YMU001_000012_H06. (509 ...HZ4|PSBH_PSINU Photosystem II reaction center protein H OS... 120 3e-27 sp|P12160|PSBH_MARPO Photosystem II

  14. AcEST: BP912045 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_D08 401 Adiantum capillus-veneris mRNA. clone: YMU001_000012_D08. BP9120...45 CL1754Contig1 Show BP912045 Clone id YMU001_000012_D08 Library YMU01 Length 401 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_D08. Accession BP912045 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...VADFGL 738 >sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Length = 1207 Score

  15. AcEST: BP915157 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B10. BP91515...7 CL3629Contig1 Show BP915157 Clone id YMU001_000067_B10 Library YMU01 Length 454 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000067_B10. Accession BP915157 Tissue type prothallium Developmental stag...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915157|Adiantum capill...-containing protein C14orf14... 37 0.051 sp|Q9BUY7|CN143_HUMAN EF-hand domain-containing protein C14orf14... 35 0.15

  16. AcEST: BP921515 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000150_H04 509 Adiantum capillus-veneris mRNA. clone: YMU001_000150_H04. BP921515... CL3363Contig1 Show BP921515 Clone id YMU001_000150_H04 Library YMU01 Length 509 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000150_H04. Accession BP921515 Tissue type prothallium Developmental stag...Res. 25:3389-3402. Query= BP921515|Adiantum capillus-veneris mRNA, clone: YMU001_000150_H04. (509 letters) D...DKIVYI 164 + K++ PT K+++V + Sbjct: 150 VGKQL------PTAKEEVVKV 164 >sp|Q8YV98|PYRR_

  17. AcEST: BP915151 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B03 607 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B03. BP91515...1 CL558Contig1 Show BP915151 Clone id YMU001_000067_B03 Library YMU01 Length 607 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000067_B03. Accession BP915151 Tissue type prothallium Developmental stage...cleic Acids Res. 25:3389-3402. Query= BP915151|Adiantum capillus-veneris mRNA, clone: YMU001_000067_B03. (60...nsposon Ty1-LR4 Gag-Pol polyprotein OS=... 58 3e-08 sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polypro

  18. AcEST: BP915115 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000066_F08 144 Adiantum capillus-veneris mRNA. clone: YMU001_000066_F08. BP915115... CL114Contig1 Show BP915115 Clone id YMU001_000066_F08 Library YMU01 Length 144 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000066_F08. Accession BP915115 Tissue type prothallium Developmental stage...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915115|Adiantum capillus-veneris ...p|Q00827|CB48_MAIZE Chlorophyll a-b binding protein 48, chlorop... 69 9e-12 sp|P15194|CB2B_PINSY Chlorophyll

  19. AcEST: BP916216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_F06 331 Adiantum capillus-veneris mRNA. clone: YMU001_000084_F06. BP916216... CL801Contig1 Show BP916216 Clone id YMU001_000084_F06 Library YMU01 Length 331 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000084_F06. Accession BP916216 Tissue type prothallium Developmental stage...cleic Acids Res. 25:3389-3402. Query= BP916216|Adiantum capillus-veneris mRNA, clone: YMU001_000084_F06. (33...=Emericella nidulans GN=hir1... 40 0.003 sp|Q0VA16|WDR70_XENTR WD repeat-containing protein 70 OS=Xenopus...

  20. AcEST: BP914140 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D03 527 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D03. BP914140 - Show BP91414...is mRNA. clone: YMU001_000042_D03. Accession BP914140 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91414...0|Adiantum capillus-veneris mRNA, clone: YMU001_000042_D03. (527 letters) Database: uniprot_sprot.fasta 412,525 sequences; 14...ein DLN-1 OS=Homo sapiens GN=C10orf140 ... 34 0.49 sp|Q6DE84|MAFB_XENLA Transcription factor MafB OS=Xenopus

  1. AcEST: BP914514 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_G04 533 Adiantum capillus-veneris mRNA. clone: YMU001_000059_G04. BP914514 - Show BP914514...is mRNA. clone: YMU001_000059_G04. Accession BP914514 Tissue type prothallium Developmental stage - Contig I...sp|P29251|FOL1_PNECA Folic acid synthesis protein fol1 OS=Pneumocystis carinii Align length 171 Score (bit) 14...es. 25:3389-3402. Query= BP914514|Adiantum capillus-veneris mRNA, clone: YMU001_000059_G04. (533 letters) Da...tabase: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching..........................

  2. AcEST: BP914142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D05 344 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D05. BP914142 - Show BP91414...is mRNA. clone: YMU001_000042_D05. Accession BP914142 Tissue type prothallium Developmental stage - Contig I...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91414..._sprot.fasta 412,525 sequences; 148,809,765 total letters Searching.................ein OS=Pan troglodytes GN... 30 2.9 sp|O14594|NCAN_HUMAN Neurocan core protein OS=Homo sapiens GN=NC... 30 2

  3. AcEST: BP914141 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D04 288 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D04. BP914141 - Show BP91414...is mRNA. clone: YMU001_000042_D04. Accession BP914141 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914141|Adiantum ...capillus-veneris mRNA, clone: YMU001_000042_D04. (264 letters) Database: uniprot_sprot.fasta 412,525 sequences; 14... subunit beta, chloroplastic OS... 106 4e-23 sp|P62614|ATPB_AEGCR ATP synthase subunit beta, chloroplastic O

  4. AcEST: BP911717 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000008_D01 438 Adiantum capillus-veneris mRNA. clone: YMU001_000008_D01. BP911717... CL1298Contig1 Show BP911717 Clone id YMU001_000008_D01 Library YMU01 Length 438 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000008_D01. Accession BP911717 Tissue type prothallium Developmental stag...cleic Acids Res. 25:3389-3402. Query= BP911717|Adiantum capillus-veneris mRNA, cl...|ZSC29_HUMAN Zinc finger and SCAN domain-containing pro... 35 0.14 sp|P17040|ZSC20_HUMAN Zinc finger and SCA

  5. AcEST: BP917717 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000104_E10 488 Adiantum capillus-veneris mRNA. clone: YMU001_000104_E10. BP917717... CL2233Contig1 Show BP917717 Clone id YMU001_000104_E10 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000104_E10. Accession BP917717 Tissue type prothallium Developmental stag...es. 25:3389-3402. Query= BP917717|Adiantum capillus-veneris mRNA, clone: YMU001_000104_E10. (488 letters) Da...RATH Pentatricopeptide repeat-containing protei... 110 4e-24 sp|O81767|PP348_ARATH Pentatricopeptide repeat-

  6. AcEST: BP917171 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_B09 441 Adiantum capillus-veneris mRNA. clone: YMU001_000097_B09. BP91717...1 CL1480Contig1 Show BP917171 Clone id YMU001_000097_B09 Library YMU01 Length 441 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000097_B09. Accession BP917171 Tissue type prothallium Developmental stag...leic Acids Res. 25:3389-3402. Query= BP917171|Adiantum capillus-veneris mRNA, clo...G 211 >sp|Q03376|BAR3_CHITE Balbiani ring protein 3 OS=Chironomus tentans GN=BR3 PE=2 SV=1 Length = 17

  7. AcEST: BP913232 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_A01 482 Adiantum capillus-veneris mRNA. clone: YMU001_000028_A01. BP913232... CL155Contig1 Show BP913232 Clone id YMU001_000028_A01 Library YMU01 Length 482 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000028_A01. Accession BP913232 Tissue type prothallium Developmental stage...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913232|... Coiled-coil domain-containing protein 61 O... 34 0.40 sp|Q5KJI2|DHH1_CRYNE ATP-dependent RNA helicase DHH1 OS=Cryptoco... 32

  8. AcEST: BP918180 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E01 492 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E01. BP91818...0 CL642Contig1 Show BP918180 Clone id YMU001_000110_E01 Library YMU01 Length 492 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000110_E01. Accession BP918180 Tissue type prothallium Developmental stage... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918180|Adiantum capil...otein OS=Bos taurus GN=RRP15 ... 35 0.24 sp|Q8TFG4|YL54_SCHPO Uncharacterized protein PB18E9.04c OS=Schiz...

  9. AcEST: BP918918 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000119_A05 543 Adiantum capillus-veneris mRNA. clone: YMU001_000119_A05. BP918918 - Show BP918918...is mRNA. clone: YMU001_000119_A05. Accession BP918918 Tissue type prothallium Developmental stage - Contig I...Definition sp|A8ERT9|SYP_ARCB4 Prolyl-tRNA synthetase OS=Arcobacter butzleri (strain RM4018) Align length 62...c Acids Res. 25:3389-3402. Query= BP918918|Adiantum capillus-veneris mRNA, clone: YMU001_000119_A05. (543 le...nthetase OS=Arcobacter butzleri (strain RM4018) GN=proS PE=3 SV=1 Length = 568 Score = 35.8 bits (81), Expec

  10. AcEST: BP918618 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000115_E11 490 Adiantum capillus-veneris mRNA. clone: YMU001_000115_E11. BP918618... CL3774Contig1 Show BP918618 Clone id YMU001_000115_E11 Library YMU01 Length 490 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000115_E11. Accession BP918618 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918618...6WRL0|Y3322_SHEB8 UPF0250 protein Shew185_3322 OS=Shewanella... 32 1.6 sp|A3D7P7|

  11. Effects of two kinds of imidazolium-based ionic liquids on the characteristics of steroid-transformation Arthrobacter simplex

    OpenAIRE

    Shen, Yanbing; Wang, Lifang; Liang, Jingting; Rui TANG; WANG, Min

    2016-01-01

    Background Ionic liquids (ILs) are a promising alternative for organic solvents because these liquids exhibit unique properties and enhanced steroid 1-dehydrogenation biotransformation caused by Arthrobacter simplex CPCC 140451 (ASP). However, the effect of ILs on the whole cell itself remains poorly understood and must be further investigated. Results A comparative investigation was performed to determine the effect of imidazolium-based ILs, namely, hydrophobic [PrMIm]PF6, and hydrophilic [P...

  12. Adenylate nucleotide levels and energy charge in Arthrobacter crystallopoietes during growth and starvation.

    Science.gov (United States)

    Leps, W T; Ensign, J C

    1979-07-01

    The adenylate nucleotide concentrations, based on internal water space, were determined in cells of Arthrobacter crystallopoietes during growth and starvation and the energy charge of the cells was calculated. The energy charge of spherical cells rose during the first 10 h of growth, then remained nearly constant for as long as 20 h into the stationary phase. The energy charge of rod-shaped cells rose during the first 4 h of growth, then remained constant during subsequent growth and decreased in the stationary growth phase. Both spherical and rod-shaped cells excreted adenosine monophosphate but not adenosine triphosphate or adenosine diphosphate during starvation. The intracellular energy charge of spherical cells declined during the initial 10 h and then remained constant for 1 week of starvation at a value of 0.78. The intracellular energy charge of rod-shaped cells declined during the first 24 h of starvation, remained constant for the next 80 h, then decreased to a value of 0.73 after a total of 168 h starvation. Both cell forms remained more than 90% viable during this time. Addition of a carbon and energy source to starving cells resulted in an increase in the ATP concentration and as a result the energy charge increased to the smae levels as found during growth.

  13. Biodegradation of Benzo[a]pyrene by Arthrobacter oxydans B4

    Institute of Scientific and Technical Information of China (English)

    PENG Hui; YIN Hua; DENG Jun; YE Jin-Shao; CHEN Shuo-Na; HE Bao-Yan; ZHANG Na

    2012-01-01

    A bacterial strain,Arthrobacter oxydans (B4),capable of degrading benzo[a]pyrene (BaP) in water body,was isolated from a polycyclic aromatic hydrocarbons-contaminated site.Effects of different factors,such as reaction time,pH value,temperature and organic nutrients,on BaP biodegradation by the strain B4 were studied.After 5 d treatment,the concentration of BaP in mineral salts medium was reduced to 0.318 mg L-1,compared to the initial concentration of 1.000 mg L-1.There was a process of acid formation during the degradation with pH failing from initial 7.01 to 4.61 at 5 d,so keeping the water body under slightly alkaline condition was propitious to BaP degradation.Strain B4 efficiently degraded BaP at 20 to 37 ℃ with addition of organic nutrients.The biodegradation and transformation of BaP mainly occurred on cell surfaces,and extracellular secretions played an important role in these processes.Fourier transform infrared spectroscopy and gas chromatograph-mass spectrometer analyses of metabolites showed that ring cleavage occurred in the BaP degradation process and the resulting metabolically utilizable substrates were generated as sole carbon sources for B4 growth.Furthermore,mineralization extent of metabolites was verified by determining the total organic carbon and inorganic carbon in the degradation system.

  14. Plasmid-encoded degradation of p-nitrophenol and 4-nitrocatechol by Arthrobacter protophormiae.

    Science.gov (United States)

    Chauhan, A; Chakraborti, A K; Jain, R K

    2000-04-21

    Arthrobacter protophormiae strain RKJ100 is capable of utilizing p-nitrophenol (PNP) as well as 4-nitrocatechol (NC) as the sole source of carbon, nitrogen and energy. The degradation of PNP and NC by this microorganism takes place through an oxidative route, as stoichiometry of nitrite molecules was observed when the strain was grown on PNP or NC as sole carbon and energy sources. The degradative pathways of PNP and NC were elucidated on the basis of enzyme assays and chemical characterization of the intermediates by TLC, GC, (1)H NMR, GC-MS, UV spectroscopy, and HPLC analyses. Our studies clearly indicate that the degradation of PNP proceeds with the formation of p-benzoquinone (BQ) and hydroquinone (HQ) and is further degraded via the beta-ketoadipate pathway. Degradation of NC involved initial oxidation to generate 1,2,4-benzenetriol (BT) and 2-hydroxy-1,4-benzoquinone; the latter intermediate is then reductively dehydroxylated, forming BQ and HQ, and is further cleaved via beta-ketoadipate to TCA intermediates. It is likely, therefore, that the same set of genes encode the further metabolism of HQ in PNP and NC degradation. A plasmid of approximately 65 kb was found to be responsible for harboring genes for PNP and NC degradation in this strain. This was based on the fact that PNP(-) NC(-) derivatives were devoid of the plasmid and had simultaneously lost their capability to grow at the expense of these nitroaromatic compounds.

  15. The Arthrobacter species FB24 Arth_1007 (DnaB intein is a pseudogene.

    Directory of Open Access Journals (Sweden)

    Kazuo Tori

    Full Text Available An Arthrobacter species FB24 gene (locus tag Arth_1007 was previously annotated as a putative intein-containing DnaB helicase of phage origin (Arsp-FB24 DnaB intein. However, it is not a helicase gene because the sequence similarity is limited to inteins. In fact, the flanking exteins total only 66 amino acids. Therefore, the intein should be referred to as the Arsp-FB24 Arth_1007 intein. The Arsp-FB24 Arth_1007 intein failed to splice in its native precursor and in a model precursor. We previously noted that the Arsp-FB24 Arth_1007 intein is the only putative Class 3 intein that is missing the catalytically essential Cys at position 4 of intein Motif F, which is one of the three defining signature residues of this class. Additionally, a catalytically essential His in position 10 of intein Motif B is also absent; this His is the most conserved residue amongst all inteins. Splicing activity was not rescued when these two catalytically important positions were 'reverted' back to their consensus residues. This study restores the unity of the Class 3 intein signature sequence in active inteins by demonstrating that the Arsp-FB24 Arth_1007 intein is an inactive pseudogene.

  16. EST Table: BP116168 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP116168 brP-2100 11/12/09 GO hit GO:0003677(DNA binding)|GO:0003918(DNA topoisomer...ess)|GO:0006265(DNA topological change) 10/09/28 82 %/179 aa ref|NP_001037009.1| DNA topoisomerase 2 [Bombyx mori] sp|O16...A topoisomerase II; Short=TOPOII gb|AAB67168.1| topoisomerase II [Bombyx mori] 10/08/28 48 %/181 aa FBpp0144...09/10 56 %/134 aa gi|91079588|ref|XP_967653.1| PREDICTED: similar to topoisomerase II [Tribolium castaneum] BP116168 brP- ...

  17. AcEST: BP918019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8019 - Show BP918019 Clone id YMU001_000108_F08 Library YMU01 Length 47 Definition Adiantum capillus-veneris...lts ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition...esult : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  18. AcEST: BP915821 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5821 - Show BP915821 Clone id YMU001_000077_D11 Library YMU01 Length 85 Definition Adiantum capillus-veneris... (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report -... TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Defin...ition - Align length - Score (bit) - E-value - Report - ...

  19. AcEST: BP916142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6142 - Show BP916142 Clone id YMU001_000083_F05 Library YMU01 Length 74 Definition Adiantum capillus-veneris...op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (re...lease 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  20. AcEST: BP915714 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5714 - Show BP915714 Clone id YMU001_000074_H09 Library YMU01 Length 82 Definition Adiantum capillus-veneris...o blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - Tr...EMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definiti...on - Align length - Score (bit) - E-value - Report - ...

  1. AcEST: BP915738 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5738 - Show BP915738 Clone id YMU001_000076_C06 Library YMU01 Length 35 Definition Adiantum capillus-veneris...ss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition...BL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  2. AcEST: BP914811 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4811 - Show BP914811 Clone id YMU001_000063_B05 Library YMU01 Length 86 Definition Adiantum capillus-veneris...t (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report ...nition - Align length - Score (bit) - E-value - Report - ... ...- TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Defi

  3. AcEST: BP913510 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3510 - Show BP913510 Clone id YMU001_000031_A07 Library YMU01 Length 63 Definition Adiantum capillus-veneris...e too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9)... Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  4. AcEST: BP914478 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4478 - Show BP914478 Clone id YMU001_000059_D03 Library YMU01 Length 21 Definition Adiantum capillus-veneris...se 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Alig...p. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  5. AcEST: BP913029 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3029 - Show BP913029 Clone id YMU001_000025_F04 Library YMU01 Length 47 Definition Adiantum capillus-veneris...lts ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition...esult : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  6. AcEST: BP914959 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4959 - Show BP914959 Clone id YMU001_000064_H05 Library YMU01 Length 50 Definition Adiantum capillus-veneris...esults ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition...X Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  7. AcEST: BP920339 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0339 - Show BP920339 Clone id YMU001_000135_H11 Library YMU01 Length 86 Definition Adiantum capillus-veneris...t (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report ...nition - Align length - Score (bit) - E-value - Report - ... ...- TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Defi

  8. AcEST: BP912478 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2478 - Show BP912478 Clone id YMU001_000019_H09 Library YMU01 Length 84 Definition Adiantum capillus-veneris...(No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Defini...tion - Align length - Score (bit) - E-value - Report - ...

  9. AcEST: BP913042 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 3042 - Show BP913042 Clone id YMU001_000025_G06 Library YMU01 Length 73 Definition Adiantum capillus-veneris...p. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (rel...ease 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  10. AcEST: BP916851 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6851 - Show BP916851 Clone id YMU001_000092_E12 Library YMU01 Length 83 Definition Adiantum capillus-veneris...No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - T...rEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definit...ion - Align length - Score (bit) - E-value - Report - ...

  11. AcEST: BP917384 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7384 - Show BP917384 Clone id YMU001_000100_B07 Library YMU01 Length 73 Definition Adiantum capillus-veneris...p. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (rel...ease 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  12. AcEST: BP914708 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4708 - Show BP914708 Clone id YMU001_000062_A06 Library YMU01 Length 87 Definition Adiantum capillus-veneris...ot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report...inition - Align length - Score (bit) - E-value - Report - ... ... - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Def

  13. AcEST: BP912333 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 2333 - Show BP912333 Clone id YMU001_000017_H05 Library YMU01 Length 83 Definition Adiantum capillus-veneris...No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - T...rEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definit...ion - Align length - Score (bit) - E-value - Report - ...

  14. AcEST: BP916918 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6918 - Show BP916918 Clone id YMU001_000093_E11 Library YMU01 Length 54 Definition Adiantum capillus-veneris...ch results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definitio...lastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  15. AcEST: BP920443 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0443 - Show BP920443 Clone id YMU001_000137_B08 Library YMU01 Length 75 Definition Adiantum capillus-veneris... op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (r...elease 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  16. AcEST: BP920319 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 0319 - Show BP920319 Clone id YMU001_000135_F08 Library YMU01 Length 41 Definition Adiantum capillus-veneris... - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition...: TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  17. AcEST: BP914899 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4899 - Show BP914899 Clone id YMU001_000064_B07 Library YMU01 Length 79 Definition Adiantum capillus-veneris...last op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMB...L (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  18. AcEST: BP914799 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 4799 - Show BP914799 Clone id YMU001_000063_A05 Library YMU01 Length 88 Definition Adiantum capillus-veneris...rot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Repor...oo short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ... ...t - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence t

  19. EST Table: BP121593 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121593 ceN-5053 10/09/28 94 %/117 aa ref|NP_054119.1| major viral capsid protein ...[Autographa californica nucleopolyhedrovirus] sp|P17499.1|VP39_NPVAC RecName: Full=Major capsid protein gb|A...AA02580.1| capsid protein [Autographa californica nucleopolyhedrovirus] gb|AAA66719.1| major viral capsid pr

  20. AcEST: BP916897 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000093_D01 58 Adiantum capillus-veneris mRNA. clone: YMU001_000093_D01. BP916897 - Show BP916897 Clone id YMU001_000093_D01 Library YMU01 Length 58 Definition Adiantum capillus-veneris mRNA. clone: YMU001_000093_D01. Accession BP916897 Tissue type prothallium Developmental stage - Contig ID - Sequence GCTGCTGATGATGGTGATGGTGCACACTCAATGATCGGTTGGTGGTTTCGACCACCAG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  1. AcEST: BP920902 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000143_B08 46 Adiantum capillus-veneris mRNA. clone: YMU001_000143_B08. BP920902 - Show BP920902 Clone id YMU001_000143_B08 Library YMU01 Length 46 Definition Adiantum capillus-veneris mRNA. clone: YMU001_000143_B08. Accession BP920902 Tissue type prothallium Developmental stage - Contig ID - Sequence AATTTGAGTACTTCCATGTTTGAGGAAGCTGCCACAAAAGATGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  2. AcEST: BP920401 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_F09 31 Adiantum capillus-veneris mRNA. clone: YMU001_000136_F09. BP920401 - Show BP920401 Clone id YMU001_000136_F09 Library YMU01 Length 31 Definition Adiantum capillus-veneris mRNA. clone: YMU001_000136_F09. Accession BP920401 Tissue type prothallium Developmental stage - Contig ID - Sequence ACATGTGCGTGCCCTCCTTCATGCGGAGATC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  3. AcEST: BP920027 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_C01 96 Adiantum capillus-veneris mRNA. clone: YMU001_000132_C01. BP920027 - Show BP920027 Clone id YMU001_000132_C01 Library YMU01 Length 96 Definition Adiantum capillus-veneris mRNA. clone: YMU001_000132_C01. Accession BP920027 Tissue type prothallium Developmental stage - Contig ID - Sequence CACCCATTGTGAAATATAGGGGGTCAACTAATCATTGTGCCTCTAAAGGGTGCTTGTTCC ATATGATAATGTTCATAGTGTCCACAACTTGAATGT ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  4. AcEST: BP920966 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000143_H08 44 Adiantum capillus-veneris mRNA. clone: YMU001_000143_H08. BP920966 - Show BP920966 Clone id YMU001_000143_H08 Library YMU01 Length 44 Definition Adiantum capillus-veneris mRNA. clone: YMU001_000143_H08. Accession BP920966 Tissue type prothallium Developmental stage - Contig ID - Sequence CCAATCTGAGAAAATTCTTCAGCCCAGTTGTCACCACGATGAGC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  5. AcEST: BP917362 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000099_H05 80 Adiantum capillus-veneris mRNA. clone: YMU001_000099_H05. BP917362 - Show BP917362 Clone id YMU001_000099_H05 Library YMU01 Length 80 Definition Adiantum capillus-veneris mRNA. clone: YMU001_000099_H05. Accession BP917362 Tissue type prothallium Developmental stage - Contig ID - Sequence CATGAGGCCATGGATGACAATGCCTGTCTTCCTCTGCTCACCTCCATCCGTCCCTCCCGT TCTCACAAACTCATGGGCAA ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Definition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ...

  6. AcEST: BP911831 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_F10 488 Adiantum capillus-veneris mRNA. clone: YMU001_000009_F10. BP91183...1 CL919Contig1 Show BP911831 Clone id YMU001_000009_F10 Library YMU01 Length 488 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000009_F10. Accession BP911831 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25...SHRGKEFISIYEH 52 >sp|Q4WD95|SEC16_ASPFU COPII coat assembly protein sec16 OS=Aspergillus fumigatus GN=sec16 PE=3 SV=1 Length = 183

  7. Degradation of o-methoxybenzoate by a two-member consortium made up of a gram-positive Arthrobacter strain and a gram-negative Pantotea strain.

    Science.gov (United States)

    Gil, M; Haïdour, A; Ramos, J L

    2000-01-01

    Aromatic carboxylic acids substituted with methoxylated groups are among the most abundant products in "alpechin", the wastes resulting from pressing olives to obtain olive oil. Degradation of o-methoxybenzoate by an stable consortium made of a gram positive bacterium, Arthrobacter oxydans, and gram negative one, Pantotea agglomerans, was shown to mineralize this compound efficiently. The concerted action of both microorganisms was needed for the two first steps in the process, namely, the conversion of o-methoxybenzoate into salycilate, and the hydroxylation of the latter to gentisate. Gentisate was further degraded by the Arthrobacter strain.

  8. Optimization of four types of antimicrobial agents to increase the inhibitory ability of marine Arthrobacter oxydans KQ11 dextranase mouthwash

    Science.gov (United States)

    Ren, Wei; Wang, Shujun; Lü, Mingsheng; Wang, Xiaobei; Fang, Yaowei; Jiao, Yuliang; Hu, Jianen

    2016-03-01

    We adopted the response surface methodology using single factor and orthogonal experiments to optimize four types of antimicrobial agents that could inhibit biofilm formation by Streptococcus mutans, which is commonly found in the human oral cavity and causes tooth decay. The objective was to improve the function of marine Arthrobacter oxydans KQ11 dextranase mouthwash (designed and developed by our laboratory). The experiment was conducted in a three-level, four-variable central composite design to determine the best combination of ZnSO4, lysozyme, citric acid and chitosan. The optimized antibacterial agents were 2.16 g/L ZnSO4, 14 g/L lysozyme, 4.5 g/L citric acid and 5 g/L chitosan. The biofilm formation inhibition reached 84.49%. In addition, microscopic observation of the biofilm was performed using scanning electron microscopy and confocal laser scanning microscopy. The optimized formula was tested in marine dextranase Arthrobacter oxydans KQ11 mouthwash and enhanced the inhibition of S. mutans. This work may be promoted for the design and development of future marine dextranase oral care products.

  9. Arthrobacter P 1, a Fast Growing Versatile Methylotroph with Amine Oxidase as a Key Enzyme in the Metabolism of Methylated Amines

    NARCIS (Netherlands)

    Dijken, J.P. van; Veenhuis, M.; Harder, W.

    1981-01-01

    A facultative methylotrophic bacterium was isolated from enrichment cultures containing methylamine as the sole carbon source. It was tentatively identified as an Arthrobacter species. Extracts of cells grown on methylamine or ethylamine contained high levels of amine oxidase (E.C. 1.4.3) activity.

  10. Physicochemical factors for affecting the efficiency of Arthrobacter chlorophenolicus MN1409 on manganese oxidation%理化因素对锰细菌Arthrobacter chlorophenolicus MN1409氧化Mn2+的影响

    Institute of Scientific and Technical Information of China (English)

    冯福鑫; 王芳; 许旭萍

    2012-01-01

    Arthrobacter chlorophenolicus MN1409是1株分离自锰矿样品的高效锰氧化细菌.为了建立该菌株氧化Mn2+的适宜条件,研究了接种量、装液量、摇床转速、温度、pH值、Fe2+初始质量浓度和Mn2+初始质量浓度等理化因素对其锰氧化效率的影响.结果表明,接种量、装液量、转速和Mn2+初始质量浓度在一定范围内变化对锰氧化率影响不大;而温度、pH值和Fe2+初始质量浓度变化对锰氧化率有较大影响.当接种量为4%,装液量为60mL,温度为25℃,摇床转速为100r/min,pH值为7,且有一定的Fe2+存在时,Arthrobacter chlorophenolicus MN1409对锰的氧化效率最高.%The physicochemical factors for affecting the manganese oxidation efficiency of an manganese oxidizing bacteria named Arthrobacter chlorophennlicus MN1409 which was isolated from manganese ore sample were studied. The identified factors include inoculum volume, liquid volume, temperature, shaking speed, pH as well as the concentration of Fe2+ and Mn2+ . The results showed that there was no significant effect on the biological manganese oxidation rate and chemical manganese oxidation rate during 2% - 10% inoculum volumes. 4% inoculum volume was the optimum condition according to its highest total manganese oxidation rate. Similarly, biological and chemical manganese oxidation rale have no significant difference for the liquid volume ranging from 50 mL to 100 mL in 250 mL triangular flask , the highest total manganese oxidation rate occurred in 60 mL liquid volume. Nevertheless, temperature showed an positive effect on manganese oxidation rate. By increasing the temperature from 15 ℃ to 35 ℃, highest biological and chemical manganese oxidation rate could be reached at 25 ℃ and 35 ℃ , respectively, plus the total oxidation rate could achieved 81.52% as well in 35 ℃ . In addition, the effect of shaker speed on manganese oxidation efficiency (MOE) showed that the oxidation rates were similar for

  11. Screening micro-organisms for cadmium absorption from aqueous solution and cadmium absorption properties of Arthrobacter nicotianae.

    Science.gov (United States)

    Tsuruta, Takehiko; Umenai, Daishi; Hatano, Tomonobu; Hirajima, Tsuyoshi; Sasaki, Keiko

    2014-01-01

    To obtain basic information on how microbial cells absorb cadmium from aqueous solution, we examined cadmium absorption in various micro-organisms. Of 51 micro-organism strains tested, we found that some Gram-positive bacteria, such as, Arthrobacter nicotianae and Bacillus subtilis, and some actinomycetes, such as, Streptomyces flavoviridis and S. levoris were highly capable of absorbing cadmium from an aqueous solution. A. nicotianae absorbed the largest amount of cadmium, over 800 μmol cadmium per gram of dry wt. cells. However, cadmium absorption by A. nicotianae was affected by the solution pH, cadmium concentration, and cell density. The absorption of cadmium was very rapid. Some factors that affected cadmium absorption by A. nicotianae cells were also discussed.

  12. AcEST: BP917487 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 7487 - Show BP917487 Clone id YMU001_000101_D09 Library YMU01 Length 59 Definition Adiantum capillus-veneris... to BlastX Result : TrEMBL (No blast op. Sequence too short.) tr_hit_id - Definition - Align length - Score (bit) - E-value - Report - ... ...nition - Align length - Score (bit) - E-value - Report - TrEMBL (release 39.9) Link... search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot (No blast op. Sequence too short.) sp_hit_id - Defi

  13. 铅胁迫对节杆菌(Arthrobacter sp.)和芽孢杆菌(Bacillus sp.)生理生化特性的影响%Impacts of Pb (Ⅱ) on the physio-biochemical features of Arthrobacter sp.and Bacillus sp.

    Institute of Scientific and Technical Information of China (English)

    杜瑞英; 黄文芳; 赵沛华; 赵迪; 文典

    2016-01-01

    将节杆菌和芽孢杆菌分别暴露于不同浓度的铅溶液中,并进行不同暴露时间的急性毒性试验.结果表明,500 mg/kg的Pb(Ⅱ)处理会使节杆菌中的细胞膜脂质过氧化产物——硫代巴比妥酸活性物质(TBARS)浓度显著降低(p<0.05),而Pb(Ⅱ)质量比变化对其他指标无显著影响(p<0.05);铅处理会使芽孢杆菌中可溶性蛋白质量浓度、GSH质量浓度和超氧化物歧化酶(SOD)活性显著升高,而过氧化氢酶(CAT)活性显著降低(p<0.05).节杆菌的可溶性糖质量浓度、GSH质量浓度、SOD活性和TBARS浓度随暴露时间延长而显著增加;芽孢杆菌的可溶性糖质量浓度、GSH质量浓度和SOD活性随暴露时间延长而显著增加,TBARS浓度随暴露时间延长呈先增后减的变化趋势,CAT活性也表现出先增后降的变化趋势.铅处理对节杆菌和芽孢杆菌具有一定的胁迫作用,两种菌通过启动不同的抗性系统来抵抗外界胁迫.

  14. Application of genetic BP network to discriminating earthquakes and explosions

    Institute of Scientific and Technical Information of China (English)

    边银菊

    2002-01-01

    In this paper, we develop GA-BP algorithm by combining genetic algorithm (GA) with back propagation (BP) algorithm and establish genetic BP neural network. We also applied BP neural network based on BP algorithm and genetic BP neural network based on GA-BP algorithm to discriminate earthquakes and explosions. The obtained result shows that the discriminating performance of genetic BP network is slightly better than that of BP network.

  15. Draft Genome Sequence of Gordonia sp. Strain UCD-TK1 (Phylum Actinobacteria)

    Science.gov (United States)

    Koenigsaecker, Tynisha M.; Coil, David A.

    2016-01-01

    Here, we present the draft genome of Gordonia sp. strain UCD-TK1. The assembly contains 5,470,576 bp in 98 contigs. This strain was isolated from a disinfected ambulatory surgery center. PMID:27738036

  16. Evaluation of Arthrobacter aurescens Strain TC1 as Bioaugmentation Bacterium in Soils Contaminated with the Herbicidal Substance Terbuthylazine.

    Directory of Open Access Journals (Sweden)

    Vera P Silva

    Full Text Available In the last years the chloro-s-triazine active substance terbuthylazine has been increasingly used as an herbicide and may leave residues in the environment which can be of concern. The present study aimed at developing a bioaugmentation tool based on the soil bacterium Arthrobacter aurescens strain TC1 for the remediation of terbuthylazine contaminated soils and at examining its efficacy for both soil and aquatic compartments. First, the feasibility of growing the bioaugmentation bacterium inocula on simple sole nitrogen sources (ammonium and nitrate instead of atrazine, while still maintaining its efficiency to biodegrade terbuthylazine was shown. In sequence, the successful and quick (3 days bioremediation efficacy of ammonium-grown A. aurescens TC1 cells was proven in a natural soil freshly spiked or four-months aged with commercial terbuthylazine at a dose 10× higher than the recommended in corn cultivation, to mimic spill situations. Ecotoxicity assessment of the soil eluates towards a freshwater microalga supported the effectiveness of the bioaugmentation tool. Obtained results highlight the potential to decontaminate soil while minimizing terbuthylazine from reaching aquatic compartments via the soil-water pathway. The usefulness of this bioaugmentation tool to provide rapid environment decontamination is particularly relevant in the event of accidental high herbicide contamination. Its limitations and advantages are discussed.

  17. SP. Pescado

    Directory of Open Access Journals (Sweden)

    Renato Gendre

    2003-12-01

    Full Text Available Nell'occhiello di un articolo dal titolo Il Peru dei de[Jini rosa e de/la grande pioggia si legge: "da una partenza  in aereo al «pescado»  che ti  sfamera."1 Questa parola spagnola, giustamente chiusa tra caporali, a noi pare molto interes­ sante, perche, nonostante l'apparenza, non ha nulla da spartire sotto i1 profilo se­ mantico con l'it. pescato. lnfatti, tutti i piu importanti dizionari della lingua italiana, di ieri e di oggi, etimologici e non 2, registrano  accanto a pescata,  ii lemma pescato, 3 ma lo spiegano come "quantita di pesce catturato nel corso di una battuta o di una stagione di pesca",4 mentre lo sp. pescado  indica i1 "pesce (solo nel senso di: pesGe pescato da mangiare [...]".s

  18. An Sp1/Sp3 binding polymorphism confers methylation protection.

    Directory of Open Access Journals (Sweden)

    Yanis A Boumber

    2008-08-01

    Full Text Available Hundreds of genes show aberrant DNA hypermethylation in cancer, yet little is known about the causes of this hypermethylation. We identified RIL as a frequent methylation target in cancer. In search for factors that influence RIL hypermethylation, we found a 12-bp polymorphic sequence around its transcription start site that creates a long allele. Pyrosequencing of homozygous tumors revealed a 2.1-fold higher methylation for the short alleles (P<0.001. Bisulfite sequencing of cancers heterozygous for RIL showed that the short alleles are 3.1-fold more methylated than the long (P<0.001. The comparison of expression levels between unmethylated long and short EBV-transformed cell lines showed no difference in expression in vivo. Electrophorectic mobility shift assay showed that the inserted region of the long allele binds Sp1 and Sp3 transcription factors, a binding that is absent in the short allele. Transient transfection of RIL allele-specific transgenes showed no effects of the additional Sp1 site on transcription early on. However, stable transfection of methylation-seeded constructs showed gradually decreasing transcription levels from the short allele with eventual spreading of de novo methylation. In contrast, the long allele showed stable levels of expression over time as measured by luciferase and approximately 2-3-fold lower levels of methylation by bisulfite sequencing (P<0.001, suggesting that the polymorphic Sp1 site protects against time-dependent silencing. Our finding demonstrates that, in some genes, hypermethylation in cancer is dictated by protein-DNA interactions at the promoters and provides a novel mechanism by which genetic polymorphisms can influence an epigenetic state.

  19. ESTROGEN REGULATION OF LRP16 GENE EXPRESSION INVOLVES SP1 TRANSCRIPTION FACTOR

    Institute of Scientific and Technical Information of China (English)

    SI Yi-ling; HAN Wei-dong; ZhAO Ya-li; LI Qi; HAO Hao-jie; SONG Hai-jing; MU Yi-ming; YU Li

    2006-01-01

    Objective: To investigate the role of Sp1 as transcription factor required for transactivation of LRP16 gene by estrogen. Methods: Specific antibodies of Erα and Sp1 were used to precipitate the target DNA/protein complexes of MCF-7 cells at different time points after estrogen treatment (Chromatin immunoprecipitation assay), the promoter region of LRP16 gene was amplified by semi-nested polymerase chain reaction (snPCR). Small interfering RNA (siRNA) against Sp1 was transiently cotransfected with LRP16-Luc (containing the region from -213bp to -126bp of LRP16 gene promoter) in MCF-7 cells. The luciferase activities were measured by dual-luciferase assay. Results: The results of chromatin immunoprecipitation assay showed that Sp1 protein directly bound to the -213bp to -126bp region of LRP16 gene, and Erα could enhance the affinity of Sp1 to DNA. Sp1-siRNA specifically decreased the transactivation of LRP16-Luc by 17β-estradiol to 70-80%. Conclusion: The estrogen-induced transactivation of the human LRP16 gene was mediated by Sp1 protein. Moreover, the interactions of ER(/Sp1 functional complex with LRP16 promoter DNA were required for enhanced LRP16 gene transactivation.

  20. Genome sequencing and annotation of Cellulomonas sp. HZM

    Directory of Open Access Journals (Sweden)

    Patric Chua

    2015-09-01

    Full Text Available We report the draft genome sequence of Cellulomonas sp. HZM, isolated from a tropical peat swamp forest. The draft genome size is 3,559,280 bp with a G + C content of 73% and contains 3 rRNA sequences (single copies of 5S, 16S and 23S rRNA.

  1. Interoperability of wearable cuffless BP measuring devices.

    Science.gov (United States)

    Liu, Jing; Zhang, Yuan-Ting

    2014-01-01

    While a traditional cuff-based Blood Pressure (BP) measuring device can only take a snap shot of BP, real-time and continuous measurement of BP without an occluding cuff is preferred which usually use the pulse transit time (PTT) in combination with other physiological parameters to estimate or track BP over a certain period of time after an initial calibration. This article discusses some perspectives of interoperability of wearable medical devices, based on IEEE P1708 draft standard that focuses on the objective performance evaluation of wearable cuffless BP measuring devices. The ISO/IEEE 11073 family of standards, supporting the plug-and play feature, is intended to enable medical devices to interconnect and interoperate with other medical devices and with computerized healthcare information systems in a manner suitable for the clinical environment. In this paper, the possible adoption of ISO/IEEE 11073 for the interoperability of wearable cuffless BP devices is proposed. In the consideration of the difference of the continuous and cuffless BP measuring methods from the conventional ones, the existing device specialization standards of ISO/IEEE 11073 cannot be directly followed when designing the cuffless BP device. Specifically, this paper discusses how the domain information model (DIM), in which vital sign information is abstracted as objects, is used to structure the information about the device and that generated from the device. Though attention should also be paid to adopt the communication standards for other parts for the communication system, applying communication standards that enable plug-and-play feature allows achieving the interoperability of different cuffless BP measuring devices with possible different configurations.

  2. Low temperature reduction of hexavalent chromium by a microbial enrichment consortium and a novel strain of Arthrobacter aurescens

    Directory of Open Access Journals (Sweden)

    Thompson Vicki S

    2006-01-01

    Full Text Available Abstract Background Chromium is a transition metal most commonly found in the environment in its trivalent [Cr(III] and hexavalent [Cr(VI] forms. The EPA maximum total chromium contaminant level for drinking water is 0.1 mg/l (0.1 ppm. Many water sources, especially underground sources, are at low temperatures (less than or equal to 15 Centigrade year round. It is important to evaluate the possibility of microbial remediation of Cr(VI contamination using microorganisms adapted to these low temperatures (psychrophiles. Results Core samples obtained from a Cr(VI contaminated aquifer at the Hanford facility in Washington were enriched in Vogel Bonner medium at 10 Centigrade with 0, 25, 50, 100, 200, 400 and 1000 mg/l Cr(VI. The extent of Cr(VI reduction was evaluated using the diphenyl carbazide assay. Resistance to Cr(VI up to and including 1000 mg/l Cr(VI was observed in the consortium experiments. Reduction was slow or not observed at and above 100 mg/l Cr(VI using the enrichment consortium. Average time to complete reduction of Cr(VI in the 30 and 60 mg/l Cr(VI cultures of the consortium was 8 and 17 days, respectively at 10 Centigrade. Lyophilized consortium cells did not demonstrate adsorption of Cr(VI over a 24 hour period. Successful isolation of a Cr(VI reducing organism (designated P4 from the consortium was confirmed by 16S rDNA amplification and sequencing. Average time to complete reduction of Cr(VI at 10 Centigrade in the 25 and 50 mg/l Cr(VI cultures of the isolate P4 was 3 and 5 days, respectively. The 16S rDNA sequence from isolate P4 identified this organism as a strain of Arthrobacter aurescens, a species that has not previously been shown to be capable of low temperature Cr(VI reduction. Conclusion A. aurescens, indigenous to the subsurface, has the potential to be a predominant metal reducer in enhanced, in situ subsurface bioremediation efforts involving Cr(VI and possibly other heavy metals and radionuclides.

  3. Increased iron-stress resilience of maize through inoculation of siderophore-producing Arthrobacter globiformis from mine.

    Science.gov (United States)

    Sharma, Meenakshi; Mishra, Vandana; Rau, Nupur; Sharma, Radhey Shyam

    2016-07-01

    Iron deficiency is common among graminaceous crops. Ecologically successful wild grasses from iron-limiting habitats are likely to harbour bacteria which secrete efficient high-affinity iron-chelating molecules (siderophores) to solubilize and mobilize iron. Such siderophore-producing rhizobacteria may increase the iron-stress resilience of graminaceous crops. Considering this, 51 rhizobacterial isolates of Dichanthium annulatum from iron-limiting abandoned mine (∼84% biologically unavailable iron) were purified and tested for siderophore production; and efficacy of Arthrobacter globiformis inoculation to increase iron-stress resilience of maize and wheat was also evaluated. 16S rRNA sequence analyses demonstrated that siderophore-producing bacteria were taxonomically diverse (seven genera, nineteen species). Among these, Gram-positive Bacillus (eleven species) was prevalent (76.92%). A. globiformis, a commonly found rhizobacterium of graminaceous crops was investigated in detail. Its siderophore has high iron-chelation capacity (ICC: 13.0 ± 2.4 μM) and effectively dissolutes diverse iron-complexes (FeCl3 : 256.13 ± 26.56 μM/ml; Fe2 O3 red: 84.3 ± 4.74 μM/ml; mine spoil: 123.84 ± 4.38 μM/ml). Siderophore production (ICC) of A. globiformis BGDa404 also varied with supplementation of different iron complexes. In plant bioassay with iron-deficiency sensitive species maize, A. globiformis inoculation triggered stress-associated traits (peroxidase and proline) in roots, enhanced plant biomass, uptake of iron and phosphate, and protein and chlorophyll contents. However, in iron deficiency tolerant species wheat, growth improvement was marginal. The present study illustrates: (i) rhizosphere of D. annulatum colonizing abandoned mine as a "hotspot" of siderophore-producing bacteria; and (ii) potential of A. globiformis BGDa404 inoculation to increase iron-stress resilience in maize. A. globiformis BGDa404 has the potential to develop as

  4. PLASMID-ENCODED PHTHALATE CATABOLIC PATHWAY IN ARTHROBACTER KEYSERI 12B: BIOTRANSFORMATIONS OF 2-SUBSTITUTED BENZOATES AND THEIR USE IN CLONING AND CHARACTERIZATION OF PHTHALATE CATABOLISM GENES AND GENE PRODUCTS

    Science.gov (United States)

    Several 2-substituted benzoates (including 2-trifluoromethyl-, 2-chloro-, 2-bromo-, 2-iodo-, 2-nitro-, 2-methoxy-, and 2-acetyl-benzoates) were converted by phthalate-grown Arthrobacter keyseri 12B to the corresponding 2-substituted 3,4-dihydroxybenzoates (protocatechuates)...

  5. The millimetre spectrum of BP Cru

    Science.gov (United States)

    Pestalozzi, Michele; Hobbs, George; Torkelsson, Ulf

    2010-04-01

    In this experiment we attempt to detect the millimetre emission from the high-mass X-ray binary BP Cru. This object is composed of a hypergiant (Wray 977) and a slow spinning X-ray pulsar (GX301-2). The recent ATCA observations of centimeter emission (Pestalozzi et al. 2009, this was the first detection of radio emission towards BP Cru) suggested that radio emission consists of two components, a transient non-thermal one and a persistent thermal one, probably arising from the large stellar wind of Wray 977. As stellar winds often show a positive spectral index, we ask to observe BP Cru at 13 and 7 mm, where we expect fluxes of around 1 mJy. Any detection will allow us to probe the inner parts of the wind and characterise the structure of the stellar wind of BP Cru. For this detection experiment we require 11 hours of observations with ATCA.

  6. BP Investment Exceeds $4 Bln in china

    Institute of Scientific and Technical Information of China (English)

    Wang Ping

    2008-01-01

    @@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.

  7. The Effects of Heterologous Expression of groEL from Arthrobacter simplex on the Resistance Performance of Escherichia coli%简单节杆菌groEL基因表达对大肠杆菌抗逆性能的影响

    Institute of Scientific and Technical Information of China (English)

    王艳霞; 王红玲; 王敏; 骆健美

    2016-01-01

    Arthrobacter simplex,a strain with steroid C1,2 dehydrogenation ability,has been widely used in the steroid industry, usually adding ethanol in the transforming system may catalyze the dissolution of hydrophobic substrates. Our prior work by LC-MS/MS and bioinformatics analysis found that heat shock protein(HSP)GroEL was closely correlated to the cell adaptive behavior under ethanol stress condition. Based on this concept,groEL gene was cloned by PCR while usingA. simplexTCCC 11037 genome as a template. The results showed that the homologies of nucleotide and amino acid sequence of GroEL in the strain were the highest with that fromNocardioides sp. JS614 by the ratio of 89% and 95%,respectively. Then its heterologous expression was conducted in Escherichia coli BL21(DE3)with the vector pET-22b (+),and the results showed that the recombinant strain presented the significant increase on the survival performance under the shock condition with high-concentration of methanol,hypertonicity and superacid,as well as the growth performance under the proper stresses of them. The study was the first report on the cloning and expression of genegroEL fromA. simplex,and also provided fundamental data for exploring the biological function of HSP protein GroEL from A. simplex.%以简单节杆菌(Arthrobacter simplex)TCCC 11037基因组为模板,通过PCR方法进行groEL基因克隆,结果表明,该菌株中GroEL的核苷酸和氨基酸序列与Nocardioidessp. JS614来源的GroEL同源性最高,分别为89%和95%。通过pET-22b(+)将其在大肠杆菌BL21(DE3)中进行异源表达,结果表明,重组菌株在甲醇、高渗和强酸这3种压力高浓度冲击条件下的存活能力和适当压力条件下的生长性能均明显提高。

  8. Equipment Design for Oxidation of 1BP/2BP Using NO_x

    Institute of Scientific and Technical Information of China (English)

    ZHOU; Xian-ming; CHANG; Shang-wen; LI; Gao-liang; LAN; Tian; LIU; Jin-ping; TANG; Hong-bin; HE; Hui

    2013-01-01

    NOx can Oxidize the reductants in 1BP and 2BP feed of Purex process,and can adjust the oxidation state of plutonium as Pu(Ⅳ)to meet the need of 2AF feed.Using NOx in Purex process can reduce the volumn of solid waste effectively,and attract more and more interest of researchers.In this work the oxidation of reductants in 1BP/2BP feed were investigated in glass column as the same-current mode,in

  9. Dicty_cDB: Contig-U15862-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ohexanone... 212 6e-53 AY083902_1( AY083902 |pid:none) Atriplex prostrata betaine a...de dehydrogenase 5, mitochondrial; ... 212 6e-53 AY123972_4( AY123972 |pid:none) Arthrobacter sp. BP2 cycl

  10. Complete Genome Sequence of a Potential Novel Bacillus sp. Strain, FJAT-18017, Isolated from a Potato Field

    Science.gov (United States)

    Liu, Guo-Hong; Wang, Jie-Ping; Che, Jian-Mei; Chen, Qian-Qian

    2017-01-01

    ABSTRACT Bacillus sp. strain FJAT-18017 was isolated from a potato field in Xinjiang, China. This paper is the first report, to our knowledge, to demonstrate the fully sequenced and completely annotated genome of Bacillus sp. FJAT-18017. The genome size is 5,265,521 bp. The average G+C content was 42.42%. PMID:28104649

  11. Genome Sequence of a Typical Ultramicrobacterium, Curvibacter sp. Strain PAE-UM, Capable of Phthalate Ester Degradation.

    Science.gov (United States)

    Ma, Dan; Hao, Zhenyu; Sun, Rui; Bartlam, Mark; Wang, Yingying

    2016-01-14

    Curvibacter sp. strain PAE-UM, isolated from river sediment, is a typical ultramicrobacterium capable of phthalate ester degradation. The genome of Curvibacter sp. PAE-UM consists of 3,284,473 bp, and its information will provide insights into the molecular mechanisms underlying its degradation ability.

  12. Genome Sequence of a Typical Ultramicrobacterium, Curvibacter sp. Strain PAE-UM, Capable of Phthalate Ester Degradation

    OpenAIRE

    Ma, Dan; Hao, Zhenyu; Sun, Rui; Bartlam, Mark; Wang, Yingying

    2016-01-01

    Curvibacter sp. strain PAE-UM, isolated from river sediment, is a typical ultramicrobacterium capable of phthalate ester degradation. The genome of Curvibacter sp. PAE-UM consists of 3,284,473 bp, and its information will provide insights into the molecular mechanisms underlying its degradation ability.

  13. BP to Increase Production Capacity of PTA at BP Zhuhai Chemical

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    BP has announced a strategic plan for its substantial development in China. It is actively proceeding with its project to increase its production capacity of purified terephthalic acid, or PTA, at the BP Zhuhai Chemical Company Limited facility i n Guangdong, China.

  14. Reconstruction of climatic and environmental changes in NW Romania during the early part of the last deglaciation (˜15,000-13,600 cal yr BP)

    Science.gov (United States)

    Wohlfarth, Barbara; Hannon, Gina; Feurdean, Angelica; Ghergari, Lucretia; Onac, Bogdan P.; Possnert, Göran

    2001-12-01

    High resolution pollen, plant macrofossil, charcoal, mineral magnetic and sedimentary analyses, combined with AMS 14C measurements, were performed on multiple sediment sequences along a transect through the former crater lake Preluca Ţiganului in northwestern Romania in order to reconstruct the climatic and environmental changes during the early part of the Last Termination. Lake sediments started to accumulate at ˜14,700 cal yr BP. Initially the upland vegetation consisted of an open forest with mainly Betula and Salix and few Pinus sp., but from 14,500 cal yr BP onwards, Pinus mugo, P. sylvestris and Populus and later on also Larix became established around the lake. Between 14,150 and 13,950 cal yr BP, Pinus cembra seems to have replaced P. mugo and P. sylvestris. At ˜13,950 cal yr BP the tree cover increased and Picea appeared for the first time, together with Pinus cembra, P. mugo and Larix. From ˜13,750 cal yr BP onwards, a Picea forest developed around the site. Based on the combined proxy data the following climatic development may be inferred: 14,700-14,500 cal yr BP, cooler and wet/humid; 14,500-14,400 cal yr BP: gradually warmer temperatures, wet/humid with dry summers; 14,400-14,320 cal yr BP: warm and dry; 14,320-14,150 cal yr BP: cooler and wet/humid; 14,150-14,100 cal yr BP: warm and dry; 14,100-13,850 cal yr BP: warmer and wet/humid; 14,700 cal yr could correspond to GS-2a, the time span between 14,700 and 14,320 to GI-1e, the phase between 14,320 and 14,150 cal yr BP to GI-1d and the time frame between 14,150 and 13,600 cal yr BP to the lower part of GI-1c.

  15. AcEST: BP919856 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A02 514 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A02. BP919856 - Show BP91985...is mRNA. clone: YMU001_000130_A02. Accession BP919856 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919856|Adiantum c

  16. AcEST: BP920173 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H07 454 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H07. BP920173 - Show BP92017...is mRNA. clone: YMU001_000133_H07. Accession BP920173 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP920173|Adiantum capillus-veneris mRNA, clone: YMU001_...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920173|Adiantum capillus

  17. AcEST: BP921101 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000145_F04 489 Adiantum capillus-veneris mRNA. clone: YMU001_000145_F04. BP921101 - Show BP921101...is mRNA. clone: YMU001_000145_F04. Accession BP921101 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101|Adiantum cap... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921101

  18. AcEST: BP919841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G06 496 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G06. BP919841 - Show BP91984...is mRNA. clone: YMU001_000129_G06. Accession BP919841 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum ca...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum capi

  19. AcEST: BP920154 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F09 487 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F09. BP920154 - Show BP92015...is mRNA. clone: YMU001_000133_F09. Accession BP920154 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adia...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920154|Adiantum

  20. AcEST: BP919887 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C10 511 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C10. BP919887 - Show BP91988...is mRNA. clone: YMU001_000130_C10. Accession BP919887 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988

  1. AcEST: BP914001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G04 493 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G04. BP914001 - Show BP91400...is mRNA. clone: YMU001_000038_G04. Accession BP914001 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914001|...ic Acids Res. 25:3389-3402. Query= BP914001|Adiantum capillus-veneris mRNA, clone

  2. AcEST: BP919212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_E05 508 Adiantum capillus-veneris mRNA. clone: YMU001_000122_E05. BP919212 - Show BP91921...is mRNA. clone: YMU001_000122_E05. Accession BP919212 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919212|Adiantum capillus-ven...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919212|Adiantum capillus-

  3. 2000 Johnston Site 1B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  4. 2000 Johnston Site 2B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  5. 2000 Johnston Site 3B-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3B-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  6. Complete genome sequence of Hymenobacter sp. strain PAMC26554, an ionizing radiation-resistant bacterium isolated from an Antarctic lichen.

    Science.gov (United States)

    Oh, Tae-Jin; Han, So-Ra; Ahn, Do-Hwan; Park, Hyun; Kim, Augustine Yonghwi

    2016-06-10

    A Gram-negative, rod-shaped, red-pink in color, and UV radiation-resistant bacterium Hymenobacter sp. strain PAMC26554 was isolated from Usnea sp., an Antarctic lichen, and belongs to the class of Cytophagia and the phylum of Bacteroidetes. The complete genome of Hymenobacter sp. PAMC26554 consists of one chromosome (5,244,843bp) with two plasmids (199,990bp and 6421bp). The genomic sequence indicates that Hymenobacter sp. strain PAMC26554 possesses several genes involved in the nucleotide excision repair pathway that protects damaged DNA. This complete genome information will help us to understand its adaptation and novel survival strategy in the Antarctic extreme cold environment.

  7. Complete genome analysis of Ketogulonigenium sp.WB0104

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Ketogulonigenium sp. may convert L-sorbose into 2-keto-L-gulonic acid, the vitamin C precursor. The genome of Ketogulonigenium sp. WB0104 consists of a circular 2765030 bp chromosome with 61.69% G+C content and two circular plasmids of 267968 and 242707 bp. The genome contains 2727 open reading frames (ORFs). The systems of replication, transcription, translation, carbohydrate and energy metabolism are intact, but the repair system is incomplete. About 640 predicted ORFs have been found to encode transporter proteins, which account for about one fourth of total predicted ORFs, noticeably higher than other documented bacteria. This may be due to the fact that WB0104 adapts to soil circumstance.

  8. Genome sequence of the aerobic bacterium Bacillus sp. strain FJAT-13831.

    Science.gov (United States)

    Liu, Guohong; Liu, Bo; Lin, Naiquan; Tang, Weiqi; Tang, Jianyang; Lin, Yingzhi

    2012-12-01

    Bacillus sp. strain FJAT-13831 was isolated from the no. 1 pit soil of Emperor Qin's Terracotta Warriors in Xi'an City, People's Republic of China. The isolate showed a close relationship to the Bacillus cereus group. The draft genome sequence of Bacillus sp. FJAT-13831 was 4,425,198 bp in size and consisted of 5,567 genes (protein-coding sequences [CDS]) with an average length of 782 bp and a G+C value of 36.36%.

  9. Sp(2) Renormalization

    CERN Document Server

    Lavrov, Peter M

    2010-01-01

    The renormalization of general gauge theories on flat and curved space-time backgrounds is considered within the Sp(2)-covariant quantization method. We assume the existence of a gauge-invariant and diffeomorphism invariant regularization. Using the Sp(2)-covariant formalism one can show that the theory possesses gauge invariant and diffeomorphism invariant renormalizability to all orders in the loop expansion and the extended BRST symmetry after renormalization is preserved. The advantage of the Sp(2)-method compared to the standard Batalin-Vilkovisky approach is that, in reducible theories, the structure of ghosts and ghosts for ghosts and auxiliary fields is described in terms of irreducible representations of the Sp(2) group. This makes the presentation of solutions to the master equations in more simple and systematic way because they are Sp(2)- scalars.

  10. Sp(2) renormalization

    Energy Technology Data Exchange (ETDEWEB)

    Lavrov, Peter M., E-mail: lavrov@tspu.edu.r [Department of Mathematical Analysis, Tomsk State Pedagogical University, Kievskaya St. 60, Tomsk 634061 (Russian Federation)

    2011-08-11

    The renormalization of general gauge theories on flat and curved space-time backgrounds is considered within the Sp(2)-covariant quantization method. We assume the existence of a gauge-invariant and diffeomorphism invariant regularization. Using the Sp(2)-covariant formalism one can show that the theory possesses gauge-invariant and diffeomorphism invariant renormalizability to all orders in the loop expansion and the extended BRST-symmetry after renormalization is preserved. The advantage of the Sp(2) method compared to the standard Batalin-Vilkovisky approach is that, in reducible theories, the structure of ghosts and ghosts for ghosts and auxiliary fields is described in terms of irreducible representations of the Sp(2) group. This makes the presentation of solutions to the master equations in more simple and systematic way because they are Sp(2)-scalars.

  11. The 15q11.2 BP1–BP2 Microdeletion Syndrome: A Review

    Directory of Open Access Journals (Sweden)

    Devin M. Cox

    2015-02-01

    Full Text Available Patients with the 15q11.2 BP1–BP2 microdeletion can present with developmental and language delay, neurobehavioral disturbances and psychiatric problems. Autism, seizures, schizophrenia and mild dysmorphic features are less commonly seen. The 15q11.2 BP1–BP2 microdeletion involving four genes (i.e., TUBGCP5, CYFIP1, NIPA1, NIPA2 is emerging as a recognized syndrome with a prevalence ranging from 0.57%–1.27% of patients presenting for microarray analysis which is a two to four fold increase compared with controls. Review of clinical features from about 200 individuals were grouped into five categories and included developmental (73% and speech (67% delays; dysmorphic ears (46% and palatal anomalies (46%; writing (60% and reading (57% difficulties, memory problems (60% and verbal IQ scores ≤75 (50%; general behavioral problems, unspecified (55% and abnormal brain imaging (43%. Other clinical features noted but not considered as common were seizures/epilepsy (26%, autism spectrum disorder (27%, attention deficit disorder (ADD/attention deficit hyperactivity disorder (ADHD (35%, schizophrenia/paranoid psychosis (20% and motor delay (42%. Not all individuals with the deletion are clinically affected, yet the collection of findings appear to share biological pathways and presumed genetic mechanisms. Neuropsychiatric and behavior disturbances and mild dysmorphic features are associated with genomic imbalances of the 15q11.2 BP1–BP2 region, including microdeletions, but with an apparent incomplete penetrance and variable expressivity.

  12. Genome Sequence of Marine Bacterium Idiomarina sp. Strain 28-8, Isolated from Korean Ark Shells.

    Science.gov (United States)

    Kim, Woo-Jin; Kim, Young-Ok; Kim, Dong-Gyun; Nam, Bo-Hye; Kong, Hee Jeong; Jung, Hyungtaek; Lee, Sang-Jun; Kim, Dong-Wook; Kim, Dae-Soo; Chae, Sung-Hwa

    2013-10-03

    Idiomarina sp. strain 28-8 is an aerobic, Gram-negative, flagellar bacterium isolated from the bodies of ark shells (Scapharca broughtonii) collected from underwater sediments in Gangjin Bay, South Korea. Here, we present the draft genome sequence of Idiomarina sp. 28-8 (2,971,606 bp, with a G+C content of 46.9%), containing 2,795 putative coding sequences.

  13. Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  14. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  15. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  16. Air Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  17. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  18. AcEST: BP920020 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_B05 91 Adiantum capillus-veneris mRNA. clone: YMU001_000132_B05. BP920020 - Show BP920020... mRNA. clone: YMU001_000132_B05. Accession BP920020 Tissue type prothallium Developmental stage - Contig ID

  19. AcEST: BP919848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H02 84 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H02. BP919848 - Show BP91984... mRNA. clone: YMU001_000129_H02. Accession BP919848 Tissue type prothallium Developmental stage - Contig ID

  20. AcEST: BP916868 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000093_A02 72 Adiantum capillus-veneris mRNA. clone: YMU001_000093_A02. BP916868 - Show BP916868... mRNA. clone: YMU001_000093_A02. Accession BP916868 Tissue type prothallium Developmental stage - Contig ID

  1. AcEST: BP915006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D07 96 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D07. BP915006 - Show BP91500... mRNA. clone: YMU001_000065_D07. Accession BP915006 Tissue type prothallium Developmental stage - Contig ID

  2. AcEST: BP911835 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G02 27 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G02. BP911835 - Show BP91183... mRNA. clone: YMU001_000009_G02. Accession BP911835 Tissue type prothallium Developmental stage - Contig ID

  3. AcEST: BP911839 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G06 76 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G06. BP911839 - Show BP91183... mRNA. clone: YMU001_000009_G06. Accession BP911839 Tissue type prothallium Developmental stage - Contig ID

  4. AcEST: BP912001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H05 68 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H05. BP912001 - Show BP9120... mRNA. clone: YMU001_000011_H05. Accession BP912001 Tissue type prothallium Developmental stage - Contig ID

  5. AcEST: BP920096 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_H11 24 Adiantum capillus-veneris mRNA. clone: YMU001_000132_H11. BP920096 - Show BP9200... mRNA. clone: YMU001_000132_H11. Accession BP920096 Tissue type prothallium Developmental stage - Contig ID

  6. AcEST: BP917073 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E10 67 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E10. BP917073 - Show BP91707... mRNA. clone: YMU001_000095_E10. Accession BP917073 Tissue type prothallium Developmental stage - Contig ID

  7. AcEST: BP919947 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A11 35 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A11. BP919947 - Show BP91994... mRNA. clone: YMU001_000131_A11. Accession BP919947 Tissue type prothallium Developmental stage - Contig ID

  8. AcEST: BP915916 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000079_D12 73 Adiantum capillus-veneris mRNA. clone: YMU001_000079_D12. BP915916 - Show BP91591... mRNA. clone: YMU001_000079_D12. Accession BP915916 Tissue type prothallium Developmental stage - Contig ID

  9. AcEST: BP920054 [AcEST

    Lifescience Database Archive (English)

    Full Text Available its) Value sp|Q9P246|STIM2_HUMAN Stromal interaction molecule 2 OS=Homo sap... 33 0.85 sp|P59438|HPS5_MOUSE Herman...LHDNH 246 +++R I SP P+R +A + P SHP H +H Sbjct: 514 RSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHH 546 >sp|P59438|HPS5_MOUSE Herman

  10. AcEST: BP918782 [AcEST

    Lifescience Database Archive (English)

    Full Text Available . 42 0.001 sp|O15164|TIF1A_HUMAN Transcription intermediary factor 1-alpha ... 42 0.001 sp|Q91Y44|BRDT_MOUSE...2 sp|Q64127|TIF1A_MOUSE Transcription intermediary factor 1-alpha ... 42 0.002 sp

  11. AcEST: BP919941 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rot sp_hit_id P53865 Definition sp|P53865|CNM67_YEAST Chaotic nuclear migration p...producing significant alignments: (bits) Value sp|P53865|CNM67_YEAST Chaotic nucl...ear migration protein 67 OS=Sa... 31 2.7 >sp|P53865|CNM67_YEAST Chaotic nuclear migration protein 67 OS=Sacc

  12. AcEST: BP917001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available iss-Prot sp_hit_id P09615 Definition sp|P09615|WNTG_DROME Protein wingless OS=Dro...cant alignments: (bits) Value sp|P09615|WNTG_DROME Protein wingless OS=Drosophila....1 >sp|P09615|WNTG_DROME Protein wingless OS=Drosophila melanogaster GN=wg PE=1 S

  13. Interaction mechanism between Arthrobacter oxydans and BaP-Cd%氧化节杆菌与苯并[a]芘-镉交互作用机理

    Institute of Scientific and Technical Information of China (English)

    邓军; 尹华; 叶锦韶; 彭辉; 秦华明; 龙焰; 何宝燕; 张娜

    2010-01-01

    利用HPLC、FTIR分析技术,研究了氧化节杆菌(Arthrobacter oxydans)对水体中苯并[a]芘(BaP)-镉(Cd)复合污染物交互作用机理.结果表明,BaP、Cd及BaP-Cd复合污染均对菌株的正常生长产生影响,其影响程度为:BaP-Cd>Cd>BaP;使用该菌投加到BaP、Cd浓度均为1 mg·L~(-1)的BaP-Cd复合污染无机盐溶液中,30 ℃、130 r·min~(-1),培养5 d后,体系BaP、Cd的残留量分别为0.39、0.65 mg·L~(-1);添加一定浓度的H_2O_2并保持体系呈偏碱性更适于该复合污染的处理.红外扫描分析显示,在微生物作用下,BaP的结构发生改变,菌株降解BaP和吸附Cd的过程主要与羟基、CC键、酰胺基团和C-H键有关.

  14. capA, a cspA-like gene that encodes a cold acclimation protein in the psychrotrophic bacterium Arthrobacter globiformis SI55.

    Science.gov (United States)

    Berger, F; Normand, P; Potier, P

    1997-09-01

    By use of Arthrobacter globiformis SI55, a psychrotrophic bacterium capable of growth between -5 and +32 degrees C, we cloned and sequenced capA, a gene homologous to cspA encoding the major cold shock protein in Escherichia coli. The deduced protein sequence has a high level of identity with the sequences of other CspA-related proteins from various sources, and no particular residue or domain that could be specific to cold-adapted microorganisms emerged. We show that CapA was produced very rapidly following cold shock, but unlike its mesophilic counterparts, it was still expressed during prolonged growth at low temperature. Its synthesis is regulated at the translational level, and we showed that growth resumption following a temperature downshift correlated with CapA expression. Transient inhibitions in protein synthesis during the first stages of the cold shock response severely impaired the subsequent acclimation of A. globiformis SI55 to low temperature and delayed CapA expression. The cold shock response in A. globiformis SI55 is an adaptative process in which CapA may play a crucial role. We suggest that low-temperature acclimation is conditioned mainly by the ability of cells to restore an active translational machinery after cold shock in a process that may be different from that present in mesophiles.

  15. Toxicity screening of soils from different mine areas—A contribution to track the sensitivity and variability of Arthrobacter globiformis assay

    Energy Technology Data Exchange (ETDEWEB)

    Marques, Catarina R., E-mail: crmarques@ua.pt [Departamento de Biologia and CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus Universitário de Santiago, 3810-193 Aveiro (Portugal); Caetano, Ana L. [Departamento de Biologia and CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus Universitário de Santiago, 3810-193 Aveiro (Portugal); Haller, Andreas [ECT Oekotoxikologie GmbH, Böttgerstraße 2–14, D-65439 Flörsheim a. M. (Germany); Gonçalves, Fernando [Departamento de Biologia and CESAM (Centro de Estudos do Ambiente e do Mar), Universidade de Aveiro, Campus Universitário de Santiago, 3810-193 Aveiro (Portugal); Pereira, Ruth [Faculdade de Ciências da Universidade do Porto, Rua do Campo Alegre, s/n, 4169-007 Porto (Portugal); Interdisciplinary Centre of Marine and Environmental Research (CIIMAR/CIMAR), Universidade do Porto, Rua dos Bragas 289, P 4050-123 Porto (Portugal); Römbke, Jörg [ECT Oekotoxikologie GmbH, Böttgerstraße 2–14, D-65439 Flörsheim a. M. (Germany)

    2014-06-01

    Highlights: • The assay gave rapid and feasible discrimination of toxic soils to A. globiformis. • Sensitive and low variability response to soils from different regions. • Soil properties may interfere with metal toxicity and fluorescence measurements. • Proposal of a toxicity threshold for the contact assay regarding soils. • A. globiformis assay should be included in the Tier I of risk assessment frameworks. - Abstract: This study used the Arthrobacter globiformis solid-contact test for assessing the quality of soils collected in areas subjected to past and present mine activities in Europe (uranium mine, Portugal) and North Africa (phosphogypsum pile, Tunisia; iron mine, Morocco). As to discriminate the influence of soils natural variability from the effect of contaminants, toxicity thresholds were derived for this test, based on the dataset of each study area. Furthermore, the test sensitivity and variability was also evaluated. As a result, soils that inhibited A. globiformis dehydrogenase activity above 45% or 50% relatively to the control, were considered to be toxic. Despite the soil metal content determined, the properties of soils seemed to influence dehydrogenase activity. Overall, the contact test provided a coherent outcome comparing to other more time-consuming and effort-demanding ecotoxicological assays. Our results strengthened the feasibility and ecological relevance of this assay, which variability was quite reduced hence suggesting its potential integration within the test battery of tier 1 of soil risk assessment schemes.

  16. Deficiency in Either 4E-BP1 or 4E-BP2 Augments Innate Antiviral Immune Responses

    Science.gov (United States)

    Nehdi, Atef; Sean, Polen; Linares, Izzar; Colina, Rodney; Jaramillo, Maritza; Alain, Tommy

    2014-01-01

    Genetic deletion of both 4E-BP1 and 4E-BP2 was found to protect cells against viral infections. Here we demonstrate that the individual loss of either 4E-BP1 or 4E-BP2 in mouse embryonic fibroblasts (MEFs) is sufficient to confer viral resistance. shRNA-mediated silencing of 4E-BP1 or 4E-BP2 renders MEFs resistant to viruses, and compared to wild type cells, MEFs knockout for either 4E-BP1 or 4E-BP2 exhibit enhanced translation of Irf-7 and consequently increased innate immune response to viruses. Accordingly, the replication of vesicular stomatitis virus, encephalomyocarditis virus, influenza virus and Sindbis virus is markedly suppressed in these cells. Importantly, expression of either 4E-BP1 or 4E-BP2 in double knockout or respective single knockout cells diminishes their resistance to viral infection. Our data show that loss of 4E-BP1 or 4E-BP2 potentiates innate antiviral immunity. These results provide further evidence for translational control of innate immunity and support targeting translational effectors as an antiviral strategy. PMID:25531441

  17. AcEST: BP919858 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A04 328 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A04. BP919858 - Show BP91985...is mRNA. clone: YMU001_000130_A04. Accession BP919858 Tissue type prothallium Developmental stage - Contig I...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919858|Adiantum capillu

  18. AcEST: BP919857 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_A03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000130_A03. BP91985...7 CL3173Contig1 Show BP919857 Clone id YMU001_000130_A03 Library YMU01 Length 501 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000130_A03. Accession BP919857 Tissue type prothallium Developmental stag...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91985...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919857|Ad

  19. AcEST: BP919852 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H07 499 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H07. BP919852 - Show BP91985...is mRNA. clone: YMU001_000129_H07. Accession BP919852 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP919852|Adiantum capillus-veneris mRNA...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919852|Adiantum capillus-veneris mRNA, clo

  20. AcEST: BP911985 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F08 421 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F08. BP911985 - Show BP911985...is mRNA. clone: YMU001_000011_F08. Accession BP911985 Tissue type prothallium Developmental stage - Contig I...7), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91198...rams, Nucleic Acids Res. 25:3389-3402. Query= BP911985|Adiantum capillus-veneris

  1. AcEST: BP920171 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H05 509 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H05. BP920171 - Show BP92017...is mRNA. clone: YMU001_000133_H05. Accession BP920171 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017...s. 25:3389-3402. Query= BP920171|Adiantum capillus-veneris mRNA, clone: YMU001_000133_H05. (509 letters) Dat

  2. AcEST: BP912017 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A11 578 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A11. BP912017... CL1368Contig1 Show BP912017 Clone id YMU001_000012_A11 Library YMU01 Length 578 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A11. Accession BP912017 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912017|Adiant...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912017|Adiantum capillus-veneris mRNA

  3. AcEST: BP920178 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A02 473 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A02. BP920178 - Show BP92017...is mRNA. clone: YMU001_000134_A02. Accession BP920178 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017... Res. 25:3389-3402. Query= BP920178|Adiantum capillus-veneris mRNA, clone: YMU001_000134_A02. (473 letters)

  4. AcEST: BP920175 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H09 490 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H09. BP920175 - Show BP92017...is mRNA. clone: YMU001_000133_H09. Accession BP920175 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920175|Adiantum

  5. AcEST: BP920174 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H08 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H08. BP920174 - Show BP92017...is mRNA. clone: YMU001_000133_H08. Accession BP920174 Tissue type prothallium Developmental stage - Contig I... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92017

  6. AcEST: BP913036 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_F11 458 Adiantum capillus-veneris mRNA. clone: YMU001_000025_F11. BP913036 - Show BP91303...is mRNA. clone: YMU001_000025_F11. Accession BP913036 Tissue type prothallium Developmental stage - Contig I...25:3389-3402. Query= BP913036|Adiantum capillus-veneris mRNA, clone: YMU001_00002...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303

  7. AcEST: BP913037 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_F12 436 Adiantum capillus-veneris mRNA. clone: YMU001_000025_F12. BP913037 - Show BP91303...is mRNA. clone: YMU001_000025_F12. Accession BP913037 Tissue type prothallium Developmental stage - Contig I...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913037|Adiantum capillus-veneris mR

  8. AcEST: BP912303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_E02 524 Adiantum capillus-veneris mRNA. clone: YMU001_000017_E02. BP912303 - Show BP912303...is mRNA. clone: YMU001_000017_E02. Accession BP912303 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP912303|Adiantum capillus-veneris mRNA, clone: YMU001_000017_E02. (524 l...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912303|Adiantum capillus-veneris mRNA, clon

  9. AcEST: BP921303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000148_B08 459 Adiantum capillus-veneris mRNA. clone: YMU001_000148_B08. BP921303 - Show BP921303...is mRNA. clone: YMU001_000148_B08. Accession BP921303 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP921303|Adiantum capillus-veneris mRNA, clone: YMU001_000148_B...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921303

  10. AcEST: BP913031 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_F06 302 Adiantum capillus-veneris mRNA. clone: YMU001_000025_F06. BP91303...1 CL1500Contig1 Show BP913031 Clone id YMU001_000025_F06 Library YMU01 Length 302 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000025_F06. Accession BP913031 Tissue type prothallium Developmental stag...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91303

  11. AcEST: BP913303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_G07 539 Adiantum capillus-veneris mRNA. clone: YMU001_000028_G07. BP913303 - Show BP913303...is mRNA. clone: YMU001_000028_G07. Accession BP913303 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913303...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913303

  12. AcEST: BP914303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_D07 644 Adiantum capillus-veneris mRNA. clone: YMU001_000057_D07. BP914303... CL2270Contig1 Show BP914303 Clone id YMU001_000057_D07 Library YMU01 Length 644 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000057_D07. Accession BP914303 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914303|Adiantum capillus-veneri...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914303

  13. AcEST: BP913038 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000025_G01 564 Adiantum capillus-veneris mRNA. clone: YMU001_000025_G01. BP91303...8 CL793Contig1 Show BP913038 Clone id YMU001_000025_G01 Library YMU01 Length 564 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000025_G01. Accession BP913038 Tissue type prothallium Developmental stage...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913038|Adiant...Nucleic Acids Res. 25:3389-3402. Query= BP913038|Adiantum capillus-veneris mRNA, clone: YMU001_000025_G01. (

  14. AcEST: BP918303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_H04 288 Adiantum capillus-veneris mRNA. clone: YMU001_000111_H04. BP918303 - Show BP918303...is mRNA. clone: YMU001_000111_H04. Accession BP918303 Tissue type prothallium Developmental stage - Contig I... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918303|Adiantum capillus-veneris mRNA, clone: YM...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918303|

  15. AcEST: BP920303 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000135_E01 493 Adiantum capillus-veneris mRNA. clone: YMU001_000135_E01. BP920303 - Show BP920303...is mRNA. clone: YMU001_000135_E01. Accession BP920303 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920303...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920303|Adiantum capillus-

  16. AcEST: BP918043 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A02 493 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A02. BP91804...3 CL3885Contig1 Show BP918043 Clone id YMU001_000109_A02 Library YMU01 Length 493 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A02. Accession BP918043 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804

  17. AcEST: BP918040 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_H10 167 Adiantum capillus-veneris mRNA. clone: YMU001_000108_H10. BP918040 - Show BP91804...is mRNA. clone: YMU001_000108_H10. Accession BP918040 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918040|Adiantum capillus-veneris mRNA, clone: YMU001.... 25:3389-3402. Query= BP918040|Adiantum capillus-veneris mRNA, clone: YMU001_000108_H10. (167 letters) Data

  18. AcEST: BP911804 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_D03 453 Adiantum capillus-veneris mRNA. clone: YMU001_000009_D03. BP911804... CL245Contig1 Show BP911804 Clone id YMU001_000009_D03 Library YMU01 Length 453 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000009_D03. Accession BP911804 Tissue type prothallium Developmental stage...s Res. 25:3389-3402. Query= BP911804|Adiantum capillus-veneris mRNA, clone: YMU00... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911804|Adiantum capil

  19. AcEST: BP918044 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A03 150 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A03. BP918044 - Show BP91804...is mRNA. clone: YMU001_000109_A03. Accession BP918044 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918044|Adiantum cap

  20. AcEST: BP918047 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A06 349 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A06. BP91804...7 CL1525Contig1 Show BP918047 Clone id YMU001_000109_A06 Library YMU01 Length 349 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A06. Accession BP918047 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918047|Adiantum capillus-veneris mRNA...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918047|Adian

  1. AcEST: BP918045 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A04 467 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A04. BP91804...5 CL1689Contig1 Show BP918045 Clone id YMU001_000109_A04 Library YMU01 Length 467 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A04. Accession BP918045 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP918045|Adiantum capillus-ven...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918045|Adiantum capillus-veneris

  2. AcEST: BP918041 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_H11 404 Adiantum capillus-veneris mRNA. clone: YMU001_000108_H11. BP918041 - Show BP91804...is mRNA. clone: YMU001_000108_H11. Accession BP918041 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918041|Adiantum c...eic Acids Res. 25:3389-3402. Query= BP918041|Adiantum capillus-veneris mRNA, clone: YMU001_000108_H11. (404

  3. AcEST: BP918048 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A07 409 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A07. BP918048 - Show BP91804...is mRNA. clone: YMU001_000109_A07. Accession BP918048 Tissue type prothallium Developmental stage - Contig I...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91804

  4. AcEST: BP918046 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A05 481 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A05. BP91804...6 CL10Contig1 Show BP918046 Clone id YMU001_000109_A05 Library YMU01 Length 481 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000109_A05. Accession BP918046 Tissue type prothallium Developmental stage ...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918046|Adi...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918046|Adiantum capillus-v

  5. AcEST: BP918049 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000109_A08 458 Adiantum capillus-veneris mRNA. clone: YMU001_000109_A08. BP91804...9 CL2636Contig1 Show BP918049 Clone id YMU001_000109_A08 Library YMU01 Length 458 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000109_A08. Accession BP918049 Tissue type prothallium Developmental stag...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918049|Adiantum capill...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918049|Adiantum ca

  6. AcEST: BP921260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_F02 609 Adiantum capillus-veneris mRNA. clone: YMU001_000147_F02. BP921260 - Show BP921260...is mRNA. clone: YMU001_000147_F02. Accession BP921260 Tissue type prothallium Developmental stage - Contig I...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921260...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP921260|Adiantum capillus-vener

  7. AcEST: BP913260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000028_C08 256 Adiantum capillus-veneris mRNA. clone: YMU001_000028_C08. BP913260 - Show BP913260...is mRNA. clone: YMU001_000028_C08. Accession BP913260 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913260|Adiantum capillus-veneris mRNA, clone: YMU00...25:3389-3402. Query= BP913260|Adiantum capillus-veneris mRNA, clone: YMU001_000028_C08. (256 letters) Databa

  8. AcEST: BP912607 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H02 459 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H02. BP912607 - Show BP91260...is mRNA. clone: YMU001_000020_H02. Accession BP912607 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912607|Adiantum capill...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260

  9. AcEST: BP912604 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G11 244 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G11. BP912604 - Show BP91260...is mRNA. clone: YMU001_000020_G11. Accession BP912604 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP912604|Adiantum capillus-veneris mRNA, clone: YMU001_000020_G11...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260

  10. AcEST: BP919260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000123_A09 469 Adiantum capillus-veneris mRNA. clone: YMU001_000123_A09. BP919260 - Show BP919260...is mRNA. clone: YMU001_000123_A09. Accession BP919260 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919260|Adiantum capillu...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919260...ed signal transduction protein OS=Uncultured methanogenic archaeon RC-I GN=UNCMA_12260

  11. AcEST: BP918260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_D07 541 Adiantum capillus-veneris mRNA. clone: YMU001_000111_D07. BP918260 - Show BP918260...is mRNA. clone: YMU001_000111_D07. Accession BP918260 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP918260|Adiantum capillus-veneris mRNA, clone: YMU001_000111_D07. (521 letters.... 25:3389-3402. Query= BP918260|Adiantum capillus-veneris mRNA, clone: YMU001_000111_D07. (521 letters) Data

  12. AcEST: BP912605 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G12 437 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G12. BP91260...5 CL1961Contig1 Show BP912605 Clone id YMU001_000020_G12 Library YMU01 Length 437 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000020_G12. Accession BP912605 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912605|Adiantum capillus-veneris mRNA, clone: YMU001_000020_G

  13. AcEST: BP912608 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H03 451 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H03. BP912608 - Show BP91260...is mRNA. clone: YMU001_000020_H03. Accession BP912608 Tissue type prothallium Developmental stage - Contig I...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91260...programs, Nucleic Acids Res. 25:3389-3402. Query= BP912608|Adiantum capillus-veneris mRNA, clone: YMU001_000

  14. AcEST: BP916260 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000085_C09 277 Adiantum capillus-veneris mRNA. clone: YMU001_000085_C09. BP916260 - Show BP916260...is mRNA. clone: YMU001_000085_C09. Accession BP916260 Tissue type prothallium Developmental stage - Contig I...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916260|Adiantum capillus-vene...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916260

  15. AcEST: BP912600 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G07 375 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G07. BP91260...0 CL1497Contig1 Show BP912600 Clone id YMU001_000020_G07 Library YMU01 Length 375 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000020_G07. Accession BP912600 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912600|Adiantum capillus-vener...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912600|Adiantum capillus-vener

  16. AcEST: BP912601 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_G08 479 Adiantum capillus-veneris mRNA. clone: YMU001_000020_G08. BP912601 - Show BP91260...is mRNA. clone: YMU001_000020_G08. Accession BP912601 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912601|Adiantum capillus-veneris m...ids Res. 25:3389-3402. Query= BP912601|Adiantum capillus-veneris mRNA, clone: YMU...SG-DTEDIHYQTITGLRKDLSGPSQEPSILTEQAIEDDSED 415 Query: 298 FLPVKANDQADDE 260 +++D +D E Sbjct: 416 SSSTESSDDSDT

  17. AcEST: BP919845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G11 376 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G11. BP919845 - Show BP91984...is mRNA. clone: YMU001_000129_G11. Accession BP919845 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G1...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus

  18. AcEST: BP919847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H01 512 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H01. BP919847 - Show BP91984...is mRNA. clone: YMU001_000129_H01. Accession BP919847 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91984...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919847|Adiantum capillus-veneris mRNA, clone: YMU0

  19. AcEST: BP919849 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H04 454 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H04. BP919849 - Show BP91984...is mRNA. clone: YMU001_000129_H04. Accession BP919849 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_00...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  20. AcEST: BP919842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G07. BP919842 - Show BP91984...is mRNA. clone: YMU001_000129_G07. Accession BP919842 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris m...c Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G07. (567 le

  1. AcEST: BP911984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F07 566 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F07. BP911984... CL2332Contig1 Show BP911984 Clone id YMU001_000011_F07 Library YMU01 Length 566 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_F07. Accession BP911984 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984|Adiantum capillus-veneris mR...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984

  2. AcEST: BP919843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G09 473 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G09. BP91984...3 CL2697Contig1 Show BP919843 Clone id YMU001_000129_G09 Library YMU01 Length 473 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G09. Accession BP919843 Tissue type prothallium Developmental stag...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Ad...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Adiantum capillus-veneris

  3. AcEST: BP919840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G05. BP919840 - Show BP91984...is mRNA. clone: YMU001_000129_G05. Accession BP919840 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_...es. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_0

  4. AcEST: BP921403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000149_D11 544 Adiantum capillus-veneris mRNA. clone: YMU001_000149_D11. BP921403... CL10Contig1 Show BP921403 Clone id YMU001_000149_D11 Library YMU01 Length 544 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000149_D11. Accession BP921403 Tissue type prothallium Developmental stage ...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP921403|Adiantum capillus-veneris mRNA, clone: YMU001_0...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921403

  5. AcEST: BP914032 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B03 607 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B03. BP914032 - Show BP91403...is mRNA. clone: YMU001_000039_B03. Accession BP914032 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914032|Adiantum...programs, Nucleic Acids Res. 25:3389-3402. Query= BP914032|Adiantum capillus-veneris mRNA, clone: YMU001_000

  6. AcEST: BP914403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E06 616 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E06. BP914403 - Show BP914403...is mRNA. clone: YMU001_000058_E06. Accession BP914403 Tissue type prothallium Developmental stage - Contig I...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914403... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914403|Adiantum capillus-veneris mRNA, clone: YM...VEENATMHLPSLILILMKTCLD--PSISGKVTE 219 L D+ W + R +N TMHL ++ LM+ CLD P I+ V E Sbjct: 403

  7. AcEST: BP914034 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B05 392 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B05. BP91403...4 CL1150Contig1 Show BP914034 Clone id YMU001_000039_B05 Library YMU01 Length 392 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_B05. Accession BP914034 Tissue type prothallium Developmental stag...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914034|Adiantum capillus...s Res. 25:3389-3402. Query= BP914034|Adiantum capillus-veneris mRNA, clone: YMU00

  8. AcEST: BP914035 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B07 572 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B07. BP914035 - Show BP91403...is mRNA. clone: YMU001_000039_B07. Accession BP914035 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP914035|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP914035|Adiantum capillus-veneris mRNA, clone: YMU001_000039_B07.

  9. AcEST: BP914037 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B09 437 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B09. BP914037 - Show BP91403...is mRNA. clone: YMU001_000039_B09. Accession BP914037 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914037|Adia... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914037|Adia

  10. AcEST: BP914039 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B11 577 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B11. BP91403...9 CL791Contig1 Show BP914039 Clone id YMU001_000039_B11 Library YMU01 Length 577 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_B11. Accession BP914039 Tissue type prothallium Developmental stage... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914039|Adiantum capillus-ven...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91403

  11. AcEST: BP914030 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_A12 427 Adiantum capillus-veneris mRNA. clone: YMU001_000039_A12. BP914030 - Show BP91403...is mRNA. clone: YMU001_000039_A12. Accession BP914030 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP914030|Adiantum capillus-veneris mRNA, clone: YMU0...WNALISGFTVHLHGDGALQCYEQMRQEGF 403 VSWN +ISG++++ A++ + +M++ Sbjct: 211 WNVMIDGYMRL...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914030|Adiantum capillus-v

  12. AcEST: BP916403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_C10 523 Adiantum capillus-veneris mRNA. clone: YMU001_000087_C10. BP916403... CL144Contig1 Show BP916403 Clone id YMU001_000087_C10 Library YMU01 Length 523 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000087_C10. Accession BP916403 Tissue type prothallium Developmental stage...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916403... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916403|Adiantum c

  13. AcEST: BP919403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G01 499 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G01. BP919403 - Show BP919403...is mRNA. clone: YMU001_000124_G01. Accession BP919403 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919403|Adiantum capillus-veneris mRNA, clone: YMU001_000124_G01. (499 letters) Dat...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919403

  14. AcEST: BP912403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F06 462 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F06. BP912403 - Show BP912403...is mRNA. clone: YMU001_000018_F06. Accession BP912403 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP912403|Adiantum capillus-veneris m...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912403|

  15. AcEST: BP915403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B08 567 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B08. BP915403 - Show BP915403...is mRNA. clone: YMU001_000071_B08. Accession BP915403 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP915403|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B08. (567 letters) Dat...s, Nucleic Acids Res. 25:3389-3402. Query= BP915403|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B08

  16. AcEST: BP918403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B03 531 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B03. BP918403 - Show BP918403...is mRNA. clone: YMU001_000113_B03. Accession BP918403 Tissue type prothallium Developmental stage - Contig I...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918403...ucleic Acids Res. 25:3389-3402. Query= BP918403|Adiantum capillus-veneris mRNA, clone: YMU001_000113_B03. (5

  17. AcEST: BP914444 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000059_A03 493 Adiantum capillus-veneris mRNA. clone: YMU001_000059_A03. BP914444... CL1628Contig1 Show BP914444 Clone id YMU001_000059_A03 Library YMU01 Length 493 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000059_A03. Accession BP914444 Tissue type prothallium Developmental stag...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914444... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914444|Adiantum capillus-veneri

  18. AcEST: BP915008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D10 581 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D10. BP915008 - Show BP91500...is mRNA. clone: YMU001_000065_D10. Accession BP915008 Tissue type prothallium Developmental stage - Contig I...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP915008|Adiantum capillus-veneris mRNA, clone: YMU001_0000...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915008|Adiant

  19. AcEST: BP917500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_F01 537 Adiantum capillus-veneris mRNA. clone: YMU001_000101_F01. BP917500 - Show BP917500...is mRNA. clone: YMU001_000101_F01. Accession BP917500 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP917500|Adiantum capillus-veneris mRNA, clone: YMU001_000101...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917500|Adiantum capillus-veneris

  20. AcEST: BP915500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000072_D04 497 Adiantum capillus-veneris mRNA. clone: YMU001_000072_D04. BP915500... CL2883Contig1 Show BP915500 Clone id YMU001_000072_D04 Library YMU01 Length 497 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000072_D04. Accession BP915500 Tissue type prothallium Developmental stag...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915500...programs, Nucleic Acids Res. 25:3389-3402. Query= BP915500|Adiantum capillus-veneris mRNA, clone: YMU001_000

  1. AcEST: BP915002 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D03 491 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D03. BP91500...2 CL2712Contig1 Show BP915002 Clone id YMU001_000065_D03 Library YMU01 Length 491 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000065_D03. Accession BP915002 Tissue type prothallium Developmental stag...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91500...grams, Nucleic Acids Res. 25:3389-3402. Query= BP915002|Adiantum capillus-veneris

  2. AcEST: BP915009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_D11 575 Adiantum capillus-veneris mRNA. clone: YMU001_000065_D11. BP915009 - Show BP91500...is mRNA. clone: YMU001_000065_D11. Accession BP915009 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915009|Adiantum capillus-veneris mRNA, clone: ...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915009|

  3. AcEST: BP920500 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_G11 581 Adiantum capillus-veneris mRNA. clone: YMU001_000137_G11. BP920500... CL3073Contig1 Show BP920500 Clone id YMU001_000137_G11 Library YMU01 Length 581 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000137_G11. Accession BP920500 Tissue type prothallium Developmental stag...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920500...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920500|Adiantum capill

  4. AcEST: BP921010 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E04 526 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E04. BP921010 - Show BP921010...is mRNA. clone: YMU001_000144_E04. Accession BP921010 Tissue type prothallium Developmental stage - Contig I...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA...programs, Nucleic Acids Res. 25:3389-3402. Query= BP921010|Adiantum capillus-veneris mRNA, clone: YMU001_000...002030-PA (Fragment) OS=Anopheles gambiae GN=AGAP002030 PE=4 SV=4 Length = 2210 S

  5. AcEST: BP915555 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_A05 516 Adiantum capillus-veneris mRNA. clone: YMU001_000073_A05. BP915555 - Show BP915555...is mRNA. clone: YMU001_000073_A05. Accession BP915555 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915555... Acids Res. 25:3389-3402. Query= BP915555|Adiantum capillus-veneris mRNA, clone: YMU001_000073_A05. (516 let

  6. AcEST: BP919975 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_E02 472 Adiantum capillus-veneris mRNA. clone: YMU001_000131_E02. BP919975 - Show BP919975...is mRNA. clone: YMU001_000131_E02. Accession BP919975 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP919975|Adiantum capillus-veneris mRNA, clone: YMU...cids Res. 25:3389-3402. Query= BP919975|Adiantum capillus-veneris mRNA, clone: YM

  7. AcEST: BP920157 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G01 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G01. BP92015...7 CL541Contig1 Show BP920157 Clone id YMU001_000133_G01 Library YMU01 Length 550 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_G01. Accession BP920157 Tissue type prothallium Developmental stage...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris mRNA,...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920157|Adiantum capillus-veneris

  8. AcEST: BP920152 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F06 457 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F06. BP920152 - Show BP92015...is mRNA. clone: YMU001_000133_F06. Accession BP920152 Tissue type prothallium Developmental stage - Contig I...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920152|Adiantu...Res. 25:3389-3402. Query= BP920152|Adiantum capillus-veneris mRNA, clone: YMU001_

  9. AcEST: BP920159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G03 420 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G03. BP920159 - Show BP92015...is mRNA. clone: YMU001_000133_G03. Accession BP920159 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92015

  10. AcEST: BP920153 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F08 540 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F08. BP920153 - Show BP92015...is mRNA. clone: YMU001_000133_F08. Accession BP920153 Tissue type prothallium Developmental stage - Contig I...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-veneris mRNA, clone: YMU...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920153|Adiantum capillus-ve

  11. AcEST: BP920156 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F12 587 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F12. BP92015...6 CL200Contig1 Show BP920156 Clone id YMU001_000133_F12 Library YMU01 Length 587 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_F12. Accession BP920156 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920156|Adiantum

  12. AcEST: BP920150 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F04 550 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F04. BP920150 - Show BP92015...is mRNA. clone: YMU001_000133_F04. Accession BP920150 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 lette...c Acids Res. 25:3389-3402. Query= BP920150|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F04. (550 le

  13. AcEST: BP920856 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000142_E09 470 Adiantum capillus-veneris mRNA. clone: YMU001_000142_E09. BP920856... CL4215Contig1 Show BP920856 Clone id YMU001_000142_E09 Library YMU01 Length 470 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000142_E09. Accession BP920856 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920856|Adiantum capillus-... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920856|Adiantum capil

  14. AcEST: BP920000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G10 490 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G10. BP920000 - Show BP920000...is mRNA. clone: YMU001_000131_G10. Accession BP920000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920000...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920000|Adiantum capil

  15. AcEST: BP920127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_D02 541 Adiantum capillus-veneris mRNA. clone: YMU001_000133_D02. BP92012...7 CL3843Contig1 Show BP920127 Clone id YMU001_000133_D02 Library YMU01 Length 541 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_D02. Accession BP920127 Tissue type prothallium Developmental stag...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920127|Adian

  16. AcEST: BP920124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C09 380 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C09. BP920124 - Show BP92012...is mRNA. clone: YMU001_000133_C09. Accession BP920124 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris ...ic Acids Res. 25:3389-3402. Query= BP920124|Adiantum capillus-veneris mRNA, clone: YMU001_000133_C09. (380 l

  17. AcEST: BP920120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C05 434 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C05. BP920120 - Show BP92012...is mRNA. clone: YMU001_000133_C05. Accession BP920120 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|Ad...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920120|

  18. AcEST: BP920125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_C12 422 Adiantum capillus-veneris mRNA. clone: YMU001_000133_C12. BP920125 - Show BP92012...is mRNA. clone: YMU001_000133_C12. Accession BP920125 Tissue type prothallium Developmental stage - Contig I...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92012

  19. AcEST: BP918377 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G07 508 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G07. BP9183...77 CL44Contig1 Show BP918377 Clone id YMU001_000112_G07 Library YMU01 Length 508 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000112_G07. Accession BP918377 Tissue type prothallium Developmental stage ...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918377|Adi

  20. AcEST: BP918324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B09 441 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B09. BP918324 - Show BP9183...is mRNA. clone: YMU001_000112_B09. Accession BP918324 Tissue type prothallium Developmental stage - Contig I... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918324|Adiantum capillus-veneris

  1. AcEST: BP915183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_E04 303 Adiantum capillus-veneris mRNA. clone: YMU001_000067_E04. BP915183 - Show BP915183...is mRNA. clone: YMU001_000067_E04. Accession BP915183 Tissue type prothallium Developmental stage - Contig I...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915183...es. 25:3389-3402. Query= BP915183|Adiantum capillus-veneris mRNA, clone: YMU001_0

  2. AcEST: BP918359 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_E12 553 Adiantum capillus-veneris mRNA. clone: YMU001_000112_E12. BP9183...59 CL3958Contig1 Show BP918359 Clone id YMU001_000112_E12 Library YMU01 Length 553 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_E12. Accession BP918359 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918359|Adiantum capillus-veneri...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918359|Adiantum capillus-veneris mRNA, clone: Y

  3. AcEST: BP921832 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_F10 448 Adiantum capillus-veneris mRNA. clone: YMU001_000154_F10. BP921832 - Show BP92183...is mRNA. clone: YMU001_000154_F10. Accession BP921832 Tissue type prothallium Developmental stage - Contig I..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183...s, Nucleic Acids Res. 25:3389-3402. Query= BP921832|Adiantum capillus-veneris mRNA, clone: YMU001_000154_F10

  4. AcEST: BP918353 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_E05 498 Adiantum capillus-veneris mRNA. clone: YMU001_000112_E05. BP9183...53 CL2530Contig1 Show BP918353 Clone id YMU001_000112_E05 Library YMU01 Length 498 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_E05. Accession BP918353 Tissue type prothallium Developmental stag...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918353|Adiantum capillus-veneris mRNA, clone: YMU00

  5. AcEST: BP918311 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A08 458 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A08. BP918311 - Show BP9183...is mRNA. clone: YMU001_000112_A08. Accession BP918311 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP918311|Adiantum capillus-veneris mRNA, clone...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918311|Adiantum capillus-veneris m

  6. AcEST: BP919183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_B10 484 Adiantum capillus-veneris mRNA. clone: YMU001_000122_B10. BP919183 - Show BP919183...is mRNA. clone: YMU001_000122_B10. Accession BP919183 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919183|Adiantum capillus-veneris m..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919183

  7. AcEST: BP921836 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_G02 401 Adiantum capillus-veneris mRNA. clone: YMU001_000154_G02. BP921836 - Show BP92183...is mRNA. clone: YMU001_000154_G02. Accession BP921836 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921836|Adiantum capillus-vener...s. 25:3389-3402. Query= BP921836|Adiantum capillus-veneris mRNA, clone: YMU001_000154_G02. (401 letters) Dat...GWEDVTRNSIGLIHSLEEDGDVGIAFCFRSKPFRCSVTDVEKVPPFEVG 1183 Score = 45.4 bits (106), Expect(2) = 9e-05 Identities

  8. AcEST: BP921837 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_G03 210 Adiantum capillus-veneris mRNA. clone: YMU001_000154_G03. BP921837 - Show BP92183...is mRNA. clone: YMU001_000154_G03. Accession BP921837 Tissue type prothallium Developmental stage - Contig I... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921837|Adiantum capillus-veneris mRNA, clone: YMU0

  9. AcEST: BP918348 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D12 438 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D12. BP9183...48 CL3952Contig1 Show BP918348 Clone id YMU001_000112_D12 Library YMU01 Length 438 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_D12. Accession BP918348 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP918348|Adiantum capillus-veneris mRNA, clone: YMU0...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  10. AcEST: BP918328 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C02 530 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C02. BP918328 - Show BP9183...is mRNA. clone: YMU001_000112_C02. Accession BP918328 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918328|Adiantum capillus-veneris...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918328|Adian

  11. AcEST: BP918368 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F10 559 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F10. BP918368 - Show BP9183...is mRNA. clone: YMU001_000112_F10. Accession BP918368 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918368|Adiantum capillus-veneris mRNA, clone: YMU001_000112_...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918368

  12. AcEST: BP918339 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D02 499 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D02. BP918339 - Show BP9183...is mRNA. clone: YMU001_000112_D02. Accession BP918339 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918339|Adiantum capillus-veneris mRNA, c

  13. AcEST: BP918316 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B01 479 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B01. BP9183...16 CL1887Contig1 Show BP918316 Clone id YMU001_000112_B01 Library YMU01 Length 479 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_B01. Accession BP918316 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918316|Adia...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  14. AcEST: BP918333 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C07 551 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C07. BP918333 - Show BP9183...is mRNA. clone: YMU001_000112_C07. Accession BP918333 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918333|Adiantum capillus-veneris mRNA, clone: YMU001_000112_C07. (5... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  15. AcEST: BP921830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_F08 494 Adiantum capillus-veneris mRNA. clone: YMU001_000154_F08. BP92183...0 CL1991Contig1 Show BP921830 Clone id YMU001_000154_F08 Library YMU01 Length 494 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000154_F08. Accession BP921830 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183...AST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183

  16. AcEST: BP918392 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A02 381 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A02. BP918392 - Show BP9183...is mRNA. clone: YMU001_000113_A02. Accession BP918392 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918392|Adiantum capillus-veneris ...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918392|...TAKLGPNVSISANARIGPGVRLVGCIILDDVEIKEN 355 Query: 183 KCCDNALYHWMEVL-HWKMRQ---EYRESAIMLPNWE*QYLVKMFLCEDEVVVTSC

  17. AcEST: BP918372 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G02 505 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G02. BP918372 - Show BP9183...is mRNA. clone: YMU001_000112_G02. Accession BP918372 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918372... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918372|Adia

  18. AcEST: BP921833 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_F11 469 Adiantum capillus-veneris mRNA. clone: YMU001_000154_F11. BP921833 - Show BP92183...is mRNA. clone: YMU001_000154_F11. Accession BP921833 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921833|Adiantum capillus-veneris mRNA, clone: YMU00...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92183

  19. AcEST: BP918300 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_H01 559 Adiantum capillus-veneris mRNA. clone: YMU001_000111_H01. BP918300 - Show BP9183...is mRNA. clone: YMU001_000111_H01. Accession BP918300 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918300|Adiantum capillus-veneris mRNA, c...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  20. AcEST: BP913183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_D11 553 Adiantum capillus-veneris mRNA. clone: YMU001_000027_D11. BP913183 - Show BP913183...is mRNA. clone: YMU001_000027_D11. Accession BP913183 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913183|Adiantum capillus-veneris ...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913183

  1. AcEST: BP917183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_D01 417 Adiantum capillus-veneris mRNA. clone: YMU001_000097_D01. BP917183 - Show BP917183...is mRNA. clone: YMU001_000097_D01. Accession BP917183 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917183...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917183|Adiantum capillus-veneris m

  2. AcEST: BP918321 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B06 529 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B06. BP9183...21 CL638Contig1 Show BP918321 Clone id YMU001_000112_B06 Library YMU01 Length 529 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000112_B06. Accession BP918321 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918321|Adiantum capillus-veneris mRNA, clo... Acids Res. 25:3389-3402. Query= BP918321|Adiantum capillus-veneris mRNA, clone:

  3. AcEST: BP918357 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_E09 576 Adiantum capillus-veneris mRNA. clone: YMU001_000112_E09. BP918357 - Show BP9183...is mRNA. clone: YMU001_000112_E09. Accession BP918357 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918357|Adiantum capillus-veneris mRNA, c...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918357|Adiantum capillus

  4. AcEST: BP918319 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_B04 586 Adiantum capillus-veneris mRNA. clone: YMU001_000112_B04. BP918319 - Show BP9183...is mRNA. clone: YMU001_000112_B04. Accession BP918319 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918319|Adiantum...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918319|Adiantu

  5. AcEST: BP918340 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D03 538 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D03. BP918340 - Show BP9183...is mRNA. clone: YMU001_000112_D03. Accession BP918340 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP918340|Adiantum capillus-veneris mRNA, clone: YMU001_000112_D03. (524 lett... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  6. AcEST: BP918308 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A05 514 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A05. BP918308 - Show BP9183...is mRNA. clone: YMU001_000112_A05. Accession BP918308 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  7. AcEST: BP918332 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C06 222 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C06. BP918332 - Show BP9183...is mRNA. clone: YMU001_000112_C06. Accession BP918332 Tissue type prothallium Developmental stage - Contig I...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918332|Adiantum capillus-veneris mRNA, clo

  8. AcEST: BP918364 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_F06 521 Adiantum capillus-veneris mRNA. clone: YMU001_000112_F06. BP918364 - Show BP9183...is mRNA. clone: YMU001_000112_F06. Accession BP918364 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...ENAPVEDNVSHFSQ--------LKDQQPATLCYAPPLSTDDTAEILFTSG 183 Query: 372 TTSDPKGVVSSHRGAYIASLTACPVWGLKEGCIYLWTLPLFH...c Acids Res. 25:3389-3402. Query= BP918364|Adiantum capillus-veneris mRNA, clone:

  9. AcEST: BP918397 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A08 462 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A08. BP918397 - Show BP9183...is mRNA. clone: YMU001_000113_A08. Accession BP918397 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918397|Adiantum capillus-veneris mRNA, clone: YM...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918397

  10. AcEST: BP918345 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D08 477 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D08. BP918345 - Show BP9183...is mRNA. clone: YMU001_000112_D08. Accession BP918345 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP918345|Adiantum capillus-veneris mRNA, c... 25:3389-3402. Query= BP918345|Adiantum capillus-veneris mRNA, clone: YMU001_000112_D08. (477 letters) Datab

  11. AcEST: BP918331 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_C05 460 Adiantum capillus-veneris mRNA. clone: YMU001_000112_C05. BP918331 - Show BP9183...is mRNA. clone: YMU001_000112_C05. Accession BP918331 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP918331|Adiantum capillus-veneris mRNA, clone...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  12. AcEST: BP918313 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A10 512 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A10. BP918313 - Show BP9183...is mRNA. clone: YMU001_000112_A10. Accession BP918313 Tissue type prothallium Developmental stage - Contig I...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918313|Adiantum capillus-veneris mRNA, clone: YMU001_000112_A...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918313|Adiantum capillus-veneris mR

  13. AcEST: BP918396 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A07 400 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A07. BP918396 - Show BP9183...is mRNA. clone: YMU001_000113_A07. Accession BP918396 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918396|Adiantum capillus-veneris mRNA, clon... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918396|Adiantum c

  14. AcEST: BP918307 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A04 589 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A04. BP9183...07 CL4210Contig1 Show BP918307 Clone id YMU001_000112_A04 Library YMU01 Length 589 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000112_A04. Accession BP918307 Tissue type prothallium Developmental stag...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918307|Adiantum capi...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918307|Adiantum capillus-veneris

  15. AcEST: BP918375 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G05 494 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G05. BP918375 - Show BP9183...is mRNA. clone: YMU001_000112_G05. Accession BP918375 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918375|Adiantum capillus-...s, Nucleic Acids Res. 25:3389-3402. Query= BP918375|Adiantum capillus-veneris mRN

  16. AcEST: BP918344 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_D07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000112_D07. BP918344 - Show BP9183...is mRNA. clone: YMU001_000112_D07. Accession BP918344 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918344|Adiantum capillus-v

  17. AcEST: BP918373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_G03 522 Adiantum capillus-veneris mRNA. clone: YMU001_000112_G03. BP918373 - Show BP9183...is mRNA. clone: YMU001_000112_G03. Accession BP918373 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183

  18. AcEST: BP918388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_H09 552 Adiantum capillus-veneris mRNA. clone: YMU001_000112_H09. BP918388 - Show BP9183...is mRNA. clone: YMU001_000112_H09. Accession BP918388 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP918388|Adiantum capillus-veneris mRNA, clone: YMU001_000112_H09. (552 let...eic Acids Res. 25:3389-3402. Query= BP918388|Adiantum capillus-veneris mRNA, clone: YMU001_000112_H09. (552

  19. AcEST: BP920183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A07 427 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A07. BP920183 - Show BP920183...is mRNA. clone: YMU001_000134_A07. Accession BP920183 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183...programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183|Adiantum capillus-veneris mRNA, clone: YMU001_000

  20. AcEST: BP918315 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A12 550 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A12. BP918315 - Show BP9183...is mRNA. clone: YMU001_000112_A12. Accession BP918315 Tissue type prothallium Developmental stage - Contig I...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9183...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP918315|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  1. AcEST: BP919570 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_F05 404 Adiantum capillus-veneris mRNA. clone: YMU001_000126_F05. BP91957...0 CL2080Contig1 Show BP919570 Clone id YMU001_000126_F05 Library YMU01 Length 404 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000126_F05. Accession BP919570 Tissue type prothallium Developmental stag...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919570|A... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919570|Adiantum c

  2. AcEST: BP919578 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_G03 472 Adiantum capillus-veneris mRNA. clone: YMU001_000126_G03. BP919578 - Show BP91957...is mRNA. clone: YMU001_000126_G03. Accession BP919578 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP919578|Adiantum capillus-veneris...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919578|Adiantum capillus-veneris mRNA, clone: Y

  3. AcEST: BP919577 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000126_G02 494 Adiantum capillus-veneris mRNA. clone: YMU001_000126_G02. BP91957...7 CL2728Contig1 Show BP919577 Clone id YMU001_000126_G02 Library YMU01 Length 494 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000126_G02. Accession BP919577 Tissue type prothallium Developmental stag...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919577|Adiantum capill...Acids Res. 25:3389-3402. Query= BP919577|Adiantum capillus-veneris mRNA, clone: YMU001_000126_G02. (494 lett

  4. AcEST: BP911957 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_C07 599 Adiantum capillus-veneris mRNA. clone: YMU001_000011_C07. BP911957... CL144Contig1 Show BP911957 Clone id YMU001_000011_C07 Library YMU01 Length 599 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000011_C07. Accession BP911957 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911957|Adiantum capillus-ve... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911957|Adiant

  5. AcEST: BP916000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000081_G02 533 Adiantum capillus-veneris mRNA. clone: YMU001_000081_G02. BP916000 - Show BP916000...is mRNA. clone: YMU001_000081_G02. Accession BP916000 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916000...s Res. 25:3389-3402. Query= BP916000|Adiantum capillus-veneris mRNA, clone: YMU001_000081_G02. (533 letters)

  6. AcEST: BP912094 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_A09 564 Adiantum capillus-veneris mRNA. clone: YMU001_000015_A09. BP9120...94 CL2967Contig1 Show BP912094 Clone id YMU001_000015_A09 Library YMU01 Length 564 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_A09. Accession BP912094 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912094|Adiantum c...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  7. AcEST: BP912057 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E09 528 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E09. BP9120...57 CL1892Contig1 Show BP912057 Clone id YMU001_000012_E09 Library YMU01 Length 528 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_E09. Accession BP912057 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP912057|Adiantum capillus-veneris mRNA, clone: YMU001_000012_E09. (528 lett... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  8. AcEST: BP921209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A04 535 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A04. BP921209 - Show BP92120...is mRNA. clone: YMU001_000147_A04. Accession BP921209 Tissue type prothallium Developmental stage - Contig I...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92120...grams, Nucleic Acids Res. 25:3389-3402. Query= BP921209|Adiantum capillus-veneris mRNA, clone: YMU001_000147

  9. AcEST: BP912061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_F01 532 Adiantum capillus-veneris mRNA. clone: YMU001_000012_F01. BP912061 - Show BP9120...is mRNA. clone: YMU001_000012_F01. Accession BP912061 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  10. AcEST: BP912036 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_C09 555 Adiantum capillus-veneris mRNA. clone: YMU001_000012_C09. BP912036 - Show BP9120...is mRNA. clone: YMU001_000012_C09. Accession BP912036 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP912036|Adiantum capillus-veneris mRNA, clone: YMU001_000012_C0... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912036|Adiantum capillus-ven

  11. AcEST: BP912025 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_B09 484 Adiantum capillus-veneris mRNA. clone: YMU001_000012_B09. BP9120...25 CL1441Contig1 Show BP912025 Clone id YMU001_000012_B09 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_B09. Accession BP912025 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  12. AcEST: BP912042 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_D05 541 Adiantum capillus-veneris mRNA. clone: YMU001_000012_D05. BP912042 - Show BP9120...is mRNA. clone: YMU001_000012_D05. Accession BP912042 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP912042|Adiantum capillus-veneris mRNA, clone: YMU001_000012_D05. (541 le...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912042|Adiantum capil

  13. AcEST: BP921208 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A03 436 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A03. BP921208 - Show BP92120...is mRNA. clone: YMU001_000147_A03. Accession BP921208 Tissue type prothallium Developmental stage - Contig I..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92120... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921208|Adiantum c

  14. AcEST: BP912056 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E08 538 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E08. BP912056 - Show BP9120...is mRNA. clone: YMU001_000012_E08. Accession BP912056 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912056|Adiantum capillus-veneris mRNA, clone... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9120

  15. AcEST: BP921120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000146_A02 427 Adiantum capillus-veneris mRNA. clone: YMU001_000146_A02. BP921120 - Show BP921120...is mRNA. clone: YMU001_000146_A02. Accession BP921120 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP921120|Adiantum capillus-veneris mRNA, clone: ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921120|Adian

  16. AcEST: BP912009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A03 561 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A03. BP912009 - Show BP9120...is mRNA. clone: YMU001_000012_A03. Accession BP912009 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP912009|Adiantum capillus-veneris mRNA, clone: YMU001_000012_A03... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912009|Adian

  17. AcEST: BP912030 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_C03 525 Adiantum capillus-veneris mRNA. clone: YMU001_000012_C03. BP912030 - Show BP9120...is mRNA. clone: YMU001_000012_C03. Accession BP912030 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912030|Ad...cids Res. 25:3389-3402. Query= BP912030|Adiantum capillus-veneris mRNA, clone: YMU001_000012_C03. (513 lette

  18. AcEST: BP912050 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_E01 544 Adiantum capillus-veneris mRNA. clone: YMU001_000012_E01. BP912050 - Show BP9120...is mRNA. clone: YMU001_000012_E01. Accession BP912050 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912050|Adiantum capillus-veneris mRNA, c.... 25:3389-3402. Query= BP912050|Adiantum capillus-veneris mRNA, clone: YMU001_000

  19. AcEST: BP915615 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000073_F08 475 Adiantum capillus-veneris mRNA. clone: YMU001_000073_F08. BP915615... CL3512Contig1 Show BP915615 Clone id YMU001_000073_F08 Library YMU01 Length 475 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000073_F08. Accession BP915615 Tissue type prothallium Developmental stag...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915615|Adiantum capill...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915615|Adiantum capillus-veneris mRNA, clon

  20. AcEST: BP915815 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_C11 552 Adiantum capillus-veneris mRNA. clone: YMU001_000077_C11. BP915815... CL3742Contig1 Show BP915815 Clone id YMU001_000077_C11 Library YMU01 Length 552 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000077_C11. Accession BP915815 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915815|Adiantum capillus-veneris mRNA, clone: YMU001... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915815|Adiant

  1. AcEST: BP915155 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_B08 468 Adiantum capillus-veneris mRNA. clone: YMU001_000067_B08. BP91515...5 CL2592Contig1 Show BP915155 Clone id YMU001_000067_B08 Library YMU01 Length 468 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000067_B08. Accession BP915155 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915155|Adiantum capillus-ven...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915

  2. AcEST: BP917474 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_C07 287 Adiantum capillus-veneris mRNA. clone: YMU001_000101_C07. BP917474... CL2332Contig1 Show BP917474 Clone id YMU001_000101_C07 Library YMU01 Length 287 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000101_C07. Accession BP917474 Tissue type prothallium Developmental stag...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917474|Adiantum capil...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917474|Adiantum capillus-veneris mRNA, clone: YMU001_

  3. Analysis list: Irf2bp2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Irf2bp2 Blood + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Irf2bp2.1....tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Irf2bp2.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Irf...2bp2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Irf2bp2.Blood.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Blood.gml ...

  4. AcEST: BP921521 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000150_H10 495 Adiantum capillus-veneris mRNA. clone: YMU001_000150_H10. BP921521... CL1722Contig1 Show BP921521 Clone id YMU001_000150_H10 Library YMU01 Length 495 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000150_H10. Accession BP921521 Tissue type prothallium Developmental stag... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921521|Adia

  5. AcEST: BP921219 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B05 600 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B05. BP92121...9 CL3191Contig1 Show BP921219 Clone id YMU001_000147_B05 Library YMU01 Length 600 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000147_B05. Accession BP921219 Tissue type prothallium Developmental stag...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921219|Adiantum capillus-...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  6. AcEST: BP921216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B01 347 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B01. BP921216 - Show BP92121...is mRNA. clone: YMU001_000147_B01. Accession BP921216 Tissue type prothallium Developmental stage - Contig I... programs, Nucleic Acids Res. 25:3389-3402. Query= BP921216|Adiantum capillus-veneris mRNA, clone: YMU001_00...tities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 116 LLQTLIVTGYISFDEHLHNPHLSKHSALHITK 21 L LI...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92121

  7. AcEST: BP921211 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A08 189 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A08. BP921211 - Show BP92121...is mRNA. clone: YMU001_000147_A08. Accession BP921211 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921211|Adiantum capillus-veneris... 25:3389-3402. Query= BP921211|Adiantum capillus-veneris mRNA, clone: YMU001_000147_A08. (189 letters) Datab

  8. AcEST: BP921821 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_E10 497 Adiantum capillus-veneris mRNA. clone: YMU001_000154_E10. BP921821 - Show BP921821...is mRNA. clone: YMU001_000154_E10. Accession BP921821 Tissue type prothallium Developmental stage - Contig I...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capill...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921821|Adiantum capillus-veneris mRNA, clone: Y...ct: 159 PTSLIQPSIVTSKKEETGIDEIIRGMRDLQIKFAKLEEKGQSPRISTKQKPRLMEGVVHR 218 Query: 237 CIWCDSTDHGRRDC 196 C+WCD+ DH RR+C Sbjct: 21

  9. AcEST: BP921021 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_F03 449 Adiantum capillus-veneris mRNA. clone: YMU001_000144_F03. BP921021... CL4025Contig1 Show BP921021 Clone id YMU001_000144_F03 Library YMU01 Length 449 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_F03. Accession BP921021 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRNA, clone: Y...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921021|Adiantum capillus-veneris mRN

  10. AcEST: BP915100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000066_E04 551 Adiantum capillus-veneris mRNA. clone: YMU001_000066_E04. BP915100... CL3103Contig1 Show BP915100 Clone id YMU001_000066_E04 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000066_E04. Accession BP915100 Tissue type prothallium Developmental stag...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915100|Adiantum capillu...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915100|Adiantum capillus-veneris mRNA, clone: YMU001

  11. AcEST: BP919100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_C03 561 Adiantum capillus-veneris mRNA. clone: YMU001_000121_C03. BP919100 - Show BP919100...is mRNA. clone: YMU001_000121_C03. Accession BP919100 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP919100|Adiantum capillus-veneris mRNA, clone: YMU001_000121_C03. (5...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919100

  12. AcEST: BP921003 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D08 457 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D08. BP92100...3 CL1992Contig1 Show BP921003 Clone id YMU001_000144_D08 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D08. Accession BP921003 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP921003|Adiantum capillus-veneris mRNA, clone: YMU0...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921003|Adiantum capillus-vener

  13. AcEST: BP921006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D12 494 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D12. BP921006 - Show BP92100...is mRNA. clone: YMU001_000144_D12. Accession BP921006 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921006|Adiantum capillus-...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP921006|Adiantum capillus-veneris mRNA, clone: YMU001_

  14. AcEST: BP917100 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_H06 514 Adiantum capillus-veneris mRNA. clone: YMU001_000095_H06. BP917100 - Show BP917100...is mRNA. clone: YMU001_000095_H06. Accession BP917100 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917100|... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917100

  15. AcEST: BP921007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_E01 460 Adiantum capillus-veneris mRNA. clone: YMU001_000144_E01. BP92100...7 CL57Contig1 Show BP921007 Clone id YMU001_000144_E01 Library YMU01 Length 460 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_E01. Accession BP921007 Tissue type prothallium Developmental stage ...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921007|Adiantum capill... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921007|Adiantum capillus-veneri

  16. AcEST: BP917432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_G02 450 Adiantum capillus-veneris mRNA. clone: YMU001_000100_G02. BP917432... CL1686Contig1 Show BP917432 Clone id YMU001_000100_G02 Library YMU01 Length 450 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_G02. Accession BP917432 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP917432|Adiantum capillus-veneris mRNA, clone: Y...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917432|Adiantum capillu

  17. AcEST: BP914326 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F07 599 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F07. BP91432...6 CL274Contig1 Show BP914326 Clone id YMU001_000057_F07 Library YMU01 Length 599 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000057_F07. Accession BP914326 Tissue type prothallium Developmental stage...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914326...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  18. AcEST: BP914321 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F02. BP914321 - Show BP91432...is mRNA. clone: YMU001_000057_F02. Accession BP914321 Tissue type prothallium Developmental stage - Contig I... 25:3389-3402. Query= BP914321|Adiantum capillus-veneris mRNA, clone: YMU001_000057_F02. (534 letters) Datab...leic Acids Res. 25:3389-3402. Query= BP914321|Adiantum capillus-veneris mRNA, clone: YMU001_000057_F02. (534

  19. AcEST: BP914432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_G12 488 Adiantum capillus-veneris mRNA. clone: YMU001_000058_G12. BP914432... CL2573Contig1 Show BP914432 Clone id YMU001_000058_G12 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000058_G12. Accession BP914432 Tissue type prothallium Developmental stag...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914432|...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914432|Adiantum ca

  20. AcEST: BP914324 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F05 457 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F05. BP91432...4 CL2609Contig1 Show BP914324 Clone id YMU001_000057_F05 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000057_F05. Accession BP914324 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914324|Adiantum capillus-vener...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  1. AcEST: BP914328 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F09 454 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F09. BP914328 - Show BP91432...is mRNA. clone: YMU001_000057_F09. Accession BP914328 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  2. AcEST: BP914320 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000057_F01 393 Adiantum capillus-veneris mRNA. clone: YMU001_000057_F01. BP914320 - Show BP91432...is mRNA. clone: YMU001_000057_F01. Accession BP914320 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914320|Adiantum capillus-veneris mRNA, clone: Y...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91432

  3. AcEST: BP920432 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000137_A06 513 Adiantum capillus-veneris mRNA. clone: YMU001_000137_A06. BP920432 - Show BP920432...is mRNA. clone: YMU001_000137_A06. Accession BP920432 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920432...eic Acids Res. 25:3389-3402. Query= BP920432|Adiantum capillus-veneris mRNA, clone: YMU001_000137_A06. (513

  4. AcEST: BP911938 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_A06 103 Adiantum capillus-veneris mRNA. clone: YMU001_000011_A06. BP911938 - Show BP911938...is mRNA. clone: YMU001_000011_A06. Accession BP911938 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911938|Adiantum ca...programs, Nucleic Acids Res. 25:3389-3402. Query= BP911938|Adiantum capillus-veneris mRNA, clone: YMU001_000

  5. AcEST: BP919384 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E05 553 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E05. BP919384 - Show BP91938...is mRNA. clone: YMU001_000124_E05. Accession BP919384 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938

  6. AcEST: BP919381 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E02 515 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E02. BP919381 - Show BP91938...is mRNA. clone: YMU001_000124_E02. Accession BP919381 Tissue type prothallium Developmental stage - Contig I...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919381|Adiantum capillus-veneris

  7. AcEST: BP919386 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E08 575 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E08. BP919386 - Show BP91938...is mRNA. clone: YMU001_000124_E08. Accession BP919386 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919386|Adiantum capillus-veneris mRNA, clone: YMU001...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919386|Adiantum capillus-veneris mRNA, clo

  8. AcEST: BP919385 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E07 296 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E07. BP919385 - Show BP91938...is mRNA. clone: YMU001_000124_E07. Accession BP919385 Tissue type prothallium Developmental stage - Contig I...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91938...25:3389-3402. Query= BP919385|Adiantum capillus-veneris mRNA, clone: YMU001_00012...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res.

  9. AcEST: BP919388 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E10 530 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E10. BP919388 - Show BP91938...is mRNA. clone: YMU001_000124_E10. Accession BP919388 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP919388|Adiantum capillus-veneris mRNA, clone: YMU001_000124_E10. ...cleic Acids Res. 25:3389-3402. Query= BP919388|Adiantum capillus-veneris mRNA, cl

  10. AcEST: BP919387 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_E09 378 Adiantum capillus-veneris mRNA. clone: YMU001_000124_E09. BP919387 - Show BP91938...is mRNA. clone: YMU001_000124_E09. Accession BP919387 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP919387|Adiantum capillus-veneris mRNA, clone: YMU001_000124... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919387|Adia

  11. AcEST: BP920052 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E03 500 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E03. BP92005...2 CL183Contig1 Show BP920052 Clone id YMU001_000132_E03 Library YMU01 Length 500 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E03. Accession BP920052 Tissue type prothallium Developmental stage...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920052|Adian

  12. AcEST: BP920053 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E04 141 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E04. BP92005...3 CL323Contig1 Show BP920053 Clone id YMU001_000132_E04 Library YMU01 Length 141 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E04. Accession BP920053 Tissue type prothallium Developmental stage... Nucleic Acids Res. 25:3389-3402. Query= BP920053|Adiantum capillus-veneris mRNA,...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920053

  13. AcEST: BP920058 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E09 507 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E09. BP92005...8 CL621Contig1 Show BP920058 Clone id YMU001_000132_E09 Library YMU01 Length 507 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E09. Accession BP920058 Tissue type prothallium Developmental stage... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920058|Adiantu

  14. AcEST: BP920059 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E10 367 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E10. BP920059 - Show BP92005...is mRNA. clone: YMU001_000132_E10. Accession BP920059 Tissue type prothallium Developmental stage - Contig I...s, Nucleic Acids Res. 25:3389-3402. Query= BP920059|Adiantum capillus-veneris mRNA, clone: YMU001_000132_E10... programs, Nucleic Acids Res. 25:3389-3402. Query= BP920059|Adiantum capillus-veneris mRNA, clone: YMU001_00

  15. AcEST: BP920056 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E07 303 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E07. BP92005...6 CL779Contig1 Show BP920056 Clone id YMU001_000132_E07 Library YMU01 Length 303 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000132_E07. Accession BP920056 Tissue type prothallium Developmental stage... 25:3389-3402. Query= BP920056|Adiantum capillus-veneris mRNA, clone: YMU001_000132_E07. (303 letters) Datab... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005

  16. AcEST: BP920051 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000132_E02 361 Adiantum capillus-veneris mRNA. clone: YMU001_000132_E02. BP92005...1 CL2821Contig1 Show BP920051 Clone id YMU001_000132_E02 Library YMU01 Length 361 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000132_E02. Accession BP920051 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920051|Adiant... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92005

  17. AcEST: BP919684 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H09. BP919684 - Show BP91968...is mRNA. clone: YMU001_000127_H09. Accession BP919684 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919684...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968

  18. AcEST: BP919685 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H10 544 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H10. BP919685 - Show BP91968...is mRNA. clone: YMU001_000127_H10. Accession BP919685 Tissue type prothallium Developmental stage - Contig I... Res. 25:3389-3402. Query= BP919685|Adiantum capillus-veneris mRNA, clone: YMU001_000127_H10. (544 letters) ...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968

  19. AcEST: BP919687 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_A01 517 Adiantum capillus-veneris mRNA. clone: YMU001_000128_A01. BP919687 - Show BP91968...is mRNA. clone: YMU001_000128_A01. Accession BP919687 Tissue type prothallium Developmental stage - Contig I...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91968

  20. AcEST: BP919681 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H06 556 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H06. BP919681 - Show BP91968...is mRNA. clone: YMU001_000127_H06. Accession BP919681 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919681|Adiantum capillus-veneris m...ucleic Acids Res. 25:3389-3402. Query= BP919681|Adiantum capillus-veneris mRNA, clone: YMU001_000127_H06. (5

  1. AcEST: BP919683 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000127_H08 545 Adiantum capillus-veneris mRNA. clone: YMU001_000127_H08. BP919683 - Show BP91968...is mRNA. clone: YMU001_000127_H08. Accession BP919683 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP919683|Adiantum capillus-veneris mRNA, clone: YMU001_000127_H08. (545 lett... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919683|Adiantum capillus-veneri

  2. AcEST: BP917220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_G09 125 Adiantum capillus-veneris mRNA. clone: YMU001_000097_G09. BP917220 - Show BP917220...is mRNA. clone: YMU001_000097_G09. Accession BP917220 Tissue type prothallium Developmental stage - Contig I...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917220|Adiantum capillus-veneris

  3. AcEST: BP913220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_G12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000027_G12. BP913220 - Show BP913220...is mRNA. clone: YMU001_000027_G12. Accession BP913220 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP913220|Adiantum capillus-veneris...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913220

  4. AcEST: BP915220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_H10 510 Adiantum capillus-veneris mRNA. clone: YMU001_000067_H10. BP915220 - Show BP915220...is mRNA. clone: YMU001_000067_H10. Accession BP915220 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915220|Adiantum capillus-veneris mRNA, clone: YMU

  5. AcEST: BP921220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_B06 550 Adiantum capillus-veneris mRNA. clone: YMU001_000147_B06. BP921220 - Show BP921220...is mRNA. clone: YMU001_000147_B06. Accession BP921220 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, clone...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921220|Adiantum capillus-veneris mRNA, c

  6. AcEST: BP912209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D06 540 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D06. BP912209 - Show BP91220...is mRNA. clone: YMU001_000016_D06. Accession BP912209 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris... programs, Nucleic Acids Res. 25:3389-3402. Query= BP912209|Adiantum capillus-veneris mRNA, clone: YMU001_00

  7. AcEST: BP912220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_E08 357 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E08. BP912220 - Show BP912220...is mRNA. clone: YMU001_000016_E08. Accession BP912220 Tissue type prothallium Developmental stage - Contig I...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912220

  8. AcEST: BP912200 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_C08 572 Adiantum capillus-veneris mRNA. clone: YMU001_000016_C08. BP91220...0 CL3270Contig1 Show BP912200 Clone id YMU001_000016_C08 Library YMU01 Length 572 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_C08. Accession BP912200 Tissue type prothallium Developmental stag...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-veneris mRNA, clo...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP912200|Adiantum capillus-vener

  9. AcEST: BP912206 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D03 484 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D03. BP912206 - Show BP91220...is mRNA. clone: YMU001_000016_D03. Accession BP912206 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912206|Adiantum capi...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91220

  10. AcEST: BP919883 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C06 445 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C06. BP91988...3 CL74Contig1 Show BP919883 Clone id YMU001_000130_C06 Library YMU01 Length 445 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000130_C06. Accession BP919883 Tissue type prothallium Developmental stage ...s Res. 25:3389-3402. Query= BP919883|Adiantum capillus-veneris mRNA, clone: YMU00...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919883|Adiantum capillus-veneris mRNA, clo

  11. AcEST: BP919888 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C11 410 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C11. BP919888 - Show BP91988...is mRNA. clone: YMU001_000130_C11. Accession BP919888 Tissue type prothallium Developmental stage - Contig I...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919888|Adiantum capillu...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919888|Adiantum capillus-

  12. AcEST: BP919885 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C08 326 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C08. BP91988...5 CL2Contig2 Show BP919885 Clone id YMU001_000130_C08 Library YMU01 Length 326 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000130_C08. Accession BP919885 Tissue type prothallium Developmental stage -...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919885|Adiantum capillus-veneris mRNA, clone: YMU001_0001... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988

  13. AcEST: BP911988 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F12 484 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F12. BP911988 - Show BP911988...is mRNA. clone: YMU001_000011_F12. Accession BP911988 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911988|Adiantum capillus...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911988|Adiantum capillus-veneris mRNA, clone: YMU0

  14. AcEST: BP919881 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C04. BP919881 - Show BP91988...is mRNA. clone: YMU001_000130_C04. Accession BP919881 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919881|Adiantum capillus-veneris mRNA, clone: YMU001_000130_..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91988

  15. AcEST: BP919882 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C05. BP919882 - Show BP91988...is mRNA. clone: YMU001_000130_C05. Accession BP919882 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919882|Adiantum capillus-veneris m... Nucleic Acids Res. 25:3389-3402. Query= BP919882|Adiantum capillus-veneris mRNA, clone: YMU001_000130_C05.

  16. AcEST: BP919886 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_C09 570 Adiantum capillus-veneris mRNA. clone: YMU001_000130_C09. BP919886 - Show BP91988...is mRNA. clone: YMU001_000130_C09. Accession BP919886 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919886|Adiantum capillus-vener... Res. 25:3389-3402. Query= BP919886|Adiantum capillus-veneris mRNA, clone: YMU001_000130_C09. (570 letters)

  17. AcEST: BP917072 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E09. BP917072 - Show BP91707...is mRNA. clone: YMU001_000095_E09. Accession BP917072 Tissue type prothallium Developmental stage - Contig I... Acids Res. 25:3389-3402. Query= BP917072|Adiantum capillus-veneris mRNA, clone: YMU001_000095_E09. (516 let...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707

  18. AcEST: BP917078 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_F03 438 Adiantum capillus-veneris mRNA. clone: YMU001_000095_F03. BP91707...8 CL4266Contig1 Show BP917078 Clone id YMU001_000095_F03 Library YMU01 Length 438 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000095_F03. Accession BP917078 Tissue type prothallium Developmental stag...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...programs, Nucleic Acids Res. 25:3389-3402. Query= BP917078|Adiantum capillus-vene

  19. AcEST: BP917071 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E08 525 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E08. BP917071 - Show BP91707...is mRNA. clone: YMU001_000095_E08. Accession BP917071 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP917071|Adiantum capillus-veneris mRNA, clone: YMU0

  20. AcEST: BP917077 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_F02 487 Adiantum capillus-veneris mRNA. clone: YMU001_000095_F02. BP91707...7 CL10Contig1 Show BP917077 Clone id YMU001_000095_F02 Library YMU01 Length 487 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000095_F02. Accession BP917077 Tissue type prothallium Developmental stage ... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917077|

  1. AcEST: BP917074 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E11 418 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E11. BP91707...4 CL413Contig1 Show BP917074 Clone id YMU001_000095_E11 Library YMU01 Length 418 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000095_E11. Accession BP917074 Tissue type prothallium Developmental stage...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917074|Adiantum ...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP917074|Adiantum capillus-veneri

  2. AcEST: BP917070 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E07 451 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E07. BP917070 - Show BP91707...is mRNA. clone: YMU001_000095_E07. Accession BP917070 Tissue type prothallium Developmental stage - Contig I...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91707...s. 25:3389-3402. Query= BP917070|Adiantum capillus-veneris mRNA, clone: YMU001_000095_E07. (451 letters) Dat

  3. AcEST: BP916167 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_A11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000084_A11. BP916167 - Show BP91616...is mRNA. clone: YMU001_000084_A11. Accession BP916167 Tissue type prothallium Developmental stage - Contig I... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916167|Adiantum capillus-veneris mRNA, ...ds Res. 25:3389-3402. Query= BP916167|Adiantum capillus-veneris mRNA, clone: YMU001_000084_A11. (253 letters

  4. AcEST: BP911616 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000007_B05 303 Adiantum capillus-veneris mRNA. clone: YMU001_000007_B05. BP911616 - Show BP911616...is mRNA. clone: YMU001_000007_B05. Accession BP911616 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911616|Adiantum capillus-... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911616...132 PE=4 SV=1 Length = 278 Score = 69.7 bits (169), Expect = 7e-11 Identities = 2

  5. AcEST: BP919946 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A10 457 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A10. BP919946 - Show BP91994...is mRNA. clone: YMU001_000131_A10. Accession BP919946 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP919946|Adiantum capillus-veneris mRNA, clone: YMU00...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919946|A

  6. AcEST: BP911994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_G08 559 Adiantum capillus-veneris mRNA. clone: YMU001_000011_G08. BP911994... CL4209Contig1 Show BP911994 Clone id YMU001_000011_G08 Library YMU01 Length 559 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_G08. Accession BP911994 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum ... programs, Nucleic Acids Res. 25:3389-3402. Query= BP911994|Adiantum capillus-veneris mRNA, clone: YMU001_00

  7. AcEST: BP919948 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_A12 489 Adiantum capillus-veneris mRNA. clone: YMU001_000131_A12. BP919948 - Show BP91994...is mRNA. clone: YMU001_000131_A12. Accession BP919948 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919948|Adia...leic Acids Res. 25:3389-3402. Query= BP919948|Adiantum capillus-veneris mRNA, clone: YMU001_000131_A12. (489

  8. AcEST: BP919943 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_H11 517 Adiantum capillus-veneris mRNA. clone: YMU001_000130_H11. BP919943 - Show BP91994...is mRNA. clone: YMU001_000130_H11. Accession BP919943 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001_000130_H11. (493 le... Res. 25:3389-3402. Query= BP919943|Adiantum capillus-veneris mRNA, clone: YMU001

  9. AcEST: BP919949 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_B01 318 Adiantum capillus-veneris mRNA. clone: YMU001_000131_B01. BP91994...9 CL2311Contig1 Show BP919949 Clone id YMU001_000131_B01 Library YMU01 Length 318 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_B01. Accession BP919949 Tissue type prothallium Developmental stag...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91994

  10. AcEST: BP918814 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_G04 548 Adiantum capillus-veneris mRNA. clone: YMU001_000117_G04. BP918814 - Show BP918814...is mRNA. clone: YMU001_000117_G04. Accession BP918814 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP918814|Adiantum capillus-veneris mRNA, clone: YMU001_000117_G04. (548 letters) Dat... Res. 25:3389-3402. Query= BP918814|Adiantum capillus-veneris mRNA, clone: YMU001_000117_G04. (548 letters)

  11. AcEST: BP918306 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A03 562 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A03. BP918306 - Show BP91830...is mRNA. clone: YMU001_000112_A03. Accession BP918306 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP918306|Adiantum capillus-veneris mRNA, clone: YMU001_000112_...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918306|Adiantum capillus-veneris mRNA, clone: YMU001_000112

  12. AcEST: BP918302 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000111_H03 457 Adiantum capillus-veneris mRNA. clone: YMU001_000111_H03. BP918302 - Show BP91830...is mRNA. clone: YMU001_000111_H03. Accession BP918302 Tissue type prothallium Developmental stage - Contig I...ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91830...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918302|Adiantum ca

  13. AcEST: BP915830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_E09 601 Adiantum capillus-veneris mRNA. clone: YMU001_000077_E09. BP915830 - Show BP915830...is mRNA. clone: YMU001_000077_E09. Accession BP915830 Tissue type prothallium Developmental stage - Contig I...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915830|Adiantu...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915830|Adiantum capillus-veneris m

  14. AcEST: BP918830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000118_A03 482 Adiantum capillus-veneris mRNA. clone: YMU001_000118_A03. BP918830... CL578Contig1 Show BP918830 Clone id YMU001_000118_A03 Library YMU01 Length 482 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000118_A03. Accession BP918830 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918830...s, Nucleic Acids Res. 25:3389-3402. Query= BP918830|Adiantum capillus-veneris mRNA, clone: YMU001_000118_A03

  15. AcEST: BP919830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_F05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000129_F05. BP919830... CL2022Contig1 Show BP919830 Clone id YMU001_000129_F05 Library YMU01 Length 476 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_F05. Accession BP919830 Tissue type prothallium Developmental stag... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919830...leic Acids Res. 25:3389-3402. Query= BP919830|Adiantum capillus-veneris mRNA, clone: YMU001_000129_F05. (458

  16. AcEST: BP917830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000106_A10 487 Adiantum capillus-veneris mRNA. clone: YMU001_000106_A10. BP917830 - Show BP917830...is mRNA. clone: YMU001_000106_A10. Accession BP917830 Tissue type prothallium Developmental stage - Contig I...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917830|Adiantum ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917830|A

  17. AcEST: BP914830 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_D03 538 Adiantum capillus-veneris mRNA. clone: YMU001_000063_D03. BP914830 - Show BP914830...is mRNA. clone: YMU001_000063_D03. Accession BP914830 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP914830|Adiantum capillus-veneris mRNA, clone: YMU001_000063_...programs, Nucleic Acids Res. 25:3389-3402. Query= BP914830|Adiantum capillus-vene

  18. AcEST: BP918309 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000112_A06 512 Adiantum capillus-veneris mRNA. clone: YMU001_000112_A06. BP91830...9 CL856Contig1 Show BP918309 Clone id YMU001_000112_A06 Library YMU01 Length 512 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000112_A06. Accession BP918309 Tissue type prothallium Developmental stage...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP918309|Adiantum capillus-veneris mRNA, clone: YMU001_00011... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91830

  19. AcEST: BP914147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000042_D12 534 Adiantum capillus-veneris mRNA. clone: YMU001_000042_D12. BP914147 - Show BP91414...is mRNA. clone: YMU001_000042_D12. Accession BP914147 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91414...niprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching......................................ids Res. 25:3389-3402. Query= BP914147|Adiantum capillus-veneris mRNA, clone: YMU001_000042_D12. (534 letter

  20. AcEST: BP917075 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000095_E12 529 Adiantum capillus-veneris mRNA. clone: YMU001_000095_E12. BP917075 - Show BP917075...is mRNA. clone: YMU001_000095_E12. Accession BP917075 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917075...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917075|Adiantum capillus-veneris mRNA

  1. AcEST: BP918650 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000116_A01 560 Adiantum capillus-veneris mRNA. clone: YMU001_000116_A01. BP918650... CL552Contig1 Show BP918650 Clone id YMU001_000116_A01 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000116_A01. Accession BP918650 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918650|Adiantum capillus-ve...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918650|Adiant

  2. AcEST: BP920168 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H02 390 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H02. BP920168 - Show BP92016...is mRNA. clone: YMU001_000133_H02. Accession BP920168 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA,...c Acids Res. 25:3389-3402. Query= BP920168|Adiantum capillus-veneris mRNA, clone: YMU001_000133_H02. (390 le

  3. AcEST: BP920169 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H03 505 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H03. BP920169 - Show BP92016...is mRNA. clone: YMU001_000133_H03. Accession BP920169 Tissue type prothallium Developmental stage - Contig I...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920169|Adiantum cap

  4. AcEST: BP920167 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_H01 152 Adiantum capillus-veneris mRNA. clone: YMU001_000133_H01. BP920167 - Show BP92016...is mRNA. clone: YMU001_000133_H01. Accession BP920167 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP920167|Adiantum capillus-veneris mRNA, clone: YMU...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920167

  5. AcEST: BP920161 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G06. BP920161 - Show BP92016...is mRNA. clone: YMU001_000133_G06. Accession BP920161 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  6. AcEST: BP920166 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G12 149 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G12. BP920166 - Show BP92016...is mRNA. clone: YMU001_000133_G12. Accession BP920166 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920166|Adiantum capillus-veneris

  7. AcEST: BP920164 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G09 447 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G09. BP920164 - Show BP92016...is mRNA. clone: YMU001_000133_G09. Accession BP920164 Tissue type prothallium Developmental stage - Contig I...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|A...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920164|Adiantum cap

  8. AcEST: BP920163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G08 372 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G08. BP92016...3 CL2472Contig1 Show BP920163 Clone id YMU001_000133_G08 Library YMU01 Length 372 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_G08. Accession BP920163 Tissue type prothallium Developmental stag...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum cap... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920163|Adiantum capillus-veneris mRNA, clone: YM

  9. AcEST: BP920165 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_G11 301 Adiantum capillus-veneris mRNA. clone: YMU001_000133_G11. BP920165 - Show BP92016...is mRNA. clone: YMU001_000133_G11. Accession BP920165 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920165...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92016

  10. AcEST: BP920400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000136_F07 401 Adiantum capillus-veneris mRNA. clone: YMU001_000136_F07. BP920400 - Show BP920400...is mRNA. clone: YMU001_000136_F07. Accession BP920400 Tissue type prothallium Developmental stage - Contig I...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920400|Adi...ery: 234 EVEDYAVRLERGLNHYGRWDSLLTRLAIDNGDCSKISSEDL 356 E+ Y + G N+ D+ +TRL I D SK+ +DL Sbjct: 400 EIAPYIITAL...ids Res. 25:3389-3402. Query= BP920400|Adiantum capillus-veneris mRNA, clone: YMU001_000136_F07. (401 letter

  11. AcEST: BP914009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G12. BP914009 - Show BP91400...is mRNA. clone: YMU001_000038_G12. Accession BP914009 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914009|Adiantum ca...programs, Nucleic Acids Res. 25:3389-3402. Query= BP914009|Adiantum capillus-veneris mRNA, clone: YMU001_000

  12. AcEST: BP914005 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G08 416 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G08. BP914005 - Show BP91400...is mRNA. clone: YMU001_000038_G08. Accession BP914005 Tissue type prothallium Developmental stage - Contig I...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91400...s Res. 25:3389-3402. Query= BP914005|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G08. (416 letters)

  13. AcEST: BP914400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E03 571 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E03. BP914400 - Show BP914400...is mRNA. clone: YMU001_000058_E03. Accession BP914400 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914400|Adiantum capillus-veneris mRNA, clone... OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 Length = 697 Score = 158 bits (400), Expect = 2e-38 Identities = 70...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914400

  14. AcEST: BP914004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G07 450 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G07. BP914004 - Show BP91400...is mRNA. clone: YMU001_000038_G07. Accession BP914004 Tissue type prothallium Developmental stage - Contig I...leic Acids Res. 25:3389-3402. Query= BP914004|Adiantum capillus-veneris mRNA, clo...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914004|Adiantum capillus-veneris mRN

  15. AcEST: BP915400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B04 438 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B04. BP915400 - Show BP915400...is mRNA. clone: YMU001_000071_B04. Accession BP915400 Tissue type prothallium Developmental stage - Contig I... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915400...ucleic Acids Res. 25:3389-3402. Query= BP915400|Adiantum capillus-veneris mRNA, c

  16. AcEST: BP918400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A11 368 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A11. BP918400 - Show BP918400...is mRNA. clone: YMU001_000113_A11. Accession BP918400 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918400|Adiantum capillus-veneris mRNA, clone: YMU001_000113_A1...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918400

  17. AcEST: BP914000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G03 555 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G03. BP914000 - Show BP91400...is mRNA. clone: YMU001_000038_G03. Accession BP914000 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP914000|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G03. (5...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914000|Adiantum capil

  18. AcEST: BP914002 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_G05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000038_G05. BP91400...2 CL1073Contig1 Show BP914002 Clone id YMU001_000038_G05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000038_G05. Accession BP914002 Tissue type prothallium Developmental stag... Nucleic Acids Res. 25:3389-3402. Query= BP914002|Adiantum capillus-veneris mRNA, clone: YMU001_000038_G05. ...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91400

  19. AcEST: BP912400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F03 584 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F03. BP912400 - Show BP912400...is mRNA. clone: YMU001_000018_F03. Accession BP912400 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP912400|Adiantum capillus-veneris mRNA, clone: YMU001_000018_F03. (... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912400...ASYGVFEGEGEYYGGRE 1233 Query: 400 GPSRTQWFRASPDGTQREIKGATGDRYTCQTEDLDAFLCVSYEPVRS

  20. AcEST: BP917400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D03 356 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D03. BP917400 - Show BP917400...is mRNA. clone: YMU001_000100_D03. Accession BP917400 Tissue type prothallium Developmental stage - Contig I...ic Acids Res. 25:3389-3402. Query= BP917400|Adiantum capillus-veneris mRNA, clone: YMU001_000100_D03. (356 l...cids Res. 25:3389-3402. Query= BP917400|Adiantum capillus-veneris mRNA, clone: YMU001_000100_D03. (356 lette