WorldWideScience

Sample records for arabidopsis lyrata ssp

  1. Comparative cDNA-AFLP analysis of Cd-tolerant and -sensitive genotypes derived from crosses between the Cd hyperaccumulator Arabidopsis halleri and Arabidopsis lyrata ssp. petraea.

    Science.gov (United States)

    Craciun, Adrian Radu; Courbot, Mikael; Bourgis, Fabienne; Salis, Pietrino; Saumitou-Laprade, Pierre; Verbruggen, Nathalie

    2006-01-01

    Cadmium (Cd) tolerance seems to be a constitutive species-level trait in Arabidopsis halleri. In order to identify genes potentially implicated in Cd tolerance, a backcross (BC1) segregating population was produced from crosses between A. halleri ssp. halleri and its closest non-tolerant relative A. lyrata ssp. petraea. The most sensitive and tolerant genotypes of the BC1 were analysed on a transcriptome-wide scale by cDNA-amplified fragment length polymorphism (AFLP). A hundred and thirty-four genes expressed more in the root of tolerant genotypes than in sensitive genotypes were identified. Most of the identified genes showed no regulation in their expression when exposed to Cd in a hydroponic culture medium and belonged to diverse functional classes, including reactive oxygen species (ROS) detoxification, cellular repair, metal sequestration, water transport, signal transduction, transcription regulation, and protein degradation, which are discussed. PMID:16916885

  2. Linkage disequilibrium between incompatibility locus region genes in the plant Arabidopsis lyrata

    DEFF Research Database (Denmark)

    Hagenblad, Jenny; Bechsgaard, Jesper Smærup; Charlesworth, Deborah

    2006-01-01

    We have studied diversity in Arabidopsis lyrata of sequences orthologous to the ARK3 gene of A. thaliana. Our main goal was to test for recombination in the S-locus region. In A. thaliana, the single-copy ARK3 gene is closely linked to the non-functional copies of the self-incompatibility loci, and...... the ortholog in A. lyrata (a self-incompatible species) is in the homologous genome region and is known as Aly8. It is thus of interest to test whether Aly8 sequence diversity is elevated due to close linkage to the highly polymorphic incompatibility locus, as is theoretically predicted. However, Aly8...... linked to the incompatibility locus, one being a pseudogene. We determined the phase of multiple haplotypes in families of plants from Icelandic and other populations. Different Aly8 sequence types are associated with different SRK alleles, while haplotypes with the same SRK sequences tend to have the...

  3. Contrasting patterns of genetic structuring in natural populations of Arabidopsis lyrata Subsp. petraea across different regions in northern Europe.

    Directory of Open Access Journals (Sweden)

    Mohsen Falahati-Anbaran

    Full Text Available Level and partitioning of genetic diversity is expected to vary between contrasting habitats, reflecting differences in strength of ecological and evolutionary processes. Therefore, it is necessary to consider processes acting on different time scales when trying to explain diversity patterns in different parts of species' distributions. To explore how historical and contemporary factors jointly may influence patterns of genetic diversity and population differentiation, we compared genetic composition in the perennial herb Arabidopsis lyrata ssp. petraea from the northernmost parts of its distribution range on Iceland to that previously documented in Scandinavia. Leaf tissue and soil were sampled from ten Icelandic populations of A. lyrata. Seedlings were grown from soil samples, and tissue from above-ground and seed bank individuals were genotyped with 21 microsatellite markers. Seed bank density in Icelandic populations was low but not significantly different from that observed in Norwegian populations. While within-population genetic diversity was relatively high on Iceland (H(E = 0.35, among-population differentiation was low (F(ST = 0.10 compared to Norwegian and Swedish populations. Population differentiation was positively associated with geographical distance in both Iceland and Scandinavia, but the strength of this relationship varied between regions. Although topography and a larger distribution range may explain the higher differentiation between mountainous Norwegian relative to lowland populations in Sweden, these factors cannot explain the lower differentiation in Icelandic compared to Swedish populations. We propose that low genetic differentiation among Icelandic populations is not caused by differences in connectivity, but is rather due to large historical effective population sizes. Thus, rather than contemporary processes, historical factors such as survival of Icelandic lineages in northern refugia during the last glacial

  4. Contrasting patterns of genetic structuring in natural populations of Arabidopsis lyrata Subsp. petraea across different regions in northern Europe.

    Science.gov (United States)

    Falahati-Anbaran, Mohsen; Lundemo, Sverre; Ansell, Stephen W; Stenøien, Hans K

    2014-01-01

    Level and partitioning of genetic diversity is expected to vary between contrasting habitats, reflecting differences in strength of ecological and evolutionary processes. Therefore, it is necessary to consider processes acting on different time scales when trying to explain diversity patterns in different parts of species' distributions. To explore how historical and contemporary factors jointly may influence patterns of genetic diversity and population differentiation, we compared genetic composition in the perennial herb Arabidopsis lyrata ssp. petraea from the northernmost parts of its distribution range on Iceland to that previously documented in Scandinavia. Leaf tissue and soil were sampled from ten Icelandic populations of A. lyrata. Seedlings were grown from soil samples, and tissue from above-ground and seed bank individuals were genotyped with 21 microsatellite markers. Seed bank density in Icelandic populations was low but not significantly different from that observed in Norwegian populations. While within-population genetic diversity was relatively high on Iceland (H(E) = 0.35), among-population differentiation was low (F(ST) = 0.10) compared to Norwegian and Swedish populations. Population differentiation was positively associated with geographical distance in both Iceland and Scandinavia, but the strength of this relationship varied between regions. Although topography and a larger distribution range may explain the higher differentiation between mountainous Norwegian relative to lowland populations in Sweden, these factors cannot explain the lower differentiation in Icelandic compared to Swedish populations. We propose that low genetic differentiation among Icelandic populations is not caused by differences in connectivity, but is rather due to large historical effective population sizes. Thus, rather than contemporary processes, historical factors such as survival of Icelandic lineages in northern refugia during the last glacial period may have

  5. Transmission ratio distortion in Arabidopsis lyrata: effects of population divergence and the S-locus

    DEFF Research Database (Denmark)

    Leppälä, J; Bechsgaard, J S; Schierup, M H;

    2007-01-01

    We investigated transmission ratio distortion within an Icelandic population of Arabidopsis lyrata using 16 molecular markers unlinked to the S-locus. Transmission ratio distortion was found more often than expected by chance at the gametic level, but not at the genotypic or zygotic level. The...... distortion in the interpopulation cross is due to population divergence. It is also substantially lower than previously observed in intrapopulation crosses at the self-incompatibility locus, suggesting inherent fitness differences of the self-incompatibility alleles. We discuss the possible role of...

  6. Genomic analysis of differentiation between soil types reveals candidate genes for local adaptation in Arabidopsis lyrata.

    Directory of Open Access Journals (Sweden)

    Thomas L Turner

    Full Text Available Serpentine soil, which is naturally high in heavy metal content and has low calcium to magnesium ratios, comprises a difficult environment for most plants. An impressive number of species are endemic to serpentine, and a wide range of non-endemic plant taxa have been shown to be locally adapted to these soils. Locating genomic polymorphisms which are differentiated between serpentine and non-serpentine populations would provide candidate loci for serpentine adaptation. We have used the Arabidopsis thaliana tiling array, which has 2.85 million probes throughout the genome, to measure genetic differentiation between populations of Arabidopsis lyrata growing on granitic soils and those growing on serpentinic soils. The significant overrepresentation of genes involved in ion transport and other functions provides a starting point for investigating the molecular basis of adaptation to soil ion content, water retention, and other ecologically and economically important variables. One gene in particular, calcium-exchanger 7, appears to be an excellent candidate gene for adaptation to low CaratioMg ratio in A. lyrata.

  7. The Arabidopsis lyrata genome sequence and the basis of rapid genome size change

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Tina T.; Pattyn, Pedro; Bakker, Erica G.; Cao, Jun; Cheng, Jan-Fang; Clark, Richard M.; Fahlgren, Noah; Fawcett, Jeffrey A.; Grimwood, Jane; Gundlach, Heidrun; Haberer, Georg; Hollister, Jesse D.; Ossowski, Stephan; Ottilar, Robert P.; Salamov, Asaf A.; Schneeberger, Korbinian; Spannagl, Manuel; Wang, Xi; Yang, Liang; Nasrallah, Mikhail E.; Bergelson, Joy; Carrington, James C.; Gaut, Brandon S.; Schmutz, Jeremy; Mayer, Klaus F. X.; Van de Peer, Yves; Grigoriev, Igor V.; Nordborg, Magnus; Weigel, Detlef; Guo, Ya-Long

    2011-04-29

    In our manuscript, we present a high-quality genome sequence of the Arabidopsis thaliana relative, Arabidopsis lyrata, produced by dideoxy sequencing. We have performed the usual types of genome analysis (gene annotation, dN/dS studies etc. etc.), but this is relegated to the Supporting Information. Instead, we focus on what was a major motivation for sequencing this genome, namely to understand how A. thaliana lost half its genome in a few million years and lived to tell the tale. The rather surprising conclusion is that there is not a single genomic feature that accounts for the reduced genome, but that every aspect centromeres, intergenic regions, transposable elements, gene family number is affected through hundreds of thousands of cuts. This strongly suggests that overall genome size in itself is what has been under selection, a suggestion that is strongly supported by our demonstration (using population genetics data from A. thaliana) that new deletions seem to be driven to fixation.

  8. Molecular evolutionary analysis of the Alfin-like protein family in Arabidopsis lyrata, Arabidopsis thaliana, and Thellungiella halophila.

    Directory of Open Access Journals (Sweden)

    Yu Song

    Full Text Available In previous studies, the Alfin1 gene, a transcription factor, enhanced salt tolerance in alfalfa, primarily through altering gene expression levels in the root. Here, we examined the molecular evolution of the Alfin-like (AL proteins in two Arabidopsis species (A. lyrata and A. thaliana and a salt-tolerant close relative Thellungiella halophila. These AL-like proteins could be divided into four groups and the two known DUF3594 and PHD-finger domains had co-evolved within each group of genes, irrespective of species, due to gene duplication events in the common ancestor of all three species while gene loss was observed only in T. halophila. To detect whether natural selection acted in the evolution of AL genes, we calculated synonymous substitution ratios (dn/ds and codon usage statistics, finding positive selection operated on four branches and significant differences in biased codon usage in the AL family between T. halophila and A. lyrata or A. thaliana. Distinctively, only the AL7 branch was under positive selection on the PHD-finger domain and the three members on the branch showed the smallest difference when codon bias was evaluated among the seven clusters. Functional analysis based on transgenic overexpression lines and T-DNA insertion mutants indicated that salt-stress-induced AtAL7 could play a negative role in salt tolerance of A. thaliana, suggesting that adaptive evolution occurred in the members of AL gene family.

  9. Does speciation between Arabidopsis halleri and Arabidopsis lyrata coincide with major changes in a molecular target of adaptation?

    Directory of Open Access Journals (Sweden)

    Camille Roux

    Full Text Available Ever since Darwin proposed natural selection as the driving force for the origin of species, the role of adaptive processes in speciation has remained controversial. In particular, a largely unsolved issue is whether key divergent ecological adaptations are associated with speciation events or evolve secondarily within sister species after the split. The plant Arabidopsis halleri is one of the few species able to colonize soils highly enriched in zinc and cadmium. Recent advances in the molecular genetics of adaptation show that the physiology of this derived ecological trait involves copy number expansions of the AhHMA4 gene, for which orthologs are found in single copy in the closely related A. lyrata and the outgroup A. thaliana. To gain insight into the speciation process, we ask whether adaptive molecular changes at this candidate gene were contemporary with important stages of the speciation process. We first inferred the scenario and timescale of speciation by comparing patterns of variation across the genomic backgrounds of A. halleri and A. lyrata. Then, we estimated the timing of the first duplication of AhHMA4 in A. halleri. Our analysis suggests that the historical split between the two species closely coincides with major changes in this molecular target of adaptation in the A. halleri lineage. These results clearly indicate that these changes evolved in A. halleri well before industrial activities fostered the spread of Zn- and Cd-polluted areas, and suggest that adaptive processes related to heavy-metal homeostasis played a major role in the speciation process.

  10. The predominantly selfing plant Arabidopsis thaliana experienced a recent reduction in transposable element abundance compared to its outcrossing relative Arabidopsis lyrata

    Directory of Open Access Journals (Sweden)

    de la Chaux Nicole

    2012-02-01

    Full Text Available Abstract Background Transposable elements (TEs are major contributors to genome evolution. One factor that influences their evolutionary dynamics is whether their host reproduces through selfing or through outcrossing. According to the recombinational spreading hypothesis, for instance, TEs can spread more easily in outcrossing species through recombination, and should thus be less abundant in selfing species. We here studied the distribution and evolutionary dynamics of TE families in the predominantly selfing plant Arabidopsis thaliana and its close outcrossing relative Arabidopsis lyrata on a genome-wide scale. We characterized differences in TE abundance between them and asked which, if any, existing hypotheses about TE abundances may explain these differences. Results We identified 1,819 TE families representing all known classes of TEs in both species, and found three times more copies in the outcrossing A. lyrata than in the predominantly selfing A. thaliana, as well as ten times more TE families unique to A. lyrata. On average, elements in A. lyrata are younger than elements in A. thaliana. In particular, A. thaliana shows a marked decrease in element number that occurred during the most recent 10% of the time interval since A. thaliana split from A. lyrata. This most recent period in the evolution of A. thaliana started approximately 500,000 years ago, assuming a splitting time of 5 million years ago, and coincides with the time at which predominant selfing originated. Conclusions Our results indicate that the mating system may be important for determining TE copy number, and that selfing species are likely to have fewer TEs.

  11. Cytoplasmic male sterility contributes to hybrid incompatibility between subspecies of Arabidopsis lyrata.

    Science.gov (United States)

    Aalto, Esa A; Koelewijn, Hans-Peter; Savolainen, Outi

    2013-10-03

    In crosses between evolutionarily diverged populations, genomic incompatibilities may result in sterile hybrids, indicating evolution of reproductive isolation. In several plant families, crosses within a population can also lead to male sterile progeny because of conflict between the maternally and biparentally inherited genomes. We examined hybrid fertility between subspecies of the perennial outcrossing self-incompatible Lyrate rockcress (Arabidopsis lyrata) in large reciprocal F2 progenies and three generations of backcrosses. In one of the reciprocal F2 progenies, almost one-fourth of the plants were male-sterile. Correspondingly, almost one-half of the plants in one of the four reciprocal backcross progenies expressed male sterility. In an additional four independent F2 and backcross families, three segregated male sterility. The observed asymmetrical hybrid incompatibility is attributable to male sterility factors in one cytoplasm, for which the other population lacks effective fertility restorers. Genotyping of 96 molecular markers and quantitative trait locus mapping revealed that only 60% of the plants having the male sterile cytoplasm and lacking the corresponding restorers were phenotypically male-sterile. Genotyping data showed that there is only one restorer locus, which mapped to a 600-kb interval at the top of chromosome 2 in a region containing a cluster of pentatricopeptide repeat genes. Male fertility showed no trade-off with seed production. We discuss the role of cytoplasm and genomic conflict in incipient speciation and conclude that cytoplasmic male sterility-lowering hybrid fitness is a transient effect with limited potential to form permanent reproductive barriers between diverged populations of hermaphrodite self-incompatible species.

  12. Validation of Pooled Whole-Genome Re-Sequencing in Arabidopsis lyrata.

    Directory of Open Access Journals (Sweden)

    Marco Fracassetti

    Full Text Available Sequencing pooled DNA of multiple individuals from a population instead of sequencing individuals separately has become popular due to its cost-effectiveness and simple wet-lab protocol, although some criticism of this approach remains. Here we validated a protocol for pooled whole-genome re-sequencing (Pool-seq of Arabidopsis lyrata libraries prepared with low amounts of DNA (1.6 ng per individual. The validation was based on comparing single nucleotide polymorphism (SNP frequencies obtained by pooling with those obtained by individual-based Genotyping By Sequencing (GBS. Furthermore, we investigated the effect of sample number, sequencing depth per individual and variant caller on population SNP frequency estimates. For Pool-seq data, we compared frequency estimates from two SNP callers, VarScan and Snape; the former employs a frequentist SNP calling approach while the latter uses a Bayesian approach. Results revealed concordance correlation coefficients well above 0.8, confirming that Pool-seq is a valid method for acquiring population-level SNP frequency data. Higher accuracy was achieved by pooling more samples (25 compared to 14 and working with higher sequencing depth (4.1× per individual compared to 1.4× per individual, which increased the concordance correlation coefficient to 0.955. The Bayesian-based SNP caller produced somewhat higher concordance correlation coefficients, particularly at low sequencing depth. We recommend pooling at least 25 individuals combined with sequencing at a depth of 100× to produce satisfactory frequency estimates for common SNPs (minor allele frequency above 0.05.

  13. Temperature-stress resistance and tolerance along a latitudinal cline in North American Arabidopsis lyrata.

    Directory of Open Access Journals (Sweden)

    Guillaume Wos

    Full Text Available The study of latitudinal gradients can yield important insights into adaptation to temperature stress. Two strategies are available: resistance by limiting damage, or tolerance by reducing the fitness consequences of damage. Here we studied latitudinal variation in resistance and tolerance to frost and heat and tested the prediction of a trade-off between the two strategies and their costliness. We raised plants of replicate maternal seed families from eight populations of North American Arabidopsis lyrata collected along a latitudinal gradient in climate chambers and exposed them repeatedly to either frost or heat stress, while a set of control plants grew under standard conditions. When control plants reached maximum rosette size, leaf samples were exposed to frost and heat stress, and electrolyte leakage (PEL was measured and treated as an estimate of resistance. Difference in maximum rosette size between stressed and control plants was used as an estimate of tolerance. Northern populations were more frost resistant, and less heat resistant and less heat tolerant, but-unexpectedly-they were also less frost tolerant. Negative genetic correlations between resistance and tolerance to the same and different thermal stress were generally not significant, indicating only weak trade-offs. However, tolerance to frost was consistently accompanied by small size under control conditions, which may explain the non-adaptive latitudinal pattern for frost tolerance. Our results suggest that adaptation to frost and heat is not constrained by trade-offs between them. But the cost of frost tolerance in terms of plant size reduction may be important for the limits of species distributions and climate niches.

  14. Evidence of various mechanisms of Cd sequestration in the hyperaccumulator Arabidopsis halleri, the non-accumulator Arabidopsis lyrata, and their progenies by combined synchrotron-based techniques.

    Science.gov (United States)

    Isaure, Marie-Pierre; Huguet, Stéphanie; Meyer, Claire-Lise; Castillo-Michel, Hiram; Testemale, Denis; Vantelon, Delphine; Saumitou-Laprade, Pierre; Verbruggen, Nathalie; Sarret, Géraldine

    2015-06-01

    Arabidopsis halleri is a model plant for Zn and Cd hyperaccumulation. The objective of this study was to determine the relationship between the chemical forms of Cd, its distribution in leaves, and Cd accumulation and tolerance. An interspecific cross was carried out between A. halleri and the non-tolerant and non-hyperaccumulating relative A. lyrata providing progenies segregating for Cd tolerance and accumulation. Cd speciation and distribution were investigated using X-ray absorption spectroscopy and microfocused X-ray fluorescence. In A. lyrata and non-tolerant progenies, Cd was coordinated by S atoms only or with a small contribution of O groups. Interestingly, the proportion of O ligands increased in A. halleri and tolerant progenies, and they were predominant in most of them, while S ligands were still present. Therefore, the binding of Cd with O ligands was associated with Cd tolerance. In A. halleri, Cd was mainly located in the xylem, phloem, and mesophyll tissue, suggesting a reallocation process for Cd within the plant. The distribution of the metal at the cell level was further discussed. In A. lyrata, the vascular bundles were also Cd enriched, but the epidermis was richer in Cd as compared with the mesophyll. Cd was identified in trichomes of both species. This work demonstrated that both Cd speciation and localization were related to the tolerance character of the plant. PMID:25873676

  15. Genetic changes in flowering and morphology in response to adaptation to a high-latitude environment in Arabidopsis lyrata

    Science.gov (United States)

    Quilot-Turion, Bénédicte; Leppälä, Johanna; Leinonen, Päivi H.; Waldmann, Patrik; Savolainen, Outi; Kuittinen, Helmi

    2013-01-01

    Background and Aims The adaptive plastic reactions of plant populations to changing climatic factors, such as winter temperatures and photoperiod, have changed during range shifts after the last glaciation. Timing of flowering is an adaptive trait regulated by environmental cues. Its genetics has been intensively studied in annual plants, but in perennials it is currently not well characterized. This study examined the genetic basis of differentiation in flowering time, morphology, and their plastic responses to vernalization in two locally adapted populations of the perennial Arabidopsis lyrata: (1) to determine whether the two populations differ in their vernalization responses for flowering phenology and morphology; and (2) to determine the genomic areas governing differentiation and vernalization responses. Methods Two A. lyrata populations, from central Europe and Scandinavia, were grown in growth-chamber conditions with and without cold treatment. A QTL analysis was performed to find genomic regions that interact with vernalization. Key Results The population from central Europe flowered more rapidly and invested more in inflorescence growth than the population from alpine Scandinavia, especially after vernalization. The alpine population had consistently a low number of inflorescences and few flowers, suggesting strong constraints due to a short growing season, but instead had longer leaves and higher leaf rosettes. QTL mapping in the F2 population revealed genomic regions governing differentiation in flowering time and morphology and, in some cases, the allelic effects from the two populations on a trait were influenced by vernalization (QTL × vernalization interactions). Conclusions The results indicate that many potentially adaptive genetic changes have occurred during colonization; the two populations have diverged in their plastic responses to vernalization in traits closely connected to fitness through changes in many genomic areas. PMID:23519836

  16. Zinc distribution and speciation in Arabidopsis halleri x Arabidops is lyrata progenies presenting various zinc accumulation capacities

    Energy Technology Data Exchange (ETDEWEB)

    Sarret, Geraldine; Willems, Glenda; Isaure, Marie-Pierre; Marcus, Matthew A.; Fakra, Sirine C.; Frerot, Helene; Pairis, Sebastien; Geoffroy, Nicolas; Manceau, Alain; Saumitou-Laprade, Pierre

    2010-04-08

    - The purpose of this study was to investigate the relationship between the chemical form and localization of zinc (Zn) in plant leaves and their Zn accumulationcapacity. - An interspecific cross between Arabidopsis halleri sp. halleri and Arabidopsis lyrata sp. petrea segregating for Zn accumulation was used. Zinc (Zn) speciation and Zn distribution in the leaves of the parent plants and of selected F1 and F2 progenies were investigated by spectroscopic and microscopic techniques and chemical analyses. - A correlation was observed between the proportion of Zn being in octahedral coordination complexed to organic acids and free in solution (Zn?OAs + Znaq) and Zn content in the leaves. This pool varied between 40percent and 80percent of total leaf Zn depending on the plant studied. Elemental mapping of the leaves revealed different Zn partitioning between the veins and the leaf tissue. The vein : tissue fluorescence ratio was negatively correlated with Zn accumulation. - The higher proportion of Zn?OAs + Znaq and the depletion of the veins in the stronger accumulators are attributed to a higher xylem unloading and vacuolar sequestration in the leaf cells. Elemental distributions in the trichomes were also investigated, and results support the role of carboxyl and⁄ or hydroxyl groups as major Zn ligands in these cells.

  17. Additive and non-additive effects of simulated leaf and inflorescence damage on survival, growth and reproduction of the perennial herb Arabidopsis lyrata.

    Science.gov (United States)

    Puentes, Adriana; Ågren, Jon

    2012-08-01

    Herbivores may damage both leaves and reproductive structures, and although such combined damage may affect plant fitness non-additively, this has received little attention. We conducted a 2-year field experiment with a factorial design to examine the effects of simulated leaf (0, 12.5, 25, or 50% of leaf area removed) and inflorescence damage (0 vs. 50% of inflorescences removed) on survival, growth and reproduction in the perennial herb Arabidopsis lyrata. Leaf and inflorescence damage negatively and independently reduced flower, fruit and seed production in the year of damage; leaf damage also reduced rosette size by the end of the first season and flower production in the second year. Leaf damage alone reduced the proportion of flowers forming a fruit and fruit production per plant the second year, but when combined with inflorescence damage no such effect was observed (significant leaf × inflorescence damage interaction). Damage to leaves (sources) caused a greater reduction in future reproduction than did simultaneous damage to leaves and inflorescences (sinks). This demonstrates that a full understanding of the effects of herbivore damage on plant fitness requires that consequences of damage to vegetative and reproductive structures are evaluated over more than 1 year and that non-additive effects are considered. PMID:22349755

  18. Forms of zinc accumulated in the hyperaccumulator Arabidopsis halleri

    OpenAIRE

    Sarret, Geraldine; Saumitou-Laprade, Pierre; Bert, Valerie; Proux, Olivier; Hazemann, Jean-Louis; Traverse, Agnes; Marcus, Matthew,; Manceau, Alain

    2002-01-01

    The chemical forms of zinc (Zn) in the Zn-tolerant and hyperaccumulator Arabidopsis halleri and in the non-tolerant and nonaccumulator Arabidopsis lyrata subsp. petraea were determined at the molecular level by combining chemical analyses, extended x-ray absorption spectroscopy (EXAFS), synchrotron-based x-ray microfluorescence, and micro--EXAFS. Plants weree grown in hydroponics with various Zn concentrations, and A. halleri specimens growing naturally in a contaminated site were also collec...

  19. 水稻和拟南芥中几丁质酶的分析%Chitinases in Oryza sativa ssp. japonica and Arabidopsis thaliana

    Institute of Scientific and Technical Information of China (English)

    许凤华; 范成明; 何月秋

    2007-01-01

    Chitinases (EC3.2.1.14), found in a wide range of organisms, catalyze the hydrolysis of chitin and play a major role in defense mechanisms against fungal pathogens. The alignment and typical domains were analyzed using basic local alignment search tool (BLAST) and simple modular architecture research tool (SMART), respectively. On the basis of the annotations of rice (Oryza sativa L.) and Arabidopsis genomic sequences and using the bio-software SignalP3.0, TMHMM2.0, TargetPl.1, and big-Pi Predictor, 25 out of 37 and 16 out of 24 open reading frames (ORFs) with chitinase activity from rice and Arabidopsis, respectively, were predicted to have signal peptides (SPs), which have an average of 24.8 amino acids at the N-terminal region. Some of the chitinases were secreted extracellularly, whereas some were located in the vacuole. The phylogenic relationship was analyzed with 61 ORFs and 25 known chitinases and they were classified into 6 clusters using Clustal X and MEGA3.1. This classification is not completely consistent when compared with the traditional system that classifies the chitinases into 7 classes. The frequency of distribution of amino acid residues was distinct in different clusters. The contents of alanine, glycine, serine, and leucine were very high in each cluster, whereas the contents of methionine, histidine, tryptophan, and cysteine were lower than 20%. Each cluster had distinct amino acid characteristics. Alanine, valine, leucine, cysteine, serine, and lysine were rich in Clusters Ⅰ to Ⅵ, respectively.%几丁质酶(EC3.2.1.14)是一种降解几丁质的糖苷酶,广泛存在于各种生物体中,并在植物中对病原真菌起重要抗性作用.首先通过BLAST在GenBank中对其同源性进行搜索,用SMART分析其结构.基于水稻和拟南芥的基因组注释,借助4个生物学软件(SignalP3.0,TMHMM2.0,TargetP1.1 and big-Pi Predictor),分析了水稻所有37条和拟南芥所有24条几丁质酶序列,发现有些几丁质酶都分

  20. Reproductive Cycle of Hard Clam, Meretrix lyrata Sowerby, 1851 (Bivalvia: Veneridae) from Sarawak, Malaysia

    OpenAIRE

    Hamli, Hadi; Idris, Mohd Hanafi; Rajaee, Amy Halimah; Kamal, Abu Hena Mustafa

    2015-01-01

    A study of the reproductive cycle of the hard clam, Meretrix lyrata, was documented based on histological observation and Gonad Index (GI). Samples were taken from estuarine waters of the Buntal River in Sarawak, Malaysia. The gonad of M. lyrata started to develop in September 2013. Gametogenesis continued to develop until the maturation and spawning stage from February to April 2014. The GI pattern for a one-year cycle showed a significant correlation with chlorophyll a. The corresponding GI...

  1. Protein (Viridiplantae): 297819616 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 53 81972:1953 predicted protein Arabidopsis lyrata subsp. lyrata MMIMEEEDQNECNSVGSFYVKVNMEGVPIGRKIDLLSLNGYHDLITTLDYMFNASILYQNLLYYVSLRPKLMAIKNCENRAEEEEMCSEKSHVLTYADKEGDWMMVGDVPWE ...

  2. Protein (Viridiplantae): 297792211 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 59689:31 81972:31 predicted protein Arabidopsis lyrata subsp. lyrata MSFVLGWYLPVIGSKCSTRFWLRTEKAERIKRIKRIKQNKSGSSRSGGTSADQAPVIGSKCSARFWLRTEKAERIKRIKRIKQNKSGSSRSGGTSADQAVRTLLNIY ...

  3. Protein (Viridiplantae): 297792861 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 81972:4104 hypothetical protein ARALYDRAFT_918544 Arabidopsis lyrata subsp. lyrata MGSFKLLVAFTLVVMMTISYDLFSGIGISARTVPPTCYESCNATFQNPECNKMCVGLAYKDGSCIYPPPEVDGLPPKRPYFPRCCCNPIILSPPSP ...

  4. Interspecific and interploidal gene flow in Central European Arabidopsis (Brassicaceae

    Directory of Open Access Journals (Sweden)

    Jørgensen Marte H

    2011-11-01

    Full Text Available Abstract Background Effects of polyploidisation on gene flow between natural populations are little known. Central European diploid and tetraploid populations of Arabidopsis arenosa and A. lyrata are here used to study interspecific and interploidal gene flow, using a combination of nuclear and plastid markers. Results Ploidal levels were confirmed by flow cytometry. Network analyses clearly separated diploids according to species. Tetraploids and diploids were highly intermingled within species, and some tetraploids intermingled with the other species, as well. Isolation with migration analyses suggested interspecific introgression from tetraploid A. arenosa to tetraploid A. lyrata and vice versa, and some interploidal gene flow, which was unidirectional from diploid to tetraploid in A. arenosa and bidirectional in A. lyrata. Conclusions Interspecific genetic isolation at diploid level combined with introgression at tetraploid level indicates that polyploidy may buffer against negative consequences of interspecific hybridisation. The role of introgression in polyploid systems may, however, differ between plant species, and even within the small genus Arabidopsis, we find very different evolutionary fates when it comes to introgression.

  5. Transposed genes in Arabidopsis are often associated with flanking repeats.

    Directory of Open Access Journals (Sweden)

    Margaret R Woodhouse

    2010-05-01

    Full Text Available Much of the eukaryotic genome is known to be mobile, largely due to the movement of transposons and other parasitic elements. Recent work in plants and Drosophila suggests that mobility is also a feature of many nontransposon genes and gene families. Indeed, analysis of the Arabidopsis genome suggested that as many as half of all genes had moved to unlinked positions since Arabidopsis diverged from papaya roughly 72 million years ago, and that these mobile genes tend to fall into distinct gene families. However, the mechanism by which single gene transposition occurred was not deduced. By comparing two closely related species, Arabidopsis thaliana and Arabidopsis lyrata, we sought to determine the nature of gene transposition in Arabidopsis. We found that certain categories of genes are much more likely to have transposed than others, and that many of these transposed genes are flanked by direct repeat sequence that was homologous to sequence within the orthologous target site in A. lyrata and which was predominantly genic in identity. We suggest that intrachromosomal recombination between tandemly duplicated sequences, and subsequent insertion of the circular product, is the predominant mechanism of gene transposition.

  6. Conserved imprinting associated with unique epigenetic signatures in the Arabidopsis genus.

    Science.gov (United States)

    Klosinska, Maja; Picard, Colette L; Gehring, Mary

    2016-01-01

    In plants, imprinted gene expression occurs in endosperm seed tissue and is sometimes associated with differential DNA methylation between maternal and paternal alleles(1). Imprinting is theorized to have been selected for because of conflict between parental genomes in offspring(2), but most studies of imprinting have been conducted in Arabidopsis thaliana, an inbred primarily self-fertilizing species that should have limited parental conflict. We examined embryo and endosperm allele-specific expression and DNA methylation genome-wide in the wild outcrossing species Arabidopsis lyrata. Here we show that the majority of A. lyrata imprinted genes also exhibit parentally biased expression in A. thaliana, suggesting that there is evolutionary conservation in gene imprinting. Surprisingly, we discovered substantial interspecies differences in methylation features associated with paternally expressed imprinted genes (PEGs). Unlike in A. thaliana, the maternal allele of many A. lyrata PEGs was hypermethylated in the CHG context. Increased maternal allele CHG methylation was associated with increased expression bias in favour of the paternal allele. We propose that CHG methylation maintains or reinforces repression of maternal alleles of PEGs. These data suggest that the genes subject to imprinting are largely conserved, but there is flexibility in the epigenetic mechanisms employed between closely related species to maintain monoallelic expression. This supports the idea that imprinting of specific genes is a functional phenomenon, and not simply a byproduct of seed epigenomic reprogramming.

  7. Protein (Viridiplantae): 297852830 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available QSAPSSYFSSFGESIEEFLDRPTSPETERILSGFLQTTDTSNNVDSFLHHTFNSDGTEKKPPEVKTEEDETEIPVTVTTME...972:1358 basic helix-loop-helix family protein Arabidopsis lyrata subsp. lyrata MESEFQQHHFLLHDHQHQRPRNSGLIRY

  8. Protein (Viridiplantae): 297835204 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 21 predicted protein Arabidopsis lyrata subsp. lyrata MSSEKEEKESSKNPTTPPIAVPPTATPPIAKPPVATPPTTKPPVATPPVATPPIATPPITKPPVTTPPVATPP...IAKPPVATPPTATPPVATPPIAKPPVATPPIATPPIAKPPVVTPPIATPPIATPPIAIPPIATPPVSKPPVATPPVATPP...TAMPPVATPPIAKPPVVTPPVATPPIAKPPVATPPIATPPVSKPPVATPPVATPPTTMPPVATPPIAKPPVATPPVATPPIAKPPVATPPIATPPVSKPPVATPPVATPP...TIMPPVATPPIAKPPVATPPVATPPIAKPPIATPPVATPPIAKPPIATPPIAKPPIATPPVATPPIAKPPIATPPIAKPPTATPPTSIPPVATPPITTPPVATPPIATPP...VAKPPVATPPVASPPVAKPPIATPPIAKPPVATPPIAKPPVATPPVATPPVATPPISTPP

  9. Protein (Viridiplantae): 297825487 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 273 81972:1273 hypothetical protein ARALYDRAFT_901062 Arabidopsis lyrata subsp. lyrata MAKPAKGKNKSLLDCSPLLEELPQSPDC...RNRGNPEANPRKCNMAKPAKDKNKSLLDCSPLLEELPQSPDCRNRGNPEANPRKCNMAKPAKDKNKSLLDCSPLLEELPQSPDC

  10. Protein (Viridiplantae): 297831284 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 89:2328 81972:2328 predicted protein Arabidopsis lyrata subsp. lyrata MAPKTKWTGKKRKRGASRRKEVGEEDGETSSKNPIERVEVVEEEREEDRGALSPVVKNEED...VNEEEENEEDENEEGEENEDGGETSSRTLGDSSDERSKDEISEKNRDERLCFVRSPKTCPVYESKKYCVRPILINFVHVVVIGKFILGMYQPVNCILISNDGNCVLAGCLDSTMRLLDR ...

  11. A Microarray Based Genomic Hybridization Method for Identification of New Genes in Plants: Case Analyses of Arabidopsis and Oryza

    Institute of Scientific and Technical Information of China (English)

    Chuanzhu Fan; Maria D. Vibranovski; Ying Chen; Manyuan Long

    2007-01-01

    To systematically estimate the gene duplication events in closely related species, we have to use comparative genomic approaches, either through genomic sequence comparison or comparative genomic hybridization (CGH). Given the scarcity of complete genomic sequences of plant species, in the present study we adopted an array based CGH to investigate gene duplications in the genus Arabidopsis. Fragment genomic DNA from four species, namely Arabidopsis thaliana, A. lyrata subsp. lyrata, A. lyrata subsp. petraea, and A. halleri, was hybridized to Affymetrix (Santa Clara, CA, USA) tiling arrays that are designed from the genomic sequences of A. thaliana. Pairwise comparisons of signal intensity were made to infer the potential duplicated candidates along each phylo-genetic branch. Ninety-four potential candidates of gene duplication along the genus were identified. Among them, the majority (69 of 94) were A. thaliana lineage specific. This result indicates that the array based CGH approach may be used to identify candidates of duplication in other plant genera containing closely related species, such as Oryza, particularly for the AA genome species. We compared the degree of gene duplication through retrotransposon between O. sativa and A. thaliana and found a strikingly higher number of chimera retroposed genes in rice. The higher rate of gene duplication through retroposition and other mechanisms may indicate that the grass species is able to adapt to more diverse environments.

  12. CATION EXCHANGER1 Cosegregates with Cadmium Tolerance in the Metal Hyperaccumulator Arabidopsis halleri and Plays a Role in Limiting Oxidative Stress in Arabidopsis Spp.

    Science.gov (United States)

    Baliardini, Cecilia; Meyer, Claire-Lise; Salis, Pietrino; Saumitou-Laprade, Pierre; Verbruggen, Nathalie

    2015-09-01

    Arabidopsis halleri is a model species for the study of plant adaptation to extreme metallic conditions. In this species, cadmium (Cd) tolerance seems to be constitutive, and the mechanisms underlying the trait are still poorly understood. A previous quantitative trait loci (QTL) analysis performed on A. halleri × Arabidopsis lyrata backcross population1 identified the metal-pump gene Heavy Metal ATPase4 as the major genetic determinant for Cd tolerance. However, although necessary, Heavy Metal ATPase4 alone is not sufficient for determining this trait. After fine mapping, a gene encoding a calcium(2+)/hydrogen(+) antiporter, cation/hydrogen(+) exchanger1 (CAX1), was identified as a candidate gene for the second QTL of Cd tolerance in A. halleri. Backcross population1 individuals displaying the A. halleri allele for the CAX1 locus exhibited significantly higher CAX1 expression levels compared with the ones with the A. lyrata allele, and a positive correlation between CAX1 expression and Cd tolerance was observed. Here, we show that this QTL is conditional and that it is only detectable at low external Ca concentration. CAX1 expression in both roots and shoots was higher in A. halleri than in the close Cd-sensitive relative species A. lyrata and Arabidopsis thaliana. Moreover, CAX1 loss of function in A. thaliana led to higher Cd sensitivity at low concentration of Ca, higher sensitivity to methylviologen, and stronger accumulation of reactive oxygen species after Cd treatment. Overall, this study identifies a unique genetic determinant of Cd tolerance in the metal hyperaccumulator A. halleri and offers a new twist for the function of CAX1 in plants. PMID:26162428

  13. CATION EXCHANGER1 Cosegregates with Cadmium Tolerance in the Metal Hyperaccumulator Arabidopsis halleri and Plays a Role in Limiting Oxidative Stress in Arabidopsis Spp.1[OPEN

    Science.gov (United States)

    Baliardini, Cecilia; Meyer, Claire-Lise; Salis, Pietrino; Saumitou-Laprade, Pierre; Verbruggen, Nathalie

    2015-01-01

    Arabidopsis halleri is a model species for the study of plant adaptation to extreme metallic conditions. In this species, cadmium (Cd) tolerance seems to be constitutive, and the mechanisms underlying the trait are still poorly understood. A previous quantitative trait loci (QTL) analysis performed on A. halleri × Arabidopsis lyrata backcross population1 identified the metal-pump gene Heavy Metal ATPase4 as the major genetic determinant for Cd tolerance. However, although necessary, Heavy Metal ATPase4 alone is not sufficient for determining this trait. After fine mapping, a gene encoding a calcium2+/hydrogen+ antiporter, cation/hydrogen+ exchanger1 (CAX1), was identified as a candidate gene for the second QTL of Cd tolerance in A. halleri. Backcross population1 individuals displaying the A. halleri allele for the CAX1 locus exhibited significantly higher CAX1 expression levels compared with the ones with the A. lyrata allele, and a positive correlation between CAX1 expression and Cd tolerance was observed. Here, we show that this QTL is conditional and that it is only detectable at low external Ca concentration. CAX1 expression in both roots and shoots was higher in A. halleri than in the close Cd-sensitive relative species A. lyrata and Arabidopsis thaliana. Moreover, CAX1 loss of function in A. thaliana led to higher Cd sensitivity at low concentration of Ca, higher sensitivity to methylviologen, and stronger accumulation of reactive oxygen species after Cd treatment. Overall, this study identifies a unique genetic determinant of Cd tolerance in the metal hyperaccumulator A. halleri and offers a new twist for the function of CAX1 in plants. PMID:26162428

  14. Simultaneous quantification and validation of caffeoylquinic acids and flavonoids in Hemistepta lyrata and peroxynitrite-scavenging activity.

    Science.gov (United States)

    Nugroho, Agung; Lim, Sang-Cheol; Byeon, Jeong Su; Choi, Jae Sue; Park, Hee-Juhn

    2013-03-25

    Traditionally, Hemistepta lyrata is consumed as a mountainous vegetable or a medicinal herb to treat inflammation, fever, hemorrhage, and hemorrhoids. In order to provide the scientific evidence of traditional uses of this plant, we identified and quantified thirteen active substances (caffeic acid, chlorogenic acid, and 3,5-di-O-caffeoylquinic acid as caffeoylquinic acids; apigenin, isorhoifolin, acacetin, linarin, diosmetin, diosmin, pectolinarigenin, and pectolinarin as flavones or their glycosides; kaempferol 3-O-rutinoside and rutin as flavonol glycosides) from H. lyrata and evaluated their peroxynitrite-scavenging activity. The chromatographic separation was performed on a Capcell Pak C18 column (5μm, 250mm×4.6mm i.d.) with a gradient elution of 0.05% TFA (trifluoroacetic acid) and 0.05% TFA in MeOH-CH(3)CN (60:40). Validation of HPLC methods on the linearity, LOD, LOQ, intra-day and inter-day variabilities, recovery, and repeatability proved that this method is selective, sensitive, precise, accurate, and reproducible. In peroxynitrite-scavenging assay, caffeic acid derivatives (chlorogenic acid, caffeic acid, and 3,5-di-O-caffeoylquinic acid) exhibited relatively lower IC(50) values than other substances tested. And HPLC simultaneous quantification showed that the 70% MeOH extract and the BuOH fraction contain a higher quantity of caffeic acid derivatives (17.82 and 30.09mg/g, consecutively). Therefore, caffeic acid derivatives could be the main contributors to the peroxynitrite-scavenging activity of H. lyrata than other phenolic substances.

  15. Comparison of in vitro antioxidant properties of extracts from three plants used for medical purpose in Cameroon:Acalypha racemosa, Garcinia lucida and Hymenocardia lyrata

    Institute of Scientific and Technical Information of China (English)

    Djacbou D Sylvie; Pieme Constant Anatole; Biapa Prosper Cabral; Penlap Beng Veronique

    2014-01-01

    Objective:To investigate the in vitro antiradical and antioxidant properties of methanol extracts of Garcinia lucida, Hymenocardia lyrata (H. lyrata) and Acalypha racemosa. Methods: We determined the in vitro antioxidant activity and the total phenolic content, and performed the phytochemical screening of the extracts from fruits, barks, leaves, roots and stems of these plants using standard procedures. Results:The results of the antioxidant properties showed that more than 60%of DPPH., NO. and HO. radicals were inhibited by the extracts. The radical scavenging activity, the total antioxidant capacity as well as the reducing power increased with the concentration of the extracts. The 50%inhibitory concentration (IC50) varied from 1.46 to 21.65 µg/mL depending of the type of extract and the antioxidant tests. The results indicated that all the extracts exhibited antioxidant properties and the roots of H. lyrata showed the best antioxidant activity [(217.17±9.45) mg Equivalent catechin/g of extract] while the highest total phenol content was found in its barks [(169.782±3.025) mg Eq cat/g of extract]. Conclusions:The methanol extract of H. lyrata possess the most antioxidant property among the three extracts.

  16. Forms of zinc accumulated in the hyperaccumulator Arabidopsis halleri.

    Science.gov (United States)

    Sarret, Géraldine; Saumitou-Laprade, Pierre; Bert, Valérie; Proux, Olivier; Hazemann, Jean-Louis; Traverse, Agnès; Marcus, Matthew A; Manceau, Alain

    2002-12-01

    The chemical forms of zinc (Zn) in the Zn-tolerant and hyperaccumulator Arabidopsis halleri and in the non-tolerant and nonaccumulator Arabidopsis lyrata subsp. petraea were determined at the molecular level by combining chemical analyses, extended x-ray absorption spectroscopy (EXAFS), synchrotron-based x-ray microfluorescence, and muEXAFS. Plants were grown in hydroponics with various Zn concentrations, and A. halleri specimens growing naturally in a contaminated site were also collected. Zn speciation in A. halleri was independent of the origin of the plants (contaminated or non-contaminated) and Zn exposure. In aerial parts, Zn was predominantly octahedrally coordinated and complexed to malate. A secondary organic species was identified in the bases of the trichomes, which contained elevated Zn concentrations, and in which Zn was tetrahedrally coordinated and complexed to carboxyl and/or hydroxyl functional groups. This species was detected thanks to the good resolution and sensitivity of synchrotron-based x-ray microfluorescence and muEXAFS. In the roots of A. halleri grown in hydroponics, Zn phosphate was the only species detected, and is believed to result from chemical precipitation on the root surface. In the roots of A. halleri grown on the contaminated soil, Zn was distributed in Zn malate, Zn citrate, and Zn phosphate. Zn phosphate was present in both the roots and aerial part of A. lyrata subsp. petraea. This study illustrates the complementarity of bulk and spatially resolved techniques, allowing the identification of: (a) the predominant chemical forms of the metal, and (b) the minor forms present in particular cells, both types of information being essential for a better understanding of the bioaccumulation processes. PMID:12481065

  17. The development-specific ssp1 and ssp2 genes of Sclerotinia sclerotiorum encode lectins with distinct yet compensatory regulation.

    Science.gov (United States)

    Li, Moyi; Rollins, Jeffrey A

    2010-06-01

    The Ssp1 development-specific protein is the most abundant soluble protein in sclerotia and apothecia of Sclerotinia sclerotiorum. Although closely associated with these developmental stages, the functions of the Ssp1 protein and its paralog, Ssp2, are not known. In this study, protein structure prediction analysis revealed that Ssp1 and Ssp2 are structurally similar to fucose-specific lectins. In an effort to understand the function of these abundant, development-specific proteins, a homokaryotic ssp1 deletion mutant was generated. The resulting mutant (Deltassp1) displays a wild-type growth and development phenotype in culture but produces approximately 50% fewer sclerotia in cultures supplemented with hygromycin. Genetic complementation with a wild-type copy of ssp1 restores normal sclerotium formation in the presence of hygromycin. This suggests that Ssp1 might play a role in resistance to glycoside-containing antibiotics encountered in the environment. Although a slight delay in carpogenic germination was observed, no additional effects of ssp1 loss-of-function were found in regards to apothecial morphology or fecundity. When the expression of ssp2 was examined in the Deltassp1 mutant, it was found to be expressed earlier in sclerotial development and its encoded protein accumulated to higher levels in both sclerotia and apothecia. These findings suggest regulatory compensation for loss of Ssp1 coupled with potential functional redundancy among lectins accumulating in sclerotia and apothecia. PMID:20350614

  18. Identification, duplication, evolution and expression analyses of caleosins in Brassica plants and Arabidopsis subspecies.

    Science.gov (United States)

    Shen, Yue; Liu, Mingzhe; Wang, Lili; Li, Zhuowei; Taylor, David C; Li, Zhixi; Zhang, Meng

    2016-04-01

    Caleosins are a class of Ca(2+) binding proteins that appear to be ubiquitous in plants. Some of the main proteins embedded in the lipid monolayer of lipid droplets, caleosins, play critical roles in the degradation of storage lipids during germination and in lipid trafficking. Some of them have been shown to have histidine-dependent peroxygenase activity, which is believed to participate in stress responses in Arabidopsis. In the model plant Arabidopsis thaliana, caleosins have been examined extensively. However, little is known on a genome-wide scale about these proteins in other members of the Brassicaceae. In this study, 51 caleosins in Brassica plants and Arabidopsis lyrata were investigated and analyzed in silico. Among them, 31 caleosins, including 7 in A. lyrata, 11 in Brassica oleracea and 13 in Brassica napus, are herein identified for the first time. Segmental duplication was the main form of gene expansion. Alignment, motif and phylogenetic analyses showed that Brassica caleosins belong to either the H-family or the L-family with different motif structures and physicochemical properties. Our findings strongly suggest that L-caleosins are evolved from H-caleosins. Predicted phosphorylation sites were differentially conserved in H-caleosin and L-caleosins, respectively. 'RY-repeat' elements and phytohormone-related cis-elements were identified in different caleosins, which suggest diverse physiological functions. Gene structure analysis indicated that most caleosins (38 out of 44) contained six exons and five introns and their intron phases were highly conserved. Structurally integrated caleosins, such as BrCLO3-3 and BrCLO4-2, showed high expression levels and may have important roles. Some caleosins, such as BrCLO2 and BoCLO8-2, lost motifs of the calcium binding domain, proline knot, potential phosphorylation sites and haem-binding sites. Combined with their low expression, it is suggested that these caleosins may have lost function. PMID:26786939

  19. Protein (Viridiplantae): 297848026 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 01:9525 59689:9736 81972:9736 predicted protein Arabidopsis lyrata subsp. lyrata MVEKAKECWTMLQNWKSIHVLQRYQKQ...HFSSTSNKELSWATSNKEHKKADHFPVLHRRSFHHLRLSPPYNCVTRNLCKSCGPASISVIAFPSTVFMAYFTEASSSPFD

  20. Protein (Viridiplantae): 297802186 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :2733 59689:5090 81972:5090 ribosomal protein L12 family protein Arabidopsis lyrata subsp. lyrata MRAPISGFLS...RSLGYLHRTTPLTTATRHLCAVASPEARTKKLERIADDLLNLNRIELYDYSILFSHKLGLNRYGSAVAVAGSDGEASGSTE

  1. The Huygens Surface Science Package (SSP)

    Science.gov (United States)

    Zarnecki, John C.; Leese, Mark; Hathi, Brijen; SSP Consortium, The

    2015-04-01

    The Huygens Surface Science Package (SSP), one of the six instruments selected by ESA, was the only one whose prime purpose was to study the surface of Titan in-situ. Designed at a time when even the basic nature of the surface (i.e. solid ice or liquid hydrocarbons) was unknown, it consisted of 9 separate compact and relatively simple sensors designed to span all likely surface scenarios. The Huygens landing on a "dry lake bed" allowed some of the sensors to be fully exercised. The results and their subsequent interpretations will be presented as well as perspectives from nearly 25 years since the original instrument selection.

  2. Abietatrienes diterpenoids from Sagittaria montevidensis SSP Montevidensis

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Clara M.A.; Radke, Vanessa S.C.O.; Silva, Cleuza C. da [Universidade Estadual de Maringa (UEM), PR (Brazil). Dept. de Quimica; Nakamura, Celso V. [Universidade Estadual de Maringa (UEM), PR (Brazil). Dept. de Analises Clinicas; Oliveira, Pollyanna L. de; Kato, Lucilia; Oliveira, Cecilia M.A. de [Universidade Federal de Goias (UFG), Goiania, GO (Brazil). Inst. de Quimica

    2010-07-01

    The antimicrobial properties of the hexane, hexane/EtOAc and methanol fractions of the fresh petioles of Sagittaria montevidensis ssp montevidensis (Alismataceae) were evaluated against fungi and Gram-negative and Gram-positive bacteria. A new abietatriene-type diterpenoid, 3beta,7alpha-dihydroxi-abieta-8,11,13-triene and the known 3beta-hydroxy-abieta-8,11,13-trien-7-one were isolated from the most active fraction tested and the structures of these compounds were elucidated by data including IR, EIMS, and 1D and 2D NMR spectra. (author)

  3. Evolutionary Fates and Dynamic Functionalization of Young Duplicate Genes in Arabidopsis Genomes1[OPEN

    Science.gov (United States)

    Wang, Jun; Tao, Feng; Marowsky, Nicholas C.; Fan, Chuanzhu

    2016-01-01

    Gene duplication is a primary means to generate genomic novelties, playing an essential role in speciation and adaptation. Particularly in plants, a high abundance of duplicate genes has been maintained for significantly long periods of evolutionary time. To address the manner in which young duplicate genes were derived primarily from small-scale gene duplication and preserved in plant genomes and to determine the underlying driving mechanisms, we generated transcriptomes to produce the expression profiles of five tissues in Arabidopsis thaliana and the closely related species Arabidopsis lyrata and Capsella rubella. Based on the quantitative analysis metrics, we investigated the evolutionary processes of young duplicate genes in Arabidopsis. We determined that conservation, neofunctionalization, and specialization are three main evolutionary processes for Arabidopsis young duplicate genes. We explicitly demonstrated the dynamic functionalization of duplicate genes along the evolutionary time scale. Upon origination, duplicates tend to maintain their ancestral functions; but as they survive longer, they might be likely to develop distinct and novel functions. The temporal evolutionary processes and functionalization of plant duplicate genes are associated with their ancestral functions, dynamic DNA methylation levels, and histone modification abundances. Furthermore, duplicate genes tend to be initially expressed in pollen and then to gain more interaction partners over time. Altogether, our study provides novel insights into the dynamic retention processes of young duplicate genes in plant genomes. PMID:27485883

  4. Evolutionary Fates and Dynamic Functionalization of Young Duplicate Genes in Arabidopsis Genomes.

    Science.gov (United States)

    Wang, Jun; Tao, Feng; Marowsky, Nicholas C; Fan, Chuanzhu

    2016-09-01

    Gene duplication is a primary means to generate genomic novelties, playing an essential role in speciation and adaptation. Particularly in plants, a high abundance of duplicate genes has been maintained for significantly long periods of evolutionary time. To address the manner in which young duplicate genes were derived primarily from small-scale gene duplication and preserved in plant genomes and to determine the underlying driving mechanisms, we generated transcriptomes to produce the expression profiles of five tissues in Arabidopsis thaliana and the closely related species Arabidopsis lyrata and Capsella rubella Based on the quantitative analysis metrics, we investigated the evolutionary processes of young duplicate genes in Arabidopsis. We determined that conservation, neofunctionalization, and specialization are three main evolutionary processes for Arabidopsis young duplicate genes. We explicitly demonstrated the dynamic functionalization of duplicate genes along the evolutionary time scale. Upon origination, duplicates tend to maintain their ancestral functions; but as they survive longer, they might be likely to develop distinct and novel functions. The temporal evolutionary processes and functionalization of plant duplicate genes are associated with their ancestral functions, dynamic DNA methylation levels, and histone modification abundances. Furthermore, duplicate genes tend to be initially expressed in pollen and then to gain more interaction partners over time. Altogether, our study provides novel insights into the dynamic retention processes of young duplicate genes in plant genomes. PMID:27485883

  5. School Teams up for SSP Functional Models

    Science.gov (United States)

    Pignolet, G.; Lallemand, R.; Celeste, A.; von Muldau, H.

    2002-01-01

    Space Solar Power systems appear increasingly as one of the major solutions to the upcoming global energy crisis, by collecting solar energy in space where this is most easy, and sending it by microwave beam to the surface of the planet, where the need for controlled energy is located. While fully operational systems are still decades away, the need for major development efforts is with us now. Yet, for many decision-makers and for most of the public, SSP often still sounds like science fiction. Six functional demonstration systems, based on the Japanese SPS-2000 concept, have been built as a result of a cooperation between France and Japan, and they are currently used extensively, in Japan, in Europe and in North America, for executive presentations as well as for public exhibitions. There is demand for more models, both for science museums and for use by energy dedicated groups, and a senior high school in La Reunion, France, has picked up the challenge to make the production of such models an integrated practical school project for pre-college students. In December 2001, the administration and the teachers of the school have evaluated the feasibility of the project and eventually taken the go decision for the school year 2002- 2003, when for education purposes a temporary "school business company" will be incorporated with the goal to study and manufacture a limited series of professional quality SSP demonstration models, and to sell them world- wide to institutions and advocacy groups concerned with energy problems and with the environment. The different sections of the school will act as the different services of an integrated business : based on the current existing models, the electronic section will redesign the energy management system and the microwave projector module, while the mechanical section of the school will adapt and re-conceive the whole packaging of the demonstrator. The French and foreign language sections will write up a technical manual for

  6. Etude chimique et biologique des huiles essentielles de Juniperus phoenicea ssp. lycia et Juniperus phoenicea ssp. turbinata du Maroc

    Directory of Open Access Journals (Sweden)

    Mansouri, N.

    2011-01-01

    Full Text Available Chemical and biological study of essential oils of Moroccan Juniperus phoenicea ssp. lycia and Juniperus phoenicea ssp. turbinata. The composition of the essential oils of the branches and berries of Juniperus phoenicea (Cupressaceae, J. phoenicea ssp. lycia (plain and J. phoenicea ssp. turbinata (mountain, obtained by hydrodistillation, collected from Morocco, was analyzed by GC and GC/MS. The yields of essential oils were varying in function of the subspecies and of the part of the plant studied. The essential oils of these tree species are largely dominated by α-pinene and may be an important source of this component of a great interest on the international market. The effectiveness of essential oils from branches of the subspecies lycia against fungi decay wood has also been emphasized.

  7. Identification of Independent Streptococcus gordonii SspA and SspB Functions in Coaggregation with Actinomyces naeslundii

    OpenAIRE

    Egland, Paul G.; Dû, Laurence D.; Kolenbrander, Paul E.

    2001-01-01

    The initial stages of dental plaque formation involve the adherence of early colonizing organisms such as Streptococcus gordonii and Actinomyces naeslundii to the saliva-coated tooth surface and to each other. The S. gordonii surface proteins SspA and SspB are known to play a role in adherence to salivary proteins and mediate coaggregation with other bacteria. Coaggregation is the adhesin receptor-mediated interaction between genetically distinct cell types and appears to be ubiquitous among ...

  8. Chemical and Antibacterial Polymorphism of Juniperus oxycedrus ssp. oxycedrus and Juniperus oxycedrus ssp. macrocarpa (Cupressaceae) Leaf Essential Oils from Tunisia

    OpenAIRE

    Hnène Medini; Bruno Manongiu; Neffati Aicha; Leila Chekir-Ghedira; Fethia Harzalla - Skhiri; Med Larbi Khouja

    2013-01-01

    Essential oils from Juniperus oxycedrus L. have been used since antiquity for fragrance, flavoring, medicinal, antimicrobial, insecticidal, and cosmetic purposes. Several works studied the chemical composition of the essential oils of Juniperus oxycedrus leaves. The aim of this study is to investigate the chemotaxonomic relationships and antibacterial activity of two Tunisian subspecies: Juniperus oxycedrus ssp. oxycedrus (L. K.) Deb. and Juniperus oxycedrus ssp. macrocarpa (S. & m.) Ball. In...

  9. Helianthus annuus ssp. texanus has chloroplast DNA and nuclear ribosomal RNA genes of Helianthus debilis ssp. cucumerifolius.

    OpenAIRE

    Rieseberg, L H; Beckstrom-Sternberg, S.; Doan, K

    1990-01-01

    Heiser [Heiser, C. B. (1951) Evolution 5, 42-51] hypothesized that Helianthus annuus ssp. texanus was derived by the introduction of H. annuus into Texas and subsequent introgression of genes from Helianthus debilis ssp. cucumerifolius into H. annuus. Although often considered to be one of the best cases of introgression in plants, alternative hypotheses to introgression, such as convergence or the joint retention of the ancestral condition, could not be ruled out in the original study. To te...

  10. Progeny of Eucalyptus globulus Labill ssp. Globulus

    Institute of Scientific and Technical Information of China (English)

    ZANGDao-qun; ZHANGChuan-hong; LUOJun-min; HUANGYong-xiang; ZHURen-gang

    2003-01-01

    The preliminary assessment of progeny test in a seed orchard of Eucalyptus globulus Labill.ssp.globulus at Yipinglang State Farm of Yunnan Province in China was conducted.The trial was composed of 21 replications,with 2 trees on each plot,15 plots in each incomplete block,and 18 incomplete blocks in each replication,laid out in a α-design of 270 open-pollinated families.The families were of three categories (natural populations,local land race and seed orchard).They were further subdivided into 11 regions.The data from an assessment of growth,stem form and other characteristics of the young trees after being planted 2 years were analyzed.Results are as follows:the different categories differed significantly in their growth,with the families from seed orchards being the best.Regions also differed significantly in their growth.The families from the regions of Westem Victoria,Eastern Victoria and all three seed orchards were better than others.The tamilies from Yunnan had the best frost tolerant and its survival was the highest.For growth,stem form and fungal tolerance,the families from Yunnan were similar to that from Southern Tasmania and Eastem Tasmania.Two-tree plots were strongly recommended over singletree plot designs for large-scale progeny trials.

  11. The maize (Zea mays ssp. mays var. B73 genome encodes 33 members of the purple acid phosphatase gene family

    Directory of Open Access Journals (Sweden)

    Eliécer eGonzález Muñoz

    2015-05-01

    Full Text Available Purple acid phosphatases (PAPs play an important role in plant phosphorus nutrition, both by liberating phosphorus from organic sources in the soil and by modulating distribution within the plant throughout growth and development. Furthermore, members of the PAP protein family have been implicated in a broader role in plant mineral homeostasis, stress responses and development. We have identified 33 candidate PAP encoding gene models in the maize (Zea mays ssp. mays var. B73 reference genome. The maize Pap family includes a clear single-copy ortholog of the Arabidopsis gene AtPAP26, shown previously to encode both major intracellular and secreted acid phosphatase activities. Certain groups of PAPs present in Arabidopsis, however, are absent in maize, while the maize family contains a number of expansions, including a distinct radiation not present in Arabidopsis. Analysis of RNA-sequencing based transcriptome data revealed accumulation of maize Pap transcripts in multiple plant tissues at multiple stages of development, and increased accumulation of specific transcripts under low phosphorus availability. These data suggest the maize PAP family as a whole to have broad significance throughout the plant life cycle, while highlighting potential functional specialization of individual family members.

  12. Unique nucleotide polymorphism of ankyrin gene cluster in Arabidopsis

    Indian Academy of Sciences (India)

    Jianchang Du; Xingna Wang; Mingsheng Zhang; Dacheng Tian; Yong-Hua Yang

    2007-01-01

    The ankyrin (ANK) gene cluster is a part of a multigene family encoding ANK transmembrane proteins in Arabidopsis thaliana, and plays an important role in protein–protein interactions and in signal pathways. In contrast to other regions of a genome, the ANK gene cluster exhibits an extremely high level of DNA polymorphism in an ∼5-kb region, without apparent decay. Phylogenetic analysis detects two clear, deeply differentiated haplotypes (dimorphism). The divergence between haplotypes of accession Col-0 and Ler-0 (Hap-C and Hap-L) is estimated to be 10.7%, approximately equal to the 10.5% average divergence between A. thaliana and A. lyrata. Sequence comparisons for the ANK gene cluster homologues in Col-0 indicate that the members evolve independently, and that the similarity among paralogues is lower than between alleles. Very little intralocus recombination or gene conversion is detected in ANK regions. All these characteristics of the ANK gene cluster are consistent with a tandem gene duplication and birth-and-death process. The possible mechanisms for and implications of this elevated nucleotide variation are also discussed, including the suggestion of balancing selection.

  13. Estudio etnobotánico, arquitectura foliar y anatomía vegetativa de Agastache mexicana ssp. mexicana y A. mexicana ssp. xolocotziana Etnobotany, leaf architecture, and vegetative anatomy of Agastache mexicana ssp. mexicana and A. mexicana ssp. xolocotziana

    OpenAIRE

    Magali A. Santillán-Ramírez; Ma. Edith López-Villafranco; Silvia Aguilar-Rodríguez; Abigail Aguilar-Contreras

    2008-01-01

    El presente trabajo incluye información etnobotánica, así como la arquitectura foliar y anatomía vegetativa de Agastache mexicana ssp. mexicana (toronjil morado) y A. mexicana ssp. xolocotziana (toronjil blanco), con la finalidad de que sean incluidas en la Farmacopea Herbolaria de los Estados Unidos Mexicanos (FHEUM) y que sus caracteres anatómicos se utilicen para validar la identidad del material vegetal en el control de calidad. El registro de la información etnobotánica se efectuó por me...

  14. [Flavonoids of Artemisia campestris, ssp. glutinosa].

    Science.gov (United States)

    Hurabielle, M; Eberle, J; Paris, M

    1982-10-01

    Four flavanones (pinostrobin, pinocembrin, sakuranetin and naringenin), one dihydroflavonol (7-methyl aromadendrin) and one flavone (hispidulin) have been isolated from Artemisia campestris L. ssp. glutinosa Gay and identified by spectroscopic methods. Artemisia campestris L. sous-espèce glutinosa Gay est une Composée Anthémidée largement répandue sur les sables du littoral méditerranéean et abondante dans certaines régions d'Espagne et d'Italie. Dans le cadre d'une étude chimiotaxonomique du genre Artemisia Tourn., nous nous sommes intéressés à l'analyse des flavonoïdes, composés jamais décrits, à notre connaissance, dans cette espèce d' Artemisia. Les sommités fleuries d' Artemisia campestris sous-espèce glutinosa, séchées et pulvérisées, sont dégraissées à l'ether de pétrole et épuisées par le chloroforme. Le fractionnement de l'extrait chloroformique, par chromatographie sur colonne de silice, et la purification de certaines fractions conduisent à l'isolement de six génines flavoniques, à l'etat pur. L' étude des spectres UV, des spectres de masse et des spectres de RMN [1,2] et la comparaison avec des échantillons authentiques permettent de proposer, pour ces flavonoïdes, les structures de la pinostrobine [3], de la pinocembrine [4], de la sakuranétine, de la naringénine [5] (flavanones), de la méthyl-7-aromadendrine, [6, 7] (dihydroflavonol) et de l'hispiduline [8, 9] (flavone); quatre de ces génines sont méthylées. Parmi ces flavonoïdes, la pinostrobine n'a jamais été décrite, à notre connaissance, dans la famille des Composées; la pinocembrine, la sakuranétine et la naringénine ont déjà été signalées chez quelques Astéracées et Eupatoriées [10], et l'hispiduline dans la tribu des Anthémidées ( Santolina chamaecyparissus L.) [8]. Seule, la méthyl-7-aromadendrine semble décrite, à ce jour, dans le genre Artemisia Tourn. [7].

  15. [Flavonoids of Artemisia campestris, ssp. glutinosa].

    Science.gov (United States)

    Hurabielle, M; Eberle, J; Paris, M

    1982-10-01

    Four flavanones (pinostrobin, pinocembrin, sakuranetin and naringenin), one dihydroflavonol (7-methyl aromadendrin) and one flavone (hispidulin) have been isolated from Artemisia campestris L. ssp. glutinosa Gay and identified by spectroscopic methods. Artemisia campestris L. sous-espèce glutinosa Gay est une Composée Anthémidée largement répandue sur les sables du littoral méditerranéean et abondante dans certaines régions d'Espagne et d'Italie. Dans le cadre d'une étude chimiotaxonomique du genre Artemisia Tourn., nous nous sommes intéressés à l'analyse des flavonoïdes, composés jamais décrits, à notre connaissance, dans cette espèce d' Artemisia. Les sommités fleuries d' Artemisia campestris sous-espèce glutinosa, séchées et pulvérisées, sont dégraissées à l'ether de pétrole et épuisées par le chloroforme. Le fractionnement de l'extrait chloroformique, par chromatographie sur colonne de silice, et la purification de certaines fractions conduisent à l'isolement de six génines flavoniques, à l'etat pur. L' étude des spectres UV, des spectres de masse et des spectres de RMN [1,2] et la comparaison avec des échantillons authentiques permettent de proposer, pour ces flavonoïdes, les structures de la pinostrobine [3], de la pinocembrine [4], de la sakuranétine, de la naringénine [5] (flavanones), de la méthyl-7-aromadendrine, [6, 7] (dihydroflavonol) et de l'hispiduline [8, 9] (flavone); quatre de ces génines sont méthylées. Parmi ces flavonoïdes, la pinostrobine n'a jamais été décrite, à notre connaissance, dans la famille des Composées; la pinocembrine, la sakuranétine et la naringénine ont déjà été signalées chez quelques Astéracées et Eupatoriées [10], et l'hispiduline dans la tribu des Anthémidées ( Santolina chamaecyparissus L.) [8]. Seule, la méthyl-7-aromadendrine semble décrite, à ce jour, dans le genre Artemisia Tourn. [7]. PMID:17396957

  16. Galanthindole: a new indole alkaloid from Galanthus plicatus ssp. byzantinus.

    Science.gov (United States)

    Unver, Nehir; Kaya, G Irem; Werner, Christa; Verpoorte, Robert; Gözler, Belkis

    2003-09-01

    A new indole alkaloid, galanthindole, was isolated from Galanthus plicatus ssp. byzantinus (Amaryllidaceae), a plant native to northwestern Turkey. Incorporating a non-fused indole ring, galanthindole may represent the prototype of a new subgroup of the Amaryllidaceae alkaloids. Two other bases, (+)-11-hydroxyvittatine and hordenine, are also reported from the same plant.

  17. Chemical and Antibacterial Polymorphism of Juniperus oxycedrus ssp. oxycedrus and Juniperus oxycedrus ssp. macrocarpa (Cupressaceae Leaf Essential Oils from Tunisia

    Directory of Open Access Journals (Sweden)

    Hnène Medini

    2013-01-01

    Full Text Available Essential oils from Juniperus oxycedrus L. have been used since antiquity for fragrance, flavoring, medicinal, antimicrobial, insecticidal, and cosmetic purposes. Several works studied the chemical composition of the essential oils of Juniperus oxycedrus leaves. The aim of this study is to investigate the chemotaxonomic relationships and antibacterial activity of two Tunisian subspecies: Juniperus oxycedrus ssp. oxycedrus (L. K. Deb. and Juniperus oxycedrus ssp. macrocarpa (S. & m. Ball. In addition, and for the first time, we reported the antibacterial activities of Tunisian J. oxycedrus ssp. macrocarpa and J. oxycedrus ssp. oxycedrus against four bacteria. Essential oils obtained by hydrodistillation were analysed by GC and GC/MS. Fifty-five constituents were identified. Thirty four major compounds were retained for the study of the chemical variability, and α-pinene, sylvestrene, p-cymene, and 13-epi-manoyl oxide were the main ones. The chemical principal components analysis (PCA identified three chemotypes. The study of the antibacterial activity showed that Escherichia coli was found to be extremely resistant (zone diameter 0 mm to all the oils tested, while Staphylococcus aureus was the most sensitive strain (zone diameter 13.5 mm and MIC ranged from 600 to 650 μg/mL.

  18. Estudio etnobotánico, arquitectura foliar y anatomía vegetativa de Agastache mexicana ssp. mexicana y A. mexicana ssp. xolocotziana Etnobotany, leaf architecture, and vegetative anatomy of Agastache mexicana ssp. mexicana and A. mexicana ssp. xolocotziana

    Directory of Open Access Journals (Sweden)

    Magali A. Santillán-Ramírez

    2008-12-01

    Full Text Available El presente trabajo incluye información etnobotánica, así como la arquitectura foliar y anatomía vegetativa de Agastache mexicana ssp. mexicana (toronjil morado y A. mexicana ssp. xolocotziana (toronjil blanco, con la finalidad de que sean incluidas en la Farmacopea Herbolaria de los Estados Unidos Mexicanos (FHEUM y que sus caracteres anatómicos se utilicen para validar la identidad del material vegetal en el control de calidad. El registro de la información etnobotánica se efectuó por medio de entrevistas semiestructuradas a pobladores del municipio de Temoaya, Estado de México, México. Para el estudio anatómico y arquitectura foliar, se elaboraron preparaciones semipermanentes y permanentes de tallos y hojas. Ambos toronjiles son utilizados por los habitantes de la zona de estudio como recurso terapéutico y de ornato; los distinguen por la forma de las hojas, el color de la flor y el aroma, pero no existen preferencias de uso entre ambos. La arquitectura foliar sigue el patrón acródromo de posición basal con un desarrollo imperfecto; las areolas muestran un desarrollo imperfecto con disposición al azar, con vénulas simples o ramificadas una vez y el margen con dientes cunonioides en ambas especies. Diferencias anatómicas se observan en el tallo y son los tricomas no glandulares uniseriados en mayor abundancia y las bandas de esclerénquima más desarrolladas los caracteres que distinguen a A. mexicana ssp. xolocotziana de A. mexicana ssp. mexicana.This work provides information on ethnobotany, leaf architecture and anatomy of Agastache mexicana ssp. mexicana (toronjil morado and A. mexicana ssp. xolocotziana (toronjil blanco, with the purpose that they will be included in the Pharmacopeia Herbolaria of the Estados Unidos Mexicanos (FHEUM and that their anatomical characters could be used to validate the identity of the botanical material in quality control. We gathered ethnobotanical information using semi

  19. Genome-wide identification, classification, and expression analysis of sHSP genes in Chinese cabbage (Brassica rapa ssp pekinensis).

    Science.gov (United States)

    Tao, P; Guo, W L; Li, B Y; Wang, W H; Yue, Z C; Lei, J L; Zhong, X M

    2015-01-01

    Small heat shock proteins (sHSPs) are essential for the plant's normal development and stress responses, especially the heat stress response. The information regarding sHSP genes in Chinese cabbage (Brassica rapa ssp pekinensis) is sparse, hence we performed a genome-wide analysis to identify sHSP genes in this species. We identified 26 non-redundant sHSP genes distributed on all chromosomes, except chromosome A7, with one additional sHSP gene identified from an expressed sequence tag library. Chinese cabbage was found to contain more sHSP genes than Arabidopsis. The 27 sHSP genes were classified into 11 subfamilies. We identified 22 groups of sHSP syntenic orthologous genes between Chinese cabbage and Arabidopsis. In addition, eight groups of paralogous genes were uncovered in Chinese cabbage. Protein structures of the 27 Chinese cabbage sHSPs were modeled using Phyre2, which revealed that all of them contain several conserved β strands across different subfamilies. In general, gene structure was conserved within each subfamily between Chinese cabbage and Arabidopsis, except for peroxisome sHSP. Analysis of promoter motifs showed that most sHSP genes contain heat shock elements or variants. We also found that biased gene loss has occurred during the evolution of the sHSP subfamily in Chinese cabbage. Expression analysis indicated that the greatest transcript abundance of most Chinese cabbage sHSP genes was found in siliques and early cotyledon embryos. Thus, genome-wide identification and characterization of sHSP genes is a first and important step in the investigation of sHSPs in Chinese cabbage. PMID:26505345

  20. Flavonoids from Ulex airensis and Ulex europaeus ssp. europaeus.

    Science.gov (United States)

    Máximo, Patrícia; Lourenço, Ana; Feio, Sónia Savluchinske; Roseiro, José Carlos

    2002-02-01

    From the dichloromethane extract of Ulex airensis three new isoflavonoids, ulexin C (1), ulexin D (2), and 7-O-methylisolupalbigenin (3), were isolated and characterized by spectroscopic methods. Ulexin D (2) was also identified from the dichloromethane extract of Ulex europaeus ssp. europaeus. Together with these new metabolites, 18 compounds of previously known structures were isolated and identified from both species. The antifungal activity of these compounds was tested against Cladosporium cucumerinum by a bioautographic TLC assay. PMID:11858751

  1. Optimal second order diagonally implicit SSP Runge--Kutta methods

    OpenAIRE

    Kocsis, Tihamér A.; Németh, Adrián

    2014-01-01

    Optimal Strong Stability Preserving (SSP) Runge--Kutta methods has been widely investegated in the last decade and many open conjectures have been formulated. The iterated implicit midpoint rule has been observed numerically optimal in large classes of second order methods, and was proven to be optimal for some small cases, but no general proof was known so far to show its optimality. In this paper we show a new approach to analytically investigate this problem and determine the unique optima...

  2. Some aspects of cultivation and utilization of waxy maize (Zea mays L. ssp. ceratina)

    OpenAIRE

    Agnieszka Klimek-Kopyra; Aleksander Szmigiel; Tadeusz Zając; Agnieszka Kidacka

    2012-01-01

    This paper is a review of available literature on Zea mays L.ssp.ceratina. It contains information on the origin, cul- tivation and utilization of waxy maize in the world and can be a contribution to the development of new research on maize cultivation and starch processing technology. Maize, as an old and economically important cereal, played an enormous role in the ancient civilisations of the New World. Among the maize subspecies compared, Z. mays ssp. indurata and Z. mays ssp. indenta...

  3. Hydrologic effects on diameter growth phenology for Celtis laevigata and Quercus lyrata in the floodplain of the lower White River, Arkansas

    Science.gov (United States)

    Allen, Scott T; Cochran, Wesley; Krauss, Ken W.; Keim, Richard F.; King, Sammy L.; Schweitzer, Callie Jo; Clatterbuck, Wayne K.; Oswalt, Christopher M.

    2016-01-01

    Bottomland hardwood (BLH) forests represent an extensive wetland system in the Mississippi Alluvial Valley and southeastern USA, and it is currently undergoing widespread transition in species composition. One such transition involves increased establishment of sugarberry (Celtis laevigata), and decreased establishment of overcup oak (Quercus lyrata). The ecological mechanisms that control this transition are not well understood. We measured monthly diameter growth with dendrometer bands on 86 sugarberry and 42 overcup oak trees at eight sites in the floodplain of the White River (AR, USA) with differing hydrologic regimes. For both species, growth attenuated earlier at drier sites compared to wetter sites. Overcup oak grew slightly longer through late August, suggesting its growth period extends across both wet and dry periods. In contrast, sugarberry growth rate decreased substantially by mid-July. While these results did not necessarily indicate a mechanism for increased prominence of sugarberry, they suggest sugarberry growing season does not as much coincide with the typically drier period of late summer and may be less affected by these conditions. Overcup oak grows later into the dry season and water table conditions during this period may determine if overcup oak benefits from this relatively extended growth period.

  4. PENGEMBANGAN SSP TEMATIK INTEGRATIF UNTUK MEMBANGUN KARAKTER KEJUJURAN DAN KEPEDULIAN SISWA SD KELAS II

    Directory of Open Access Journals (Sweden)

    Sri Hariyati Qodriyah

    2015-07-01

    Full Text Available Penelitian ini bertujuan untuk menghasilkan perangkat pembelajaran berupa SSP Tematik yang dapat mengembangkan karakter siswa kelas 2 sekolah dasar, meliputi karakter kejujuran dan kepedulian. Penelitian ini merupakan penelitian dan pengembangan yang terdiri dari tujuh tahap, yaitu studi pendahuluan, perencanaan, mengembangkan produk awal, uji coba awal, revisi produk utama, uji coba lapangan, dan revisi terhadap produk operasional. SSP yang dikembangkan dievaluasi oleh seorang ahli materi dan media untuk mengetahui validitasnya. Subjek uji coba berjumlah 90 siswa terdiri dari 23 siswa SD Sonosewu, Kasihan, Bantul, DIY sebagai subjek uji coba terbatas dan 33 siswa untuk kelas control dan 34 siswa untuk kelas eksperimen SD 1 Kadipiro, Kasihan, Bantul, DIY. Hasil penelitian ini berupa SSP yang meliputi: silabus, RPP, LKS, dan lembar penilaian. Hasil evaluasi dari ahli materi dan ahli media untuk menguji tingkat kevalidan SSP menyatakan bahwa SSP yang dikembangkan adalah valid dan berkategori “baik”. Hasil uji coba menunjukkan bahwa SSP yang dikembangkan dinyatakan layak serta memenuhi kriteria praktis dan efektif dalam mengembangkan karakter siswa. Pembelajaran dengan SSP yang dikembangkan mampu mengembangkan karakter kejujuran dan kepedulian. Kata Kunci: SSP, karakter jujur dan peduli   DEVELOPING THEMATIC INTEGRATIVE SSP FOR BUILDING THE CHARACTERS OF HONESTY AND CARE GRADE II STUDENT OF ELEMENTARY SCHOOL Abstract This study aims to produce integrated learning sets in the form of thematic SSP that can develop the characters of honesty and care of grade II students of elementary school. This was a research and development study consisting of seven steps, i.e. preliminary study, planning, preliminary product development, preliminary tryout, main product revision, field tryout, revision of operational product, operational product revision, and revision of the final product. The developed SSP was evaluated by a science subject expert to assess

  5. Nonindependent domestication of the two rice subspecies, Oryza sativa ssp. indica and ssp. japonica, demonstrated by multilocus microsatellites.

    Science.gov (United States)

    Gao, Li-Zhi; Innan, Hideki

    2008-06-01

    The origins of the Asian cultivated rice Oryza sativa from its wild ancestor O. rufipogon have been debated for decades. The question mainly concerns whether it originated monophyletically or polyphyletically. To shed light on the origins and demographic history of rice domestication, we genotyped a total of 92 individual plants from the two O. sativa subspecies and O. rufipogon for 60 microsatellites. An approximate Bayesian method was applied to estimate demographic parameters for O. rufipogon vs. O. sativa ssp. indica and O. rufipogon vs. O. sativa ssp. japonica. We showed that the japonica subspecies suffered a more severe bottleneck than the indica subspecies and thus a greater loss of genetic variation during its domestication. Across microsatellite loci there is a significant positive correlation in the reduction of genetic diversity between the two subspecies. The results suggest that completely independent domestication of indica and japonica subspecies may not explain our data and that there is at least partial sharing of their ancestral populations and/or recent gene flow between them. PMID:18505887

  6. 温度、盐度、pH和饵料密度对皱肋文蛤清滤率的影响%Effects of temperature, salinity, pH, and microalgae density on clearance rates of Meretrix lyrata

    Institute of Scientific and Technical Information of China (English)

    栗志民; 刘志刚; 徐法军; 李明昊

    2011-01-01

    The farming of the clam Meretrix lyrata has been successfully developed since 1987 and brought high economic and social benefits to the coastal communities. As a highly valued fishery resource especially in Vietnam, recently M. Lyrata has become another new aqua-culture species with a potential for large-scale farming in the South China Sea and a good market prospects. In this study, by adopting the ecology experimental methods, the effects of seawater temperatures, salinities, pH, and microalgae densities on the clearance rates of M. Lyrata were investigated, which are expected to provide insight on culturing capacity, feeding behavior and energy of M. Lyrata and references for healthy culturing and extension of M. Lyrata. The results showed that the clearance rates of M. Lyrata (P<0. 01) at three sizes were significantly affected by varied temperature (13~33℃), salinity (13~33), pH (7~9), and diet density (2. 5×104~10×104 cell/ml). The maximum clearance rates of the large, medium, and small sized M. Lyrata were 1. 06, 1. 78 and 2. 42 L/g ? H at 28℃ respectively, 0. 35, 0. 65 and 1. 05 L/g ? H at salinity 23, 1. 26, 1. 67 and 2. 02 L/g ? H at pH 8,1. 29, 2. 07 and 2. 29 L/g ? H at microalgae density of 10 × 104 cell/ml. These results indicate that the optimum feeding environ mental conditions were: temperature 28℃, salinity 23, pH 8 and microalgae density 10 × 104 cell/ml. These results indicate that the sensitivity of the large, medium and small sized M. Lyrata to temperature, salinity, pH or microalgae density appeared in the following order: large size<[medium size

  7. A validity study of the SSP-School Inclusion Questionnaire

    Directory of Open Access Journals (Sweden)

    DIANA DĂMEAN

    2012-12-01

    Full Text Available The paper is based on the results of a research that aimed to identify the factors influencing school inclusion among disadvantagedstudents. The main outcome of the research was the development of the SSP-School Inclusion Questionnaire, intended to: (1measure school inclusion levels among students; (2 identify students with significantly lower levels of school inclusion, whoneed to be included in intervention programs; and (3 measure the impact of intervention programs using subjective indicators(beneficiaries’ perception of school and teachers, feelings of safety in school, school performance. The questionnaire was completedby 480 vocational school students aged 15-19 from a large developed urban area (Cluj-Napoca in Romania. The purpose of theresearch was to test the validity and reliability of the instrument and to propose it to professionals working in education (schoolpsychologists, school counsellors etc. for efficient data collection and for measuring the impact of educational intervention.

  8. Regulation of the S-locus receptor kinase and self-incompatibility in Arabidopsis thaliana.

    Science.gov (United States)

    Strickler, Susan R; Tantikanjana, Titima; Nasrallah, June B

    2013-02-01

    Intraspecific mate selectivity often is enforced by self-incompatibility (SI), a barrier to self-pollination that inhibits productive pollen-pistil interactions. In the Brassicaceae, SI specificity is determined by two highly-polymorphic proteins: the stigmatic S-locus receptor kinase (SRK) and its pollen coat-localized ligand, the S-locus cysteine-rich protein (SCR). Arabidopsis thaliana is self fertile, but several of its accessions can be made to express SI, albeit to various degrees, by transformation with functional SRK-SCR gene pairs isolated from its close self-incompatible relative, Arabidopsis lyrata. Here, we use a newly identified induced mutation that suppresses the SI phenotype in stigmas of SRK-SCR transformants of the Col-0 accession to investigate the regulation of SI and the SRK transgene. This mutation disrupts NRPD1a, a gene that encodes a plant-specific nuclear RNA polymerase required for genomic methylation and production of some types of silencing RNAs. We show that NRPD1a, along with the RNA-dependent RNA polymerase RDR2, is required for SI in some A. thaliana accessions. We also show that Col-0 nrpd1a mutants exhibit decreased accumulation of SRK transcripts in stigmas, which is not, however, responsible for loss of SI in these plants. Together, our analysis of the nrpd1a mutation and of SRK promoter activity in various accessions reveals that the SRK transgene is subject to several levels of regulation, which vary substantially by tissue type and by accession. This study thus helps explain the well-documented differences in expression of SI exhibited by SRK-SCR transformants of different A. thaliana accessions.

  9. Phytochemical analysis of the flower extracts of Rhododendron arboreum Sm. ssp. nilagiricum (Zenker) Tagg

    Institute of Scientific and Technical Information of China (English)

    Kiruba S; Mahesh M; Nisha SR; Miller Paul Z; Jeeva S

    2011-01-01

    Objective: To evaluate the preliminary phytochemical screening of the flower extracts of Rhododendron arboreum (R. arboreum) Sm. ssp. nilagiricum (Zenker) Tagg. Methods: The preliminary phytochemical screening was performed by the standard methods as described by Harborne. Results: The phytochemical analysis carried out on the flowers of R. arboreum Sm. ssp. nilagiricum (Zenker) Tagg showed the presence of phenols, saponins, steroids, tannin, xanthoprotein and coumarin. Conclusions:The present study suggested that the flower extracts of R. arboreum Sm. ssp. nilagiricum (Zenker) Tagg possess significant phytochemical constituents and it can be used as antimicrobial agents against clinically isolated pathogens.

  10. Preliminary phytochemical studies of the leaf extracts of Rhododendron arboreum Sm. ssp. nilagiricum (Zenker) Tagg

    Institute of Scientific and Technical Information of China (English)

    Solomon Kiruba; Mony Mahesh; Zachariah Miller Paul; Solomon Jeeva

    2012-01-01

    Objective: To examine the secondary metabolites present in the leaf extracts of Rhododendron arboreum Sm. ssp. nilagiricum (Zenker) Tagg. Methods: Phytochemical screening of the leaf extract was done to determine the phytochemical constituents in the various solvents studied.Results:nilagiricum (Zenker) Tagg. confirm the existence of secondary metabolites such as phenols, saponins and tannins. Conclusions: The study suggests that the leaf extracts of R. arboreum Sm. ssp. nilagiricum (Zenker) Tagg. can be best utilized in developing bioactive compounds against pathogenic infection. The phytochemical study carried out on the leaf extracts of R. arboreum Sm. ssp.

  11. Bosom Buddies: The Symbiotic Relationship Between Infants and Bifidobacterium longum ssp. longum and ssp. infantis. Genetic and Probiotic Features.

    Science.gov (United States)

    Arboleya, Silvia; Stanton, Catherine; Ryan, C Anthony; Dempsey, Eugene; Ross, Paul R

    2016-01-01

    The intestinal microbiota is a complex community that plays an important role in human health from the initial steps of its establishment. Its microbial composition has been suggested to result from selective pressures imposed by the host and is modulated by competition among its members. Bifidobacterium longum is one of the most abundant species of the Bifidobacterium genus in the gut microbiota of healthy breast-fed infants and adults. The recent advancements of 'omics techniques have facilitated the genetic and functional studies of different gut microbiota members. They have revealed the complex genetic pathways used to metabolize different compounds that likely contribute to the competitiveness and persistence of B. longum in the colon. The discovery of a genomic island in B. longum ssp. infantis that encodes specific enzymes for the metabolism of human milk oligosaccharides suggests a specific ecological adaptation. Moreover, B. longum is widely used as probiotic, and beneficial effects in infant health have been reported in several studies. PMID:26934170

  12. An abstract class loader for the SSP and its implementation in TL.

    Energy Technology Data Exchange (ETDEWEB)

    Wickstrom, Gregory Lloyd; Winter, Victor Lono (University of Nebraska at Omaha, Omaha, NE); Fraij, Fares (University of Texas at El Paso, El Paso, TX); Roach, Steve (University of Texas at El Paso, El Paso, TX); Beranek, Jason (University of Nebraska at Omaha, Omaha, NE)

    2004-08-01

    The SSP is a hardware implementation of a subset of the JVM for use in high consequence embedded applications. In this context, a majority of the activities belonging to class loading, as it is defined in the specification of the JVM, can be performed statically. Static class loading has the net result of dramatically simplifying the design of the SSP as well as increasing its performance. Due to the high consequence nature of its applications, strong evidence must be provided that all aspects of the SSP have been implemented correctly. This includes the class loader. This article explores the possibility of formally verifying a class loader for the SSP implemented in the strategic programming language TL. Specifically, an implementation of the core activities of an abstract class loader is presented and its verification in ACL2 is considered.

  13. A Novel Bluetooth Man-In-The-Middle Attack Based On SSP using OOB Association model

    OpenAIRE

    Saravanan, K.; Vijayanand, L.; Negesh, R. K.

    2012-01-01

    As an interconnection technology, Bluetooth has to address all traditional security problems, well known from the distributed networks. Moreover, as Bluetooth networks are formed by the radio links, there are also additional security aspects whose impact is yet not well understood. In this paper, we propose a novel Man-In-The-Middle (MITM) attack against Bluetooth enabled mobile phone that support Simple Secure Pairing(SSP). From the literature it was proved that the SSP association models su...

  14. Evaluación de la calidad funcional y sensorial en cultivares de Triticum aestivum ssp. vulgare y ssp. spelta en cultivo ecológico

    OpenAIRE

    Vargas Kostiuk, María Eugenia

    2016-01-01

    En esta Tesis Doctoral se ha estudiado la influencia del cultivar sobre el comportamiento reológico y panadero de cinco cultivares de trigo sembrados en el mismo año y en el mismo ambiente, en condiciones de cultivo ecológico. Tres de ellos eran de trigo panadero (Triticum aestivum ssp. vulgare), ‘Bonpain’, ‘Craklin’ y ‘Sensas’ y los otros dos de trigo espelta (Triticum aestivum ssp. spelta), ‘Espelta Álava’ y ‘Espelta Navarra’. Actualmente, el alohexaploide trigo panadero (2n=6x=42 genomio A...

  15. Divergent evolutionary and expression patterns between lineage specific new duplicate genes and their parental paralogs in Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Jun Wang

    Full Text Available Gene duplication is an important mechanism for the origination of functional novelties in organisms. We performed a comparative genome analysis to systematically estimate recent lineage specific gene duplication events in Arabidopsis thaliana and further investigate whether and how these new duplicate genes (NDGs play a functional role in the evolution and adaption of A. thaliana. We accomplished this using syntenic relationship among four closely related species, A. thaliana, A. lyrata, Capsella rubella and Brassica rapa. We identified 100 NDGs, showing clear origination patterns, whose parental genes are located in syntenic regions and/or have clear orthologs in at least one of three outgroup species. All 100 NDGs were transcribed and under functional constraints, while 24% of the NDGs have differential expression patterns compared to their parental genes. We explored the underlying evolutionary forces of these paralogous pairs through conducting neutrality tests with sequence divergence and polymorphism data. Evolution of about 15% of NDGs appeared to be driven by natural selection. Moreover, we found that 3 NDGs not only altered their expression patterns when compared with parental genes, but also evolved under positive selection. We investigated the underlying mechanisms driving the differential expression of NDGs and their parents, and found a number of NDGs had different cis-elements and methylation patterns from their parental genes. Overall, we demonstrated that NDGs acquired divergent cis-elements and methylation patterns and may experience sub-functionalization or neo-functionalization influencing the evolution and adaption of A. thaliana.

  16. Suppressor Screens in Arabidopsis.

    Science.gov (United States)

    Li, Xin; Zhang, Yuelin

    2016-01-01

    Genetic screens have proven to be a useful tool in the dissection of biological processes in plants. Specifically, suppressor screens have been widely used to study signal transduction pathways. Here we provide a detailed protocol for ethyl methanesulfonate (EMS) mutagenesis used in our suppressor screens in Arabidopsis and discuss the basic principles behind suppressor screen design and downstream analyses. PMID:26577776

  17. Identification of QTLs Related to Bolting in Brassica rapa ssp. pekinensis(syn. Brassica campestris ssp. pekinensis)

    Institute of Scientific and Technical Information of China (English)

    ZHANG Xiao-wei; XIE Cong-hua; WANG Xiao-wu; WU Jian; ZHAO Jian-jun; SONG Xiao-fei; LI Ying; ZHANG Yan-guo; XU Dong-hui; SUN Ri-fei; YUAN Yu-xiang

    2006-01-01

    A genetic linkage map of Brassica rapa ssp. pekinensis was constructed with 186 AFLP (amplified fragment length polymorphism) markers by using a doubled-haploid (DH) population with 183 individuals. The individuals were derived from F1 which was developed by crossing a bolting resistant DH line Y-177-12 and an easy bolting DH line Y195-93a.AFLPs were generated by the use of restriction enzymes EcoR Ⅰ and Mse Ⅰ. The segregation of each marker and linkage was analyzed by using JoinMap version 3.0. Mapped markers were aligned in ten linkage groups which covered 887.8 cM with an average marker interval of 4.47 cM. Markers showing skewed segregation ratio were clustered in six LGs.Quantitative trait loci (QTL) were mapped for bolting resistance by using MAPQTL 4.0 package. Four QTLs explaining from 7.0 to 9.4% of the total variation were detected, all of them increase bolting resistance. These mapped QTLs could be used to develop a marker assisted selection programme for bolting resistance breeding.

  18. Regulation of bolting and identification of the α-tubulin gene family in Brassica rapa L. ssp pekinensis.

    Science.gov (United States)

    Zhang, Y W; Jin, D; Xu, C; Zhang, L; Guo, M H; Fang, Z Y

    2016-01-01

    Microtubules are important components of eukaryotic cells, and they play vital roles in cell morphogenesis, carrying of signaling molecules, transport of materials, and establishing the cell polarity. During bolting of biennial plants, cell division and elongation are involved, and cell elongation inevitably involves the microtubules arrangement and expression of related genes. So we deduce that it is of great significance to figure out the mechanism of bolting and flowering in which TUA genes are involved. In the present study, bioinformatic methods were used to predict and identify the α-tubulin gene family (BrTUAs) in Brassica rapa L. ssp pekinensis (Chinese cabbage) through the alignment of AtTUA gene sequence from Arabidopsis thaliana with the B. rapa genome database (http://brassicadb.org/brad/) using the basic local alignment search tool. The change in the structure and functions of BrTUAs during the process of evolution, cis-acting elements in the promoter sequences of BrTUAs, and the expression of the identified genes was also analyzed. Twelve members of the α-tubulin gene family were identified from Chinese cabbage. The gene length, intron, exon, and promoter regions were determined to have changed significantly during the genome evolution. Only five of the 12 members were encoded completely and were observed to differ in their spatial and temporal expression. The five BrTUA promoter sequences contained different numbers of cis-elements responsive to light and low-temperature response, cis-elements responsive among which hormonal responses were significantly different. We also report that the BrTUAs were involved in the regulation of the bolting in Chinese cabbage, and propose that this process could be controlled by regulating the expression of BrTUAs. PMID:26909938

  19. Versatile modes of peptide recognition by the AAA+ adaptor protein SspB

    Energy Technology Data Exchange (ETDEWEB)

    Levchenko, Igor; Grant, Robert A.; Flynn, Julia M.; Sauer, Robert T.; Baker, Tania A. (MIT)

    2010-07-19

    Energy-dependent proteases often rely on adaptor proteins to modulate substrate recognition. The SspB adaptor binds peptide sequences in the stress-response regulator RseA and in ssrA-tagged proteins and delivers these molecules to the AAA+ ClpXP protease for degradation. The structure of SspB bound to an ssrA peptide is known. Here, we report the crystal structure of a complex between SspB and its recognition peptide in RseA. Notably, the RseA sequence is positioned in the peptide-binding groove of SspB in a direction opposite to the ssrA peptide, the two peptides share only one common interaction with the adaptor, and the RseA interaction site is substantially larger than the overlapping ssrA site. This marked diversity in SspB recognition of different target proteins indicates that it is capable of highly flexible and dynamic substrate delivery.

  20. Staphylococcus saprophyticus surface-associated protein (Ssp) is associated with lifespan reduction in Caenorhabditis elegans.

    Science.gov (United States)

    Szabados, Florian; Mohner, Amelie; Kleine, Britta; Gatermann, Sören G

    2013-10-01

    Staphylococcal lipases have been proposed as pathogenicity factors. In Staphylococcus saprophyticus the surface-associated protein (Ssp) has been previously characterized as a cell wall-associated true lipase. A S. saprophyticus Δssp::ermB mutant has been described as less virulent in an in vivo model of urinary tract infection compared with its wild-type. This is the first report showing that S. saprophyticus induced a lifespan reduction in Caenorhabditis elegans similar to that of S. aureus RN4220. In two S. saprophyticus Δssp::ermB mutants lifespan reduction in C. elegans was partly abolished. In order to attribute virulence to the lipase activity itself and distinguish this phenomenon from the presence of the Ssp-protein, the conserved active site of the lipase was modified by site-directed ligase-independent mutagenesis and lipase activity-deficient mutants were constructed. These results indicate that the Ssp is associated with pathogenicity in C. elegans and one could speculate that the lipase activity itself is responsible for this virulence.

  1. A modified PCR-SSP method for the identification of ABO blood group antigens.

    Science.gov (United States)

    Downing, J; Darke, C

    2003-08-01

    The ABO blood group antigens are carbohydrate molecules synthesized by the glycosyltransferases encoded by the ABO gene on chromosome 9. Kidney transplantation across the ABO barrier generally leads to rapid humoral graft rejection due to the presence of naturally occurring antibodies to the A and B antigens. We have developed a method for ABO typing our cadaveric organ donors by the polymerase chain reaction using sequence-specific primers (PCR-SSP). The method uses 12 primers in eight PCR mixtures and is performed under the same conditions as our routine HLA-A, B, C PCR-SSP typing. The PCR-SSP-based types of 166 regular blood donors and 148 cadaveric organ donors all showed total concordance with their serologically assigned ABO groups. Six individuals possessing the ABO A subgroups (A3, Ax and Aend) all typed as A1 by PCR-SSP, as expected. PCR-SSP is an appropriate method for ABO typing of cadaveric organ donors and, importantly, enables both ABO and HLA typing to be performed on the same DNA material.

  2. Cytogenetic Diversity of Simple Sequences Repeats in Morphotypes of Brassica rapa ssp. chinensis.

    Science.gov (United States)

    Zheng, Jin-Shuang; Sun, Cheng-Zhen; Zhang, Shu-Ning; Hou, Xi-Lin; Bonnema, Guusje

    2016-01-01

    A significant fraction of the nuclear DNA of all eukaryotes is comprised of simple sequence repeats (SSRs). Although these sequences are widely used for studying genetic variation, linkage mapping and evolution, little attention had been paid to the chromosomal distribution and cytogenetic diversity of these sequences. In this paper, we report the distribution characterization of mono-, di-, and tri-nucleotide SSRs in Brassica rapa ssp. chinensis. Fluorescence in situ hybridization was used to characterize the cytogenetic diversity of SSRs among morphotypes of B. rapa ssp. chinensis. The proportion of different SSR motifs varied among morphotypes of B. rapa ssp. chinensis, with tri-nucleotide SSRs being more prevalent in the genome of B. rapa ssp. chinensis. We determined the chromosomal locations of mono-, di-, and tri-nucleotide repeat loci. The results showed that the chromosomal distribution of SSRs in the different morphotypes is non-random and motif-dependent, and allowed us to characterize the relative variability in terms of SSR numbers and similar chromosomal distributions in centromeric/peri-centromeric heterochromatin. The differences between SSR repeats with respect to abundance and distribution indicate that SSRs are a driving force in the genomic evolution of B. rapa species. Our results provide a comprehensive view of the SSR sequence distribution and evolution for comparison among morphotypes B. rapa ssp. chinensis. PMID:27507974

  3. The transfer RNA genes in Oryza sativa L.ssp.indica

    Institute of Scientific and Technical Information of China (English)

    王希胤; 史晓黎; 郝柏林

    2002-01-01

    The availability of the draft genome sequence of Oryza sativa L. ssp. indica has made it possible to study the rice tRNA genes. A total of 596 tRNA genes, including 3 selenocysteine tRNA genes and one suppressor tRNA gene are identified in 127551 rice contigs. There are 45 species of tRNA genes and the revised wobble hypothesis proposed by Guthrie and Abelson is perfectly obeyed. The relationship between codon usage and the number of corresponding tRNA genes is discussed. Redundancy may exist in the present list of tRNA genes and novel ones may be found in the future. A set of 33 tRNA genes is discovered in the complete chloroplast genome of Oryza sativa L. ssp. indica. These tRNA genes are identical to those in ssp. japonica identified by us independently from the origional annotation.

  4. Optimal Control Strategy for Marine Ssp Podded Propulsion Motor Based on Strong Tracking-Epf

    Directory of Open Access Journals (Sweden)

    Yao Wenlong

    2015-09-01

    Full Text Available Aiming at the non-linearity of state equation and observation equation of SSP (Siemen Schottel Propulsor propulsion motor, an improved particle filter algorithm based on strong tracking extent Kalman filter (ST-EKF was presented, and it was imported into the marine SSP propulsion motor control system. The strong tracking filter was used to update particles in the new algorithm and produce importance densities. As a result, the problems of particle degeneracy and sample impoverishment were ameliorated, the propulsion motor states and the rotor resistance were estimated simultaneously using strong track filter (STF, and the tracking ability of marine SSP propulsion motor control system was improved. Simulation result shown that the improved EPF algorithm was not only improving the prediction accuracy of the motor states and the rotor resistance, but also it can satisfy the requirement of navigation in harbor. It had the better accuracy than EPF algorithm.

  5. Arabidopsis in Wageningen

    OpenAIRE

    Koornneef, M

    2013-01-01

    Arabidopsis thaliana is the plant species that in the past 25 years has developed into the major model species in plant biology research. This was due to its properties such as short generation time, its small genome and its easiness to be transformed. Wageningen University has played an important role in the development of this model, based on interdisciplinary collaborations using genetics as a major tool to investigate aspects of physiology, development, plant-microbe interactions and evol...

  6. Genetic Interactions among AMPK Catalytic Subunit Ssp2 and Glycogen Synthase Kinases Gsk3 and Gsk31 in Schizosaccharomyces Pombe.

    Science.gov (United States)

    Qingyun; Ma, Yan; Kato, Toshiaki; Furuyashiki, Tomoyuki

    2016-01-01

    In Schizosaccharomyces pombe, Ssp2, an ortholog of AMP-activated protein kinase (AMPK), is critical for cell growth at restrictive temperatures and under glucose depletion as well as sexual differentiation under nitrogen depletion. To identify genes genetically related to Ssp2, we performed a genetic screening to search for the genes whose overexpression rescued the growth defects in Δssp2 cells at restrictive temperatures, and identified 35 cosmids as multicopy suppressor genes. In Southern blot analyses, 22 out of these cosmids were hybridized to an ssp2+ probe. Using nucleotide sequencing, we identified the gsk3+ gene in one of the cosmids, and the remaining 12 cosmids were hybridized to a gsk3+ probe. Overexpression of the gsk3+ gene or the gsk31+ gene, another GSK3 member, rescues defective growth of Δssp2 cells at restrictive temperatures and under glucose depletion as well as sexual differentiation under nitrogen depletion. Δgsk3Δgsk31 double knockout cells, but neither Δgsk3 nor Δgsk31 single knockout cells, phenocopy Δssp2 cells. The deletion of the gsk3+ or gsk31+ gene augments the phenotypes of Δssp2 cells. These findings suggest that Gsk3 and Gsk31 are critical and interact with Ssp2 in multiple cellular functions. PMID:27604537

  7. Ssp1 CaMKK: A Sensor of Actin Polarization That Controls Mitotic Commitment through Srk1 in Schizosaccharomyces pombe.

    Directory of Open Access Journals (Sweden)

    Alba Gómez-Hierro

    Full Text Available Calcium/calmodulin-dependent protein kinase kinase (CaMKK is required for diverse cellular functions. Mammalian CaMKK activates CaMKs and also the evolutionarily-conserved AMP-activated protein kinase (AMPK. The fission yeast Schizosaccharomyces pombe CaMKK, Ssp1, is required for tolerance to limited glucose through the AMPK, Ssp2, and for the integration of cell growth and division through the SAD kinase Cdr2.Here we report that Ssp1 controls the G2/M transition by regulating the activity of the CaMK Srk1. We show that inhibition of Cdc25 by Srk1 is regulated by Ssp1; and also that restoring growth polarity and actin localization of ssp1-deleted cells by removing the actin-monomer-binding protein, twinfilin, is sufficient to suppress the ssp1 phenotype.These findings demonstrate that entry into mitosis is mediated by a network of proteins, including the Ssp1 and Srk1 kinases. Ssp1 connects the network of components that ensures proper polarity and cell size with the network of proteins that regulates Cdk1-cyclin B activity, in which Srk1 plays an inhibitory role.

  8. A Novel Bluetooth Man-In-The-Middle Attack Based On SSP using OOB Association model

    CERN Document Server

    Saravanan, K; Negesh, R K

    2012-01-01

    As an interconnection technology, Bluetooth has to address all traditional security problems, well known from the distributed networks. Moreover, as Bluetooth networks are formed by the radio links, there are also additional security aspects whose impact is yet not well understood. In this paper, we propose a novel Man-In-The-Middle (MITM) attack against Bluetooth enabled mobile phone that support Simple Secure Pairing(SSP). From the literature it was proved that the SSP association models such as Numeric comparison, Just works and passkey Entry are not more secure. Here we propose the Out Of Band (OOB) channeling with enhanced security than the previous methods.

  9. INDUSTRIJSKA KONOPLJA (Cannabis sativa L. ssp. sativa) V SLOVENIJI IN PO SVETU

    OpenAIRE

    Medved, Meta

    2012-01-01

    Gojenje industrijske konoplje (Cannabis sativa L. ssp. sativa) ima v Sloveniji in po svetu še vedno negativen prizvok. Razlog za to je sorodnost te rastline z indijsko konopljo (Cannabis sativa L. ssp. indica), ki se vzgaja za pridobivanje droge. To se odraža tudi v zakonodaji, ki nekaterim državam prepoveduje, drugim pa omejuje gojenje konoplje. Namen te raziskave je predstaviti uporabnost in dobičkonosnost pri pridelavi konoplje, ter preveriti vpliv pojavnosti droge, indijske konoplje na ...

  10. The catalase gene differentiates between some strains of Staphylococcus aureus ssp. anaerobius

    OpenAIRE

    Musa, N. O.; Eltom, K.; Gessler, F.; H. Böhnel; Babiker, A.; Sanousi, S. M.

    2010-01-01

    Staphylococcus aureus ssp anaerobius strain S10 was isolated from an outbreak of sheep abscess disease. Sequence of the catalase gene of this strain showed 99 % identity to the catalase gene (katB) sequence of the reference strain (S. aureus ssp. anaerobius strain MVF213) with mismatching of three base pairs. An important substitution located 1036 nucleotides upstream of the initiation codon from “C” in katB to “T” in the catalase gene of strain S10 originated a stop codon. The de...

  11. Analysis of COPII Vesicles Indicates a Role for the Emp47-Ssp120 Complex in Transport of Cell Surface Glycoproteins.

    Science.gov (United States)

    Margulis, Neil G; Wilson, Joshua D; Bentivoglio, Christine M; Dhungel, Nripesh; Gitler, Aaron D; Barlowe, Charles

    2016-03-01

    Coat protein complex II (COPII) vesicle formation at the endoplasmic reticulum (ER) transports nascent secretory proteins forward to the Golgi complex. To further define the machinery that packages secretory cargo and targets vesicles to Golgi membranes, we performed a comprehensive proteomic analysis of purified COPII vesicles. In addition to previously known proteins, we identified new vesicle proteins including Coy1, Sly41 and Ssp120, which were efficiently packaged into COPII vesicles for trafficking between the ER and Golgi compartments. Further characterization of the putative calcium-binding Ssp120 protein revealed a tight association with Emp47 and in emp47Δ cells Ssp120 was mislocalized and secreted. Genetic analyses demonstrated that EMP47 and SSP120 display identical synthetic positive interactions with IRE1 and synthetic negative interactions with genes involved in cell wall assembly. Our findings support a model in which the Emp47-Ssp120 complex functions in transport of plasma membrane glycoproteins through the early secretory pathway.

  12. Full Scale Test of SSP 34m blade, edgewise loading LTT

    DEFF Research Database (Denmark)

    Nielsen, Magda; Jensen, Find Mølholt; Nielsen, Per Hørlyk;

    This report is a part of the research project “Eksperimentel vingeforskning: Strukturelle mekanismer i nutidens og fremtidens store vinger under kombineret last” where a 34m wind turbine blade from SSP-Technology A/S has been tested in edgewise direction (LTT). The applied load is 60% of an unrea...

  13. Full Scale Test SSP 34m blade, Combined load. Data report

    DEFF Research Database (Denmark)

    Nielsen, Per Hørlyk; Nielsen, Magda; Jensen, Find Mølholt;

    This report is part of the research project entitled “Eksperimentel vingeforskning: Strukturelle mekanismer i nutidens og fremtidens store vinger under kombineret last” where a 34m wind turbine blade from SSP-Technology A/S was tested in combined flap and edgewise load. The applied load is 55% of...

  14. Proteomic analysis of bronchoalveolar lavage fluid proteins from mice infected with Francisella tularensis ssp novicida

    Energy Technology Data Exchange (ETDEWEB)

    Varnum, Susan M.; Webb-Robertson, Bobbie-Jo M.; Pounds, Joel G.; Moore, Ronald J.; Smith, Richard D.; Frevert, Charles; Skerret, Shawn J.; Wunschel, David S.

    2012-07-06

    Francisella tularensis causes the zoonosis tularemia in humans and is one of the most virulent bacterial pathogens. We utilized a global proteomic approach to characterize protein changes in bronchoalveolar lavage fluid from mice exposed to one of three organisms, F. tularensis ssp. novicida, an avirulent mutant of F. tularensis ssp. novicida (F.t. novicida-ΔmglA); and Pseudomonas aeruginosa. The composition of BALF proteins was altered following infection, including proteins involved in neutrophil activation, oxidative stress and inflammatory responses. Components of the innate immune response were induced including the acute phase response and the complement system, however the timing of their induction varied. Francisella tularensis ssp. novicida infected mice do not appear to have an effective innate immune response in the first hours of infection, however within 24 hours they show an upregulation of innate immune response proteins. This delayed response is in contrast to P. aeruginosa infected animals which show an early innate immune response. Likewise, F.t. novicida-ΔmglA infection initiates an early innate immune response, however this response is dimished by 24 hours. Finally, this study identifies several candidate biomarkers, including Chitinase 3-like-1 (CHI3L1 or YKL-40) and peroxiredoxin 1, that are associated with F. tularensis ssp. novicida but not P. aeruginosa infection.

  15. PENGEMBANGAN SSP FISIKA BERBASIS PENDEKATAN CTL UNTUK MENINGKATKAN KETERAMPILAN PROSES SAINS DAN MOTIVASI BELAJAR

    Directory of Open Access Journals (Sweden)

    Faiq Makhdum Noor

    2015-04-01

    Full Text Available This research aims to develop a learning device as Subject-Specific Pedagogy (SSP of physics, and to improve science process skills and learning motivation of the students. This research used the 4D model. The subjects of this research were the XI grade students of Muhammadiyah High School 2 Yogyakarta. The data collecting instruments were expert validation sheets, science process skill observation sheets, questionnaire of students’ response to the student books and worksheets, question-naire of students’ response to teaching process, students’ motivation learning sheets, and science process skill paper test. The research data were collected through observation, questionnaire, and paper test, and analyzed quantitatively. The results show as follows. (1 The development of physics SSP is carried out in accordance with the procedures of 4D model product development. (2 The results of expert’s validation show the physics SSP is in the very good criteria. (3 The readability of the student books and worksheets is in the good criteria. (4 The increasing of the score of science process skills and students’ learning motivation in the experimental class is higher than that in the control class. This shows that the physics SSP is fit for use in physics teaching.

  16. The discovery of resistant sources of spring barley, Hordeum vulgare ssp. spontaneum, and unique greenbug biotypes

    Science.gov (United States)

    The genetic sources for host-plant resistance to the greenbug (Schiazphis graminum Ronani) in barley (Hordeum vulgare ssp. spontaneum) are limited in that only two single dominant genes Rsg1 and Rsg2 are available for resistance to greenbug biotypes. We evaluated four new barley lines from the Wild...

  17. An Arabidopsis callose synthase

    DEFF Research Database (Denmark)

    Ostergaard, Lars; Petersen, Morten; Mattsson, Ole;

    2002-01-01

    in the Arabidopsis mpk4 mutant which exhibits systemic acquired resistance (SAR), elevated beta-1,3-glucan synthase activity, and increased callose levels. In addition, AtGsl5 is a likely target of salicylic acid (SA)-dependent SAR, since AtGsl5 mRNA accumulation is induced by SA in wild-type plants, while...... expression of the nahG salicylate hydroxylase reduces AtGsl5 mRNA levels in the mpk4 mutant. These results indicate that AtGsl5 is likely involved in callose synthesis in flowering tissues and in the mpk4 mutant....

  18. Summary of Recent Results from NASA's Space Solar Power (SSP) Programs and the Current Capabilities of Microwave WPT Technology

    Science.gov (United States)

    McSpadden, James; Mankins, John C.; Howell, Joe T. (Technical Monitor)

    2002-01-01

    The concept of placing enormous solar power satellite (SPS) systems in space represents one of a handful of new technological options that might provide large-scale, environmentally clean base load power into terrestrial markets. In the US, the SPS concept was examined extensively during the late 1970s by the U.S. Department of Energy (DOE) and the National Aeronautics and Space Administration (NASA). More recently, the subject of space solar power (SSP) was reexamined by NASA from 1995-1997 in the "fresh look" study, and during 1998 in an SSP "concept definition study". As a result of these efforts, in 1999-2000, NASA undertook the SSP Exploratory Research and Technology (SERT) program which pursued preliminary strategic technology research and development to enable large, multi-megawatt SSP systems and wireless power transmission (WPT) for government missions and commercial markets (in-space and terrestrial). During 2001-2002, NASA has been pursuing an SSP Concept and Technology Maturation (SCTM) program follow-on to the SERT, with special emphasis on identifying new, high-leverage technologies that might advanced the feasibility of future SSP systems. In addition, in 2001, the U.S. National Research Council (NRC) released a major report providing the results of a peer review of NASA's SSP strategic research and technology (R&T) road maps. One of the key technologies needed to enable the future feasibility of SSP/SPS is that of wireless power transmission. Advances in phased array antennas and rectennas have provided the building blocks for a realizable WPT system. These key components include the dc-RF converters in the transmitter, the retrodirective beam control system, and the receiving rectenna. Each subject is briefly covered, and results from the SERT program that studied a 5.8 GHz SPS system are presented. This paper presents a summary results from NASA's SSP efforts, along with a summary of the status of microwave WPT technology development.

  19. Expression of an Antisense BcMF3 Affects Microsporogenesis and Pollen Tube Growth in Arabidopsis

    Institute of Scientific and Technical Information of China (English)

    LIU Le-cheng; CAO Jia-shu; YU Xiao-lin; XIANG Xun; FEI Yong-jun

    2006-01-01

    In an effort to provide some information relevant to the molecular mechanism of genic male sterility in plants, BcMF3 gene that encodes a pectin methylesterase was isolated from the fertile B line of Chinese cabbage-pak-choi (Brassica rapa ssp.chinensis, syn. B. campestris ssp. chinensis). In the present paper, a 455-bp antisense cDNA fragment of BcMF3 was introduced to binary vector pBI121, and then was mobilized into Agrobacterium tumefaciens strain LBA4404. The A.tumefaciens harboring the BcMF3 antisense fragment was transformed to Arabidopsis thaliana by floral dip. Scanning electronic microscopy examination demonstrated that 47.8% of BcMF3 antisense pollen grains exhibited abnormal shape,which might lead to decreased germination of pollens, suggesting that the product of BcMF3 gene plays an important role during microsporogenesis. The evidence on burst of 45.7% of BcMF3 antisense pollen tubes in vitro and a majority of BcMF3 antisense pollens restricted within the stigmatic tissue revealed that BcMF3 is involved in aiding the growth of pollen tubes. The results suggest that BcMF3 acts at both stages of microsporogensis and pollen tube growth.

  20. Transgenic Arabidopsis Gene Expression System

    Science.gov (United States)

    Ferl, Robert; Paul, Anna-Lisa

    2009-01-01

    The Transgenic Arabidopsis Gene Expression System (TAGES) investigation is one in a pair of investigations that use the Advanced Biological Research System (ABRS) facility. TAGES uses Arabidopsis thaliana, thale cress, with sensor promoter-reporter gene constructs that render the plants as biomonitors (an organism used to determine the quality of the surrounding environment) of their environment using real-time nondestructive Green Fluorescent Protein (GFP) imagery and traditional postflight analyses.

  1. Trichoderma volatiles effecting Arabidopsis

    DEFF Research Database (Denmark)

    Ramadan, Metwaly; Gigolashvili, Tamara; Grosskinsky, Dominik Kilian;

    2015-01-01

    Trichoderma species are present in many ecosystems and some strains have the ability to reduce the severity of plant diseases by activating various defense pathways via specific biologically active signaling molecules. Hence we investigated the effects of low molecular weight volatile compounds...... of Trichoderma asperellum IsmT5 on Arabidopsis thaliana. During co-cultivation of T. asperellum IsmT5 without physical contact to A. thaliana we observed smaller but vital and robust plants. The exposed plants exhibit increased trichome numbers, accumulation of defense-related compounds such as H2O2, anthocyanin......, camalexin, and increased expression of defense-related genes. We conclude that A. thaliana perceives the Trichoderma volatiles as stress compounds and subsequently initiates multilayered adaptations including activation of signaling cascades to withstand this environmental influence. The prominent headspace...

  2. SSP Technology Investigation of a High-Voltage DC-DC Converter

    Science.gov (United States)

    Pappas, J. A.; Grady, W. M.; George, Patrick J. (Technical Monitor)

    2002-01-01

    The goal of this project was to establish the feasibility of a high-voltage DC-DC converter based on a rod-array triggered vacuum switch (RATVS) for the Space Solar Power system. The RATVS has many advantages over silicon and silicon-carbide devices. The RATVS is attractive for this application because it is a high-voltage device that has already been demonstrated at currents in excess of the requirement for an SSP device and at much higher per-device voltages than existing or near-term solid state switching devices. The RATVS packs a much higher specific power rating than any solid-state device and it is likely to be more tolerant of its surroundings in space. In addition, pursuit of an RATVS-based system would provide NASA with a nearer-term and less expensive power converter option for the SSP.

  3. Lactic acid production by mixed cultures of Kluyveromyces marxianus, Lactobacillus delbrueckii ssp. bulgaricus and Lactobacillus helveticus.

    Science.gov (United States)

    Plessas, S; Bosnea, L; Psarianos, C; Koutinas, A A; Marchant, R; Banat, I M

    2008-09-01

    Lactic acid production using Kluyveromyces marxianus (IFO 288), Lactobacillus delbrueckii ssp. bulgaricus (ATCC 11842) and Lactobacillus helveticus (ATCC 15009) individually or as mixed culture on cheese whey in stirred or static fermentation conditions was evaluated. Lactic acid production, residual sugar and cell biomass were the main features examined. Increased lactic acid production was observed, when mixed cultures were used in comparison to individual ones. The highest lactic acid concentrations were achieved when K. marxianus yeast was combined with L. delbrueckii ssp. bulgaricus, and when all the strains were used revealing possible synergistic effects between the yeast and the two lactic acid bacteria. The same synergistic effects were further observed and verified when the mixed cultures were applied in sourdough fermentations, proving that the above microbiological system could be applied in the food fermentations where high lactic acid production is sought.

  4. ARE ENTEROCOCCUS FAECIUM CRL 183 AND LACTOBACILLUS HELVETICUS SSP. JUGURTI 416 ABLE TO PRODUCE ANTIMICROBIAL SUBSTANCE?

    Directory of Open Access Journals (Sweden)

    R. BEDANI

    2008-12-01

    Full Text Available

    Production of antimicrobial substance by E. faecium CRL 183 and L. helveticus ssp jugurti 416 was tested against pathogenic bacteria and microorganisms isolated from Wistar rat faeces, using a spot-on-the-lawn assay. Three pathogenic bacteria (Listeria monocytogenes 1/2a, Salmonella enteridites 193/95, Escherichia coli O157:H7 and twenty-fi ve colonies, isolated from animal faeces, belonging to the following groups Enterococcus, Lactobacillus, Clostridium, Bacteroides and Enterobacteriaceae, were used as indicator microorganisms. The results showed that E. faecium CRL 183 and L. helveticus ssp jugurti 416 did not produce signifi cant antimicrobial activity against the indicator microorganisms tested. More tests needed to be carried out with other indicator bacteria and other culture media to confi rm the lack of antimicrobial production.

  5. Chemical Composition and Antimicrobial Activity of Thymus praecox Opiz ssp. polytrichus Essential Oil from Serbia

    Directory of Open Access Journals (Sweden)

    Nada V. Petrović

    2016-03-01

    Full Text Available Chemical composition and antimicrobial activity of the essential oil of wild growing Thymus praecox Opiz ssp. polytrichus were studied. trans-Nerolidol (19.79%, germacrene D (18.48% and thymol (9.62% were the main components in essential oil. This study is the first report of the antimicrobial activity of essential oil obtained from the T. praecox Opiz ssp. polytrichus. Antimicrobial activity of essential oil was investigated on Bacillus cereus, Micrococcus flavus, Staphylococcus aureus, Listeria monocytogenes, Escherichia coli, Pseudomonas aeruginosa, Enterobacter cloacae, Salmonella typhimurium, Aspergillus fumigatus, A. versicolor, A. ochraceus, A. niger, Trichoderma viride, Penicillium funiculosum, P. ochrochloron, and P. verrucosum var. cyclopium strains. In the antimicrobial assays, essential oil showed high antimicrobial potential (MIC 19–150 m g/mL, MBC 39–300 m g/mL for bacteria; and MIC 19.5–39 m g/mL, MFC 39–78 m g/mL for fungi.

  6. Susceptibility of wild carrot (Daucus carota ssp. carota) to Sclerotinia sclerotiorum

    DEFF Research Database (Denmark)

    Jensen, Brita Dahl; Finckh, M.R.; Munk, Lisa;

    2008-01-01

    Sclerotinia soft rot, caused by Sclerotinia sclerotiorum, is a severe disease of cultivated carrots (Daucus carota ssp. sativus) in storage. It is not known whether Sclerotinia soft rot also affects wild carrots (D. carota ssp. carota), which hybridise and exchange genes, among them resistance...... genes, with the cultivated carrot. We investigated the susceptibility of wild carrots to S. sclerotiorum isolates from cultivated carrot under controlled and outdoor conditions. Inoculated roots from both wild and cultivated plants produced sclerotia and soft rot in a growth chamber test. Two isolates...... differed significantly in the ability to produce lesions and sclerotia on roots of both wild carrots and cv. Bolero. Flowering stems of wild carrots produced dry, pale lesions after inoculation with the pathogen, and above-ground plant weight was significantly reduced 4 weeks after inoculation...

  7. SSP: a simple software process for small- size software development projects

    OpenAIRE

    Ochoa, Sergio; Pino, José A.; Luis A. Guerrero; Cesar A Collazos

    2006-01-01

    A large number of software development projects in Latin- American countries are small-size, poorly defined and time pressured. These projects usually involve under qualified people. Provided that well-known software development models have shown limited applicability in such scenario, developers usually carry out ad-hoc software processes. Therefore, the obtained results are unpredictable. This article presents a Simple Software Process (SSP) for small-size software projects involving under ...

  8. Evaluating the Strange Situation Procedure (SSP to assess the bond between dogs and humans.

    Directory of Open Access Journals (Sweden)

    Therese Rehn

    Full Text Available The Strange Situation Procedure (SSP is increasingly being used to study attachment between dogs and humans. It has been developed from the Ainsworth Strange Situation Procedure, which is used extensively to investigate attachment between children and their parents. In this experiment, 12 female beagle dogs were tested in two treatments to identify possible order effects in the test, a potential weakness in the SSP. In one treatment (FS, dogs participated together with a 'familiar person' and a 'stranger'. In a control treatment (SS, the same dogs participated together with two unfamiliar people, 'stranger A' and 'stranger B'. Comparisons were made between episodes within as well as between treatments. As predicted in FS, dogs explored more in the presence of the familiar person than the stranger. Importantly, they also explored more in the presence of stranger A (who appeared in the same order as the familiar person and followed the same procedure than stranger B in SS. Furthermore, comparisons between treatments, where a familiar person was present in FS and stranger A was present in SS, showed no differences in exploration. In combination, these results indicate that the effect of a familiar person on dogs' exploratory behaviour, a key feature when assessing secure attachment styles, could not be tested reliably due to the order in which the familiar person and the stranger appear. It is proposed that in the future only counterbalanced versions of the SSP are used. Alternatively, since dogs reliably initiated more contact with the familiar person compared to the strangers, it is suggested that future studies on attachment in dogs towards humans should focus either on the behaviour of the dog in those episodes of the SSP when the person returns, or on reunion behaviour in other studies, specially designed to address dog-human interactions at this time.

  9. Brain SPECT analysis by 3D-SSP and clinical features of Parkinson's disease

    International Nuclear Information System (INIS)

    The aim of the present study is to investigate the association of symptoms in Parkinson's disease (PD) with cerebral perfusion on single photon emission computed tomography (SPECT). The clinical features of PD were compared with SPECT images of the brain obtained by three-dimensional stereotactic surface projection (3D-SSP) analysis. Thirty-eight patients who had PD without dementia (17 men and 21 women with a mean age of 68.6±4.7 years) were enrolled in this study. Their symptoms were rated using the unified parkinson's disease rating scale (UPDRS). Within a week, all patients were examined by SPECT with I-123, and reconstructed images were analyzed with 3D-SSP using an image-analysis software, iSSP ver. 3.5. Data on brain surface perfusion extracted by 3D-SSP analysis were compared between the PD patients and the normal control group. The same comparisons were made for subgroups of PD patients with severe symptoms, such as tremor, gait disturbance, bradykinesia, and the UPDRS motor score. Cerebral perfusion was decreased at the anterior cingulate cortex and occipital lobe of the PD patients compared with the normal controls. In the subgroups with severe gait disturbance and severe bradykinesia, additional hypoperfusion was seen at the lateral frontal association and lateral temporal association and the medial frontal gyrus, and by the pixel-by-pixel comparison, perfusion was significantly decreased (p<0.05) at the medial frontal gyrus and anterior cingulate cortex compared with the normal control group. In PD patients, severe gait disturbance and bradykinesia may be correlated with hypoperfusion of the medial aspect of the frontal lobe. This suggests that functional disturbance of the supplementary motor area and other parts of the frontal lobe are involved in the development of gait disturbance and bradykinesia in PD. (author)

  10. Khorasan wheat population researching (Triticum turgidum, ssp. Turanicum (McKey) in the minimum tillage conditions

    OpenAIRE

    Ikanović Jela; Popović Vera; Janković Snežana; Živanović Ljubiša; Rakić Sveto; Dončić Dalibor

    2014-01-01

    Khorasan wheat occupies a special place in the group of new-old cereals (Triticum turgidum, ssp. Turanicum McKey). It is an ancient species, native to eastern Persia, that is very close to durum wheat by morphological characteristics. Investigations were carried out in agro ecological conditions of the eastern Srem, with two wheat populations with dark and bright awns as objects of study. The following morphological and productive characteristics were inves...

  11. Failure of PCR to Detect Treponema pallidum ssp. pertenue DNA in Blood in Latent Yaws.

    Directory of Open Access Journals (Sweden)

    Michael Marks

    Full Text Available Yaws, caused by Treponema pallidum ssp. pertenue, is a neglected tropical disease closely related to venereal syphilis and is targeted for eradication by 2020. Latent yaws represents a diagnostic challenge, and current tools cannot adequately distinguish between individuals with true latent infection and individuals who are serofast following successful treatment. PCR on blood has previously been shown to detect T. pallidum DNA in patients with syphilis, suggesting that this approach may be of value in yaws. We performed real-time PCR for Treponema pallidum ssp. pertenue on blood samples from 140 children with positive T. pallidum Particle Agglutination (TPPA and Rapid Plasma Reagin (RPR tests and 7 controls (negative serology, all collected as part of a prospective study of yaws in the Solomon Islands. All samples were also tested by a nested PCR for T. pallidum. 12 patients had clinical evidence of active yaws whilst 128 were considered to have latent yaws. 43 children had high titre rapid plasma reagins (RPRs of ≥1:32. PCR testing with both assays gave negative results in all cases. It is possible that the failure to detect T. pallidum ssp. pertenue in blood reflects lower loads of organism in latent yaws compared to those in latent infection with T. pallidum ssp. pertenue, and/or a lower propensity for haematogenous dissemination in yaws than in syphilis. As the goal of the yaws control programme is eradication, a tool that can differentiate true latent infection from individuals who are serofast would be of value; however, PCR of blood is not that tool.

  12. Incorporation of probiotic bacteria (Lactobacillus acidophilus and Bifidobacterium ssp.) in Argentinean ovine cheese

    OpenAIRE

    Perotti, María; Wolf, Irma; Addis, Margherita; Comunian, Roberta; Paba, Antonio; Meinardi, Carlos

    2014-01-01

    The market of cheeses from ewe’s milk has been growing steadily in Argentina. The nutritional benefits of these products can be enhanced by adding probiotic cultures. In the present study, the survival of a mix of probiotic microorganisms (Lactobacillus acidophilus La-5 and Bifidobacterium animalis ssp. lactis Bb12) in a semi-hard ovine cheese, manufactured with a technology previously developed in our institute was evaluated. Besides, the effect of its incorporation on the chemical compositi...

  13. Failure of PCR to Detect Treponema pallidum ssp. pertenue DNA in Blood in Latent Yaws.

    Science.gov (United States)

    Marks, Michael; Katz, Samantha; Chi, Kai-Hua; Vahi, Ventis; Sun, Yongcheng; Mabey, David C; Solomon, Anthony W; Chen, Cheng Y; Pillay, Allan

    2015-01-01

    Yaws, caused by Treponema pallidum ssp. pertenue, is a neglected tropical disease closely related to venereal syphilis and is targeted for eradication by 2020. Latent yaws represents a diagnostic challenge, and current tools cannot adequately distinguish between individuals with true latent infection and individuals who are serofast following successful treatment. PCR on blood has previously been shown to detect T. pallidum DNA in patients with syphilis, suggesting that this approach may be of value in yaws. We performed real-time PCR for Treponema pallidum ssp. pertenue on blood samples from 140 children with positive T. pallidum Particle Agglutination (TPPA) and Rapid Plasma Reagin (RPR) tests and 7 controls (negative serology), all collected as part of a prospective study of yaws in the Solomon Islands. All samples were also tested by a nested PCR for T. pallidum. 12 patients had clinical evidence of active yaws whilst 128 were considered to have latent yaws. 43 children had high titre rapid plasma reagins (RPRs) of ≥1:32. PCR testing with both assays gave negative results in all cases. It is possible that the failure to detect T. pallidum ssp. pertenue in blood reflects lower loads of organism in latent yaws compared to those in latent infection with T. pallidum ssp. pertenue, and/or a lower propensity for haematogenous dissemination in yaws than in syphilis. As the goal of the yaws control programme is eradication, a tool that can differentiate true latent infection from individuals who are serofast would be of value; however, PCR of blood is not that tool. PMID:26125585

  14. Environmental Restoration and Waste Management Site-Specific Plan (SSP) for fiscal year 1992 (FY92)

    International Nuclear Information System (INIS)

    The FY-92 Site-Specific Plan (FY-92 SSP) for environmental restoration and waste management at the Idaho National Engineering Laboratory (INEL) is designed to provide the reader with easy access to the status of environmental restoration and waste management activities at INEL. The first chapter provides background on INIEL's physical environment, site history and mission, and general information about the site and its facilities. In addition, this chapter discusses the inter-relationships between the Site Specific Plan, the Environmental Restoration and Waste Management Five-Year Plan, the environmental restoration and waste management prioritization systems, and the Activity Data Sheets (ADSs) for environmental restoration and waste management. This discussion should help readers understand what the SSP is and how it fits into the environmental restoration and waste management process at INEL. This understanding should provide the reader with a better context for understanding the discussions in the SSP as well as a better feel for how and what to comment on during the public comment period that will be held from the first of September through the end of October 1991

  15. Evaluation of different DNA-based fingerprinting methods for typing Photobacterium damselae ssp. piscicida.

    Science.gov (United States)

    Mancuso, Monique; Avendaño-Herrera, Rubén; Zaccone, R; Toranzo, Alicia E; Magariños, Beatriz

    2007-01-01

    This study evaluates the effectiveness of three different molecular techniques, repetitive extragenic palindromic PCR (REP-PCR), enterobacterial repetitive intergenic consensus sequence PCR (ERIC-PCR) and the random amplified polymorphic DNA (RAPD-PCR) for rapid typing of Photobacterium damselae ssp. piscicida strains isolated from different species of marine fish and geographic areas. The results obtained by the three methods showed that RAPD and ERIC-PCR were more discriminative for suitable rapid typing of Ph. damselae ssp. piscicida than REP-PCR. The analysis of DNA banding patterns generated by both molecular methods (RAPD and ERIC-PCR) clearly separated the strains into two main groups that strongly correlated with their geographic origin. Moreover, the REP-PCR analysis was less reproducible than the RAPD and ERIC-PCR methods and does not allow the establishment of genetic groups. RAPD and ERIC-PCR constitute valuable tools for molecular typing of Ph. damselae ssp. piscicida strains, which can be used in epidemiological studies of photobacteriosis infections. PMID:17657358

  16. Simultaneous genotyping of HPA-17w to -21w by PCR-SSP in Chinese Cantonese.

    Science.gov (United States)

    Zhou, Haojie; Ding, Haoqiang; Chen, Yangkai; Li, Xiaofan; Ye, Xin; Nie, Yongmei

    2015-01-01

    Studies have reported the polymorphism of human platelet antigen (HPA)-17w, -18w, -19w, -20w, and -21w. However, the distribution of these five antigens in Chinese Cantonese is still unknown. In this study, we designed new sequence-specific primers for HPA-19w to -21w and used published primers for HPA-17w and -18w to develop a polymerase chain reaction with the sequence-specific primers (PCR-SSP) method for simultaneously genotyping HPA-17w to -21w. A total of 820 unrelated Cantonese apheresis platelet donors in Guangzhou were involved in this study. Among the five HPAs, complete a/a homozygosity was observed for HPA-17w to -20w with an allele frequency of 1.0000. For HPA-21w, nine individuals (9/820, 1.10%) were found to be HPA-21a/bw heterozygous and the allele frequencies of HPA-21a and HPA-21bw were 0.9945 (1631/1640) and 0.0055 (9/1640), respectively. The reliability of the PCR-SSP method was determined by comparing with the genotyping results by DNA sequencing, and no inconsistencies were observed between the two methods. This study provides a reliable PCR-SSP method for simultaneously genotyping HPA-17w to -21w and could improve HPA-matched platelet transfusion in Chinese Cantonese.

  17. The catalase gene differentiates between some strains of Staphylococcus aureus ssp. anaerobius.

    Science.gov (United States)

    Musa, N O; Eltom, K; Gessler, F; Böhnel, H; Babiker, A; El Sanousi, S M

    2010-05-01

    Staphylococcus aureus ssp anaerobius strain S10 was isolated from an outbreak of sheep abscess disease. Sequence of the catalase gene of this strain showed 99% identity to the catalase gene (katB) sequence of the reference strain (S. aureus ssp. anaerobius strain MVF213) with mismatching of three base pairs. An important substitution located 1036 nucleotides upstream of the initiation codon from "C" in katB to "T" in the catalase gene of strain S10 originated a stop codon. The deduced protein (345 amino acids) is 105 amino acids shorter than that of katB. Partial sequence of the catalase gene of other 8 local isolates in addition to another reference strain (DSM 20714/ATCC 35844) revealed the same mutations in all local (African) strains, whereas the sequence of the reference (European) strain was typical to that of katB. Sequence of the catalase gene of S. aureus ssp. anaerobius strain S10 was deposited in GenBank under accession no. EU281993. PMID:20526831

  18. Evolutionary pattern of the regulatory network for flower development:Insights gained from a comparison of two Arabidopsis species

    Institute of Scientific and Technical Information of China (English)

    yang LIU; Chun-Ce GUO; Gui-Xia XU; Hong-Yan SHAN; Hong-Zhi KONG

    2011-01-01

    Previous studies on Arabidopsis thaliana and other model plants have indicated that the development of a flower is controlled by a regulatory network composed of genes and the interactions among them.Studies on the evolution of this network will therefore help understand the genetic basis that underlies flower evolution.In this study,by reviewing the most recent published work,we added 31 genes into the previously proposed regulatory network for flower development.Thus,the number of genes reached 60.We then compared the composition,structure,and evolutionary rate of these genes between A.thaliana and one of its allies,A.lyrata.We found that two genes (FLC and MAF2) show 1∶ 2 and 2∶ 2 relationships between the two species,suggesting that they have experienced independent,post-speciation duplications.Of the remaining 58 genes,35 (60.3%) have diverged in exon-intron structure and,consequently,code for proteins with different sequence features and functions.Molecular evolutionary analyses further revealed that,although most floral genes have evolved under strong purifying selection,some have evolved under relaxed or changed constraints,as evidenced by the elevation of nonsynonymous substitution rates and/or the presence of positively selected sites.Taken together,these results suggest that the regulatory network for flower development has evolved rather rapidly,with changes in the composition,structure,and functional constraint of genes,as well as the interactions among them,being the most important contributors.

  19. Intraspecific variability of cadmium tolerance and accumulation, and cadmium-induced cell wall modifications in the metal hyperaccumulator Arabidopsis halleri.

    Science.gov (United States)

    Meyer, Claire-Lise; Juraniec, Michal; Huguet, Stéphanie; Chaves-Rodriguez, Elena; Salis, Pietro; Isaure, Marie-Pierre; Goormaghtigh, Erik; Verbruggen, Nathalie

    2015-06-01

    Certain molecular mechanisms of Cd tolerance and accumulation have been identified in the model species Arabidopsis halleri, while intraspecific variability of these traits and the mechanisms of shoot detoxification were little addressed. The Cd tolerance and accumulation of metallicolous and non-metallicolous A. halleri populations from different genetic units were tested in controlled conditions. In addition, changes in shoot cell wall composition were investigated using Fourier transform infrared spectroscopy. Indeed, recent works on A. halleri suggest Cd sequestration both inside cells and in the cell wall/apoplast. All A. halleri populations tested were hypertolerant to Cd, and the metallicolous populations were on average the most tolerant. Accumulation was highly variable between and within populations, and populations that were non-accumulators of Cd were identified. The effect of Cd on the cell wall composition was quite similar in the sensitive species A. lyrata and in A. halleri individuals; the pectin/polysaccharide content of cell walls seems to increase after Cd treatment. Nevertheless, the changes induced by Cd were more pronounced in the less tolerant individuals, leading to a correlation between the level of tolerance and the extent of modifications. This work demonstrated that Cd tolerance and accumulation are highly variable traits in A. halleri, suggesting adaptation at the local scale and involvement of various molecular mechanisms. While in non-metallicolous populations drastic modifications of the cell wall occur due to higher Cd toxicity and/or Cd immobilization in this compartment, the increased tolerance of metallicolous populations probably involves other mechanisms such as vacuolar sequestration. PMID:25873677

  20. Ectopic Expression of the Chinese Cabbage Malate Dehydrogenase Gene Promotes Growth and Aluminum Resistance in Arabidopsis.

    Science.gov (United States)

    Li, Qing-Fei; Zhao, Jing; Zhang, Jing; Dai, Zi-Hui; Zhang, Lu-Gang

    2016-01-01

    Malate dehydrogenases (MDHs) are key metabolic enzymes that play important roles in plant growth and development. In the present study, we isolated the full-length and coding sequences of BraMDH from Chinese cabbage [Brassica campestris L. ssp. pekinensis (Lour) Olsson]. We conducted bioinformatics analysis and a subcellular localization assay, which revealed that the BraMDH gene sequence contained no introns and that BraMDH is localized to the chloroplast. In addition, the expression pattern of BraMDH in Chinese cabbage was investigated, which revealed that BraMDH was heavily expressed in inflorescence apical meristems, as well as the effect of BraMDH overexpression in two homozygous transgenic Arabidopsis lines, which resulted in early bolting and taller inflorescence stems. Furthermore, the fresh and dry weights of aerial tissue from the transgenic Arabidopsis plants were significantly higher than those from the corresponding wild-type plants, as were plant height, the number of rosette leaves, and the number of siliques produced, and the transgenic plants also exhibited stronger aluminum resistance when treated with AlCl3. Therefore, our results suggest that BraMDH has a dramatic effect on plant growth and that the gene is involved in both plant growth and aluminum resistance. PMID:27536317

  1. Arabidopsis thaliana peroxidase N

    DEFF Research Database (Denmark)

    Mirza, Osman Asghar; Henriksen, A; Ostergaard, L;

    2000-01-01

    The structure of the neutral peroxidase from Arabidopsis thaliana (ATP N) has been determined to a resolution of 1.9 A and a free R value of 20.5%. ATP N has the expected characteristic fold of the class III peroxidases, with a C(alpha) r.m.s.d. of 0.82 A when compared with horseradish peroxidase C...... (HRP C). HRP C is 54% identical to ATP N in sequence. When the structures of four class III plant peroxidases are superimposed, the regions with structural differences are non-randomly distributed; all are located in one half of the molecule. The architecture of the haem pocket of ATP N is very similar...... to that of HRP C, in agreement with the low small-molecule substrate specificity of all class III peroxidases. The structure of ATP N suggests that the pH dependence of the substrate turnover will differ from that of HRP C owing to differences in polarity of the residues in the substrate-access channel. Since...

  2. SLA typing using the PCR-SSP method and establishment of the SLA homozygote line in pedigreed SNU miniature pigs.

    Science.gov (United States)

    Yeom, Su-Cheong; Park, Chung-Gyu; Lee, Byeong-Chun; Lee, Wang-Jae

    2010-04-01

    Seoul National University (SNU) miniature pigs represent a closed colony with 24 founder pigs and a well preserved pedigree. Characterization using mRNA sequence analysis was conducted for 6 swine leukocyte antigen (SLA) loci in parental or founder pigs, and 17 defined alleles were detected. Based on these complete coding sequences, 17 sequence specific primers (SSPs) were designed for polymorphic sites. To validate the specificity of each allele SSP, the PCR-SSP was conducted with defined allele clones as templates. PCR-SSP was conducted with the hot start polymerase and touch-down PCR. The parental or found SNU miniature pigs showed overall SLA class I and II heterozygotes. Using the established PCR-SSP method, we conducted SLA typing for breeding stock including 2 pedigreed pigs and identified the novel SLA class II homozygote haplotye (DRA*0201, DRB1*0403, DQA*0102 and DQB1*0701) and 2 SLA homozygote pig lines: SLA class I Hp-3.0 and class II Hp-0.3, and SLA class I Hp-2.0 and class II Hp-0.2. We thought that our PCR-SSP SLA typing method could be applicable for new SLA homozygote line establishment by assignment and scheduled breeding.

  3. Exploiting Natural Variation in Arabidopsis

    NARCIS (Netherlands)

    Molenaar, J.A.; Keurentjes, J.J.B.

    2014-01-01

    Natural variation for many traits is present within the species Arabidopsis thaliana . This chapter describes the use of natural variation to elucidate genes underlying the regulation of quantitative traits. It deals with the development and use of mapping populations, the detection and handling of

  4. Exploiting natural variation in Arabidopsis

    NARCIS (Netherlands)

    J.A. Molenaar; J.J.B. Keurentjes

    2014-01-01

    Natural variation for many traits is present within the species Arabidopsis thaliana. This chapter describes the use of natural variation to elucidate genes underlying the regulation of quantitative traits. It deals with the development and use of mapping populations, the detection and handling of g

  5. Investigation of biological activity of polar extracts isolated from Phlomis crinita Cav ssp. mauritanica Munby.

    Science.gov (United States)

    Limem-Ben Amor, Ilef; Skandrani, Ines; Boubaker, Jihed; Ben Sghaïer, Mohamed; Neffati, Aicha; Bhouri, Wissem; Bouhlel, Ines; Chouchane, Nabil; Kilani, Soumaya; Guedon, Emmanuel; Ghoul, Mohamed; Ghedira, Kamel; Chekir-Ghedira, Leila

    2009-01-01

    The lyophilized infusion, the methanol, the ethyl acetate, and the total oligomer flavonoid (TOF)-enriched extracts prepared from the dried leaves of Phlomis crinita Cav. ssp. mauritanica Munby were investigated for the contents of flavonoids, tannins, coumarines and steroids. Antibacterial activity was investigated toward five bacterial strains. An inhibitory effect was observed against Staphyllococcus aureus and Enterococcus feacalis, and the minimal inhibitory concentrations ranged from 2.5 to 5 mg/mL of extract. The tested extracts exhibit an important free radical scavenging activity toward the 1,1-diphenyl 2-picrylhydrazyl (DPPH) free radical; with IC(50) values of 30.5, 6, 32, and 31.5 microg/mL, respectively, in the presence of lyophilized infusion, the TOF, the methanol, and the ethyl acetate extracts. Genotoxic and antigenotoxic properties of the different extracts were studied by using the SOS chromotest with Escherichia coli PQ37. The lyophilized infusion and TOF extracts obtained from P. crinita ssp. mauritanica showed no genotoxicity, whereas methanol and ethyl acetate extracts are considered as marginally genotoxic. On the other hand, we showed that each extract inhibited the mutagenicity induced by aflatoxin B1 (AFB1) (10 microg/assay) and nifuroxazide (NF) (10 microg/assay). The ethyl acetate extract showed the strongest level of protection toward the genotoxicity induced by both directly and indirectly genotoxic NF and AFB1. These tests proved that the lyophilized infusion possesses an antiradical activity likewise, it showed no genotoxic effect; that is why we choose this extract to assess its antiulcerogenic activity by using an ethanol-induced ulcerogenesis model in the rat. This test demonstrates that 300 mg/kg of a P. crinita ssp. mauritanica lyophilized infusion was more effective than the reference compound, cimetidine. PMID:19514937

  6. Estudo da viabilidade de Bifidobacterium animalis ssp. lactis em suco de Yacon

    OpenAIRE

    Watanabe, Felipe Miguel Farion

    2013-01-01

    Resumo: A maioria dos produtos probióticos são elaborados à base de leite, com desvantagens aos consumidores intolerantes à lactose, tornando assim produtos probióticos não lácteos vantajosos. O yacon é uma planta que acumula em suas raízes compostos prebióticos conhecidos como frutooligossacarídeos. O objetivo deste trabalho foi produzir o suco de yacon e utilizá-lo como matriz não láctea para a bactéria probiótica Bifidobacterium animalis ssp. lactis. O yacon apresentou rápido escurecimento...

  7. PENGEMBANGAN SUBJECT SPECIFIC PEDAGOGY (SSP IPA TERPADU UNTUK MENINGKATKAN HASIL BELAJAR SISWA

    Directory of Open Access Journals (Sweden)

    Fitri Yuliawati

    2016-05-01

    Full Text Available Background of this research is the analysis of the results of interviews some junior secondary schools in Yogyakarta and the conclusion that teachers do not use an integrated science teaching and teachers still find difficulties in the application of learning science in an integrated manner. It can be influenced by several factors, such as the lack of reference used by teachers in presenting the material Integrated Science relevantly, most of science teachers are from educational background of chemistry, physics, and biology instead of science education, so that teachers find difficulties to create an integrated learning of science. In addition, teachers feel difficulty in determining the depth of the material, limits of integration in integrated science teaching, and did not know the concept of integrated science teaching. This research is a development research. Learning tools developed included : student books, lesson plans, student activity sheets and evaluation tools. The development of the learning which is done in this study use the models of 4D development which includes the step of Define (definition which at this stage conducted a needs analysis. Design : it is the stage of Subject Specific Pedagogy (SSP software design. Development, it is the stage of development after the draft was made followed by a learning device validation by experts. This stage is also conducted to seek input from all the responses, reactions and comments from teachers, students, and observers so that it can be used for further improvement of science teaching later. The Disseminate, it is the stage of field tests are widely but not done. Data collection instruments used in this study include : test items and questionnaire. The conclusion of this development research are as follows : the results of the validation SSP integrated science by learning tools expert, material experts and media experts indicate the category of Very Good (SB so that SSP integrated

  8. Antifungal activity of Lactobacillus paracasei ssp. tolerans isolated from a sourdough bread culture.

    Science.gov (United States)

    Hassan, Yousef I; Bullerman, Lloyd B

    2008-01-15

    Lactic acid bacteria were isolated from four different sourdough bread cultures previously investigated for antifungal activity. A total of 116 isolates were obtained and screened for antifungal activity against a battery of molds. The most inhibitory isolate obtained was identified by API 50 CHL and 16s ribosomal RNA genotyping and found to be Lactobacillus paracasei ssp. tolerans. This isolate completely inhibited the growth of Fusarium proliferatum M 5689, M 5991 and Fusarium graminearum R 4053 compared to controls in a dual agar plate assay.

  9. Accumulation of biologically active furanocoumarins in Ruta graveolens ssp. divaricata (Tenore) Gams in vitro culture.

    Science.gov (United States)

    Ekiert, H; Abou-Mandour, A A; Czygan, F Ch

    2005-01-01

    The study was designed to investigate dynamics of accumulation of five linear furanocoumarins and umbelliferone in stationary liquid cultures of Ruta graveolens ssp. divaricata (Tenore) Gams during 6-week growth cycles. The contents of individual metabolites in biomass increased 1.8-3.5 times while their total content rose 2.3 times. Maximum contents of xanthotoxin, bergapten and isopimpinellin (112.3, 76.2 and 84.0mg/100g d.w., respectively) and maximum total content of all metabolites (283.4 mg/100 g d.w.), obtained on 35th culture day, are interesting from practical point of view.

  10. Atrocalopteryx melli orohainani ssp. nov. on the Island of Hainan, China (Zygoptera: Calopterygidae)

    OpenAIRE

    Guan, Z.; Han, B-P; Dumont, Henri

    2012-01-01

    The new sp. is described from the mountain core of Hainan, southern China, where it usually occurs at altitudes not lower than 300 m asl. It lives on the same type of small, shaded rivers as the nominate ssp. on the continent, and is distinguished by its larger size, slightly less enfumed wings, and a 2.6% difference in the sequence of the barcoding portion of the mitochodrial DNA-cytochrome c oxidase subunit I gene (COI). Holotype male: Diaoluoshan mountain, 6-VIII-2011; deposited in the Ins...

  11. ENZYMATIC ACTIVITY AND ANTIBIOTIC RESISTANCE PROFILE OF LACTOBACILLUS PARACASEI SSP. PARACASEI-1 ISOLATED FROM REGIONAL YOGURTS OF BANGLADESH

    Directory of Open Access Journals (Sweden)

    Ummay Honi

    2013-12-01

    Full Text Available Lactobacillus paracasei ssp. paracasei-1 was identified from traditional yogurts of Khulna region, Bangladesh and its enzyme and antibiotic resistance profiles were determined. A commercially available API Zym kit was employed to determine the activities of 19 different enzymes. We found that L. paracasei ssp. paracasei-1 showed strong activities for several enzymes, viz. leucine arylamidase, valine arylamidase, napthol-AS-BI-phosphohydrolase, β-galactosidase, α –Glucosidase, N-Acetyl- β- glucosaminidase while activities for other enzymes were absent. Antibiotic resistance profile was assessed by minimum inhibitory concentration (MIC test for 61 major antibiotics and 4 antifungal agents obtained from commercial sources in MRS Agar media. The strain generally showed resistance to gram negative spectrum antibiotic while it showed susceptibility towards β-lactam antibiotic to gram positive spectrum antibiotic. The findings provide the therapeutic basis of using L. paracasei ssp. paracasei-1 in finished food products.

  12. Étude de l'effet antibactérien des huiles essentielles de Thymus ciliatus ssp coloratus

    OpenAIRE

    HADDOUCHE, Khalida

    2015-01-01

    Etude de l'effet antibactérien de l'huile essentielle de Thymus ciliatus ssp coloratus Résumé Les plantes médicinales constituent une source immense de métabolites secondaires, dont les huiles essentielles dotées de nombreuses activités biologiques ; souvent recherchées dans le domaine phytopharmaceutique et en agro-alimentaire. Le présent travail porte sur une étude qualitative du pouvoir antibactérien de l'huile essentielle de la plante médicinale: Thymus ciliatus ssp c...

  13. Evolutionary dynamics of leucine-rich repeat receptor-like kinases and related genes in plants:A phylogenomic approach

    Institute of Scientific and Technical Information of China (English)

    Tao Shi; Hongwen Huang; Michael J.Sanderson; Frans E.Tax

    2014-01-01

    Leucine-rich repeat (LRR) receptor-like kinases (RLKs), evolutionarily related LRR receptor-like proteins (RLPs) and receptor-like cytoplasmic kinases (RLCKs) have important roles in plant signaling, and their gene subfamilies are large with a complicated history of gene duplication and loss. In three pairs of closely related lineages, including Arabidopsis thaliana and A. lyrata (Arabidopsis), Lotus japonicus, and Medicago truncatula (Legumes), Oryza sativa ssp. japonica, and O. sativa ssp. indica (Rice), we find that LRR RLKs comprise the largest group of these LRR-related subfamilies, while the related RLCKs represent the smal est group. In addition, comparison of orthologs indicates a high frequency of reciprocal gene loss of the LRR RLK/LRR RLP/RLCK subfamilies. Furthermore, pairwise comparisons show that reciprocal gene loss is often associated with lineage-specific duplication(s) in the alternative lineage. Last, analysis of genes in A. thaliana involved in development revealed that most are highly conserved orthologs without species-specific duplication in the two Arabidopsis species and originated from older Arabidopsis-specific or rosid-specific duplications. We discuss potential pitfal s related to functional prediction for genes that have undergone frequent turnover (duplications, losses, and domain architecture changes), and conclude that prediction based on phylogenetic relationships wil likely outperform that based on sequence similarity alone.

  14. Lactoferrin affects the adherence and invasion of Streptococcus dysgalactiae ssp. dysgalactiae in mammary epithelial cells.

    Science.gov (United States)

    O'Halloran, Fiona; Beecher, Christine; Chaurin, Valerie; Sweeney, Torres; Giblin, Linda

    2016-06-01

    Streptococcus dysgalactiae ssp. dysgalactiae is an important causative agent of bovine mastitis worldwide. Lactoferrin is an innate immune protein that is associated with many functions including immunomodulatory, antiproliferative, and antimicrobial properties. This study aimed to investigate the interactions between lactoferrin and a clinical bovine mastitis isolate, Strep. dysgalactiae ssp. dysgalactiae DPC5345. Initially a deliberate in vivo bovine intramammary challenge was performed with Strep. dysgalactiae DPC5345. Results demonstrated a significant difference in lactoferrin mRNA levels in milk cells between the control and infused quarters 7h postinfusion. Milk lactoferrin levels in the Strep. dysgalactiae DPC5345 infused quarters were significantly increased compared with control quarters at 48h postinfusion. In vitro studies demonstrated that lactoferrin had a bacteriostatic effect on the growth of Strep. dysgalactiae DPC5345 and significantly decreased the ability of the bacteria to internalize into HC-11 mammary epithelial cells. Confocal microscopy images of HC-11 cells exposed to Strep. dysgalactiae and lactoferrin further supported this effect by demonstrating reduced invasion of bacteria to HC-11 cells. The combined data suggest that a bovine immune response to Strep. dysgalactiae infection includes a significant increase in lactoferrin expression in vivo, and based on in vitro data, lactoferrin limits mammary cell invasion of this pathogen by binding to the bacteria and preventing its adherence. PMID:27016824

  15. The Huygens surface science package (SSP): Flight performance review and lessons learned

    Science.gov (United States)

    Leese, M. R.; Lorenz, R. D.; Hathi, B.; Zarnecki, J. C.

    2012-09-01

    The Surface Science Package (SSP) was one of six instruments flown onboard the Huygens probe to Titan, the largest moon of Saturn, in the framework of the NASA/ESA/ASI Cassini-Huygens mission (Matson et al., 2002). The SSP operated throughout the probe's descent and after landing on Titan on 14th January 2005. This paper reviews scientific results from the Surface Science Package, and also reports previously unpublished flight data which illustrate the performance of the measurement systems in the Titan environment. This review provides some lessons learned that may be useful for further detailed analysis of the Huygens mission data, and for payloads for future missions to Titan, in which there has been recent interest (e.g., the Titan Saturn System Mission (TSSM) (Joint TSSM Science Definition Team, 2009), TANDEM (Coustenis et al., 2009) or the Titan Mare Explorer (TiME) Discovery-class proposal (Stofan et al., 2010)), as well as for planetary probe missions more generally.

  16. The Salmonella type III effector SspH2 specifically exploits the NLR co-chaperone activity of SGT1 to subvert immunity.

    Directory of Open Access Journals (Sweden)

    Amit P Bhavsar

    Full Text Available To further its pathogenesis, S. Typhimurium delivers effector proteins into host cells, including the novel E3 ubiquitin ligase (NEL effector SspH2. Using model systems in a cross-kingdom approach we gained further insight into the molecular function of this effector. Here, we show that SspH2 modulates innate immunity in both mammalian and plant cells. In mammalian cell culture, SspH2 significantly enhanced Nod1-mediated IL-8 secretion when transiently expressed or bacterially delivered. In addition, SspH2 also enhanced an Rx-dependent hypersensitive response in planta. In both of these nucleotide-binding leucine rich repeat receptor (NLR model systems, SspH2-mediated phenotypes required its catalytic E3 ubiquitin ligase activity and interaction with the conserved host protein SGT1. SGT1 has an essential cell cycle function and an additional function as an NLR co-chaperone in animal and plant cells. Interaction between SspH2 and SGT1 was restricted to SGT1 proteins that have NLR co-chaperone function and accordingly, SspH2 did not affect SGT1 cell cycle functions. Mechanistic studies revealed that SspH2 interacted with, and ubiquitinated Nod1 and could induce Nod1 activity in an agonist-independent manner if catalytically active. Interestingly, SspH2 in vitro ubiquitination activity and protein stability were enhanced by SGT1. Overall, this work adds to our understanding of the sophisticated mechanisms used by bacterial effectors to co-opt host pathways by demonstrating that SspH2 can subvert immune responses by selectively exploiting the functions of a conserved host co-chaperone.

  17. Asparagine Metabolic Pathways in Arabidopsis.

    Science.gov (United States)

    Gaufichon, Laure; Rothstein, Steven J; Suzuki, Akira

    2016-04-01

    Inorganic nitrogen in the form of ammonium is assimilated into asparagine via multiple steps involving glutamine synthetase (GS), glutamate synthase (GOGAT), aspartate aminotransferase (AspAT) and asparagine synthetase (AS) in Arabidopsis. The asparagine amide group is liberated by the reaction catalyzed by asparaginase (ASPG) and also the amino group of asparagine is released by asparagine aminotransferase (AsnAT) for use in the biosynthesis of amino acids. Asparagine plays a primary role in nitrogen recycling, storage and transport in developing and germinating seeds, as well as in vegetative and senescence organs. A small multigene family encodes isoenzymes of each step of asparagine metabolism in Arabidopsis, except for asparagine aminotransferase encoded by a single gene. The aim of this study is to highlight the structure of the genes and encoded enzyme proteins involved in asparagine metabolic pathways; the regulation and role of different isogenes; and kinetic and physiological properties of encoded enzymes in different tissues and developmental stages. PMID:26628609

  18. Induction and purification of chitinase in Brassica napus L. ssp. oleifera infected with Phoma lingam

    DEFF Research Database (Denmark)

    Rasmussen, U.; Giese, H.; Dalgaard Mikkelsen, J.

    1992-01-01

    after tryptic digestion of the protein shows high sequence similarity to basic chitinases from bean, tobacco, potato, Arabidopsis, barley and rice, as well as to acidic chitinases from tobacco and petunia. A close serological relationship was found between the chitinase isoenzyme and an isoenzyme from...

  19. Arabidopsis thaliana—Aphid Interaction

    OpenAIRE

    Louis, Joe; Singh, Vijay,; Shah, Jyoti

    2012-01-01

    Aphids are important pests of plants that use their stylets to tap into the sieve elements to consume phloem sap. Besides the removal of photosynthates, aphid infestation also alters source-sink patterns. Most aphids also vector viral diseases. In this chapter, we will summarize on recent significant findings in plant-aphid interaction, and how studies involving Arabidopsis thaliana and Myzus persicae (Sülzer), more commonly known as the green peach aphid (GPA), are beginning to provide impor...

  20. Stem cell organization in Arabidopsis

    OpenAIRE

    Wendrich, J.R.

    2016-01-01

    Growth of plant tissues and organs depends on continuous production of new cells, by niches of stem cells. Stem cells typically divide to give rise to one differentiating daughter and one non-differentiating daughter. This constant process of self-renewal ensures that the niches of stem cells or meristems stay active throughout plant-life. Specification of stem cells occurs very early during development of the emrbyo and they are maintained during later stages. The Arabidopsis embryo is a hig...

  1. Molecular Characterization of Two Silenced y-type Genes for Glu-B1 in Triticum aestivum ssp. yunnanese and ssp. tibetanum

    Institute of Scientific and Technical Information of China (English)

    Zhong-Wei Yuan; Qi-Jiao Chen; Lian-Quan Zhang; Ze-Hong Yan; You-Liang Zheng; Deng-Cai Liu

    2009-01-01

    The high molecular weight glutenln subunits (HMW-GSs) are a major class of common wheat storage proteins. The bread-making quality of common wheat flour is influenced by the composition of HMW-GSs. In the present study, two unexpressed 1By genes from Triticum aesitvum L.ssp.yunnanese AS332 and T. aesitvum sep.tibetanum AS908 were respectively cloned and characterized. The results indicated that both of the silenced 1By genes in AS332 and AS908 were 1By9. in contrast to previously reported mechanisms for silenced genes 1Ax and 1Ay, which was due to the insertion of transposon elements or the presence of premature stop codon via base substitution of C→T transition in tdnucleotides CAA or CAG, the silence of 1By9 genes was caused by premature stop codons via the deletion of base A in tdnucleotide CAA, which lead to frameshift mutation and indirectly produced several premature stop codons (TAG) downstream of the coding sequence.

  2. Analysis of expressed sequence tags from Musa acuminata ssp. burmannicoides, var. Calcutta 4 (AA) leaves submitted to temperature stresses

    NARCIS (Netherlands)

    Santos, C.R.; Martins, N.F.; Horberg, H.M.; Almeida, E.R.P.; Coelho, M.C.F.; Togawa, R.; Silva, F.R.; Caetano, A.R.; Miller, R.N.G.; Souza, M.T.

    2005-01-01

    In order to discover genes expressed in leaves of Musa acuminata ssp. burmannicoides var. Calcutta 4 (AA), from plants submitted to temperature stress, we produced and characterized two full-length enriched cDNA libraries. Total RNA from plants subjected to temperatures ranging from 5°C to 25°C and

  3. Growth Responses of Plantago major L. ssp. pleiosperma (Pilger) to Changes in Mineral Supply : Evidence for Regulation by Cytokinins.

    Science.gov (United States)

    Kuiper, D

    1988-07-01

    Plants of an inbred line of Plantago major ssp. pleiosperma were subjected to an alteration in mineral supply. Observed responses of growth rate and shoot to root ratio are thought to be induced by changes in endogenous cytokinin concentration and not by mineral concentration in plant tissue.

  4. Poplar root exudates contain compounds that induce the expression of MiSSP7 in Laccaria bicolor.

    Science.gov (United States)

    Plett, Jonathan M; Martin, Francis

    2012-01-01

    Communication between organisms is crucial for their survival, especially for sessile organisms such as plants that depend upon interactions with mutualistic organisms to maximize their nutrient acquisition. This communication can take the form of the exchange of volatile compounds, metabolites or effectors - small protein signals secreted from the colonizing cell that change the biology of the host cell.  We recently characterized the first mutualistic effector protein from an ectomycorrhizal fungus, a small secreted protein named MiSSP7 encoded by Laccaria bicolor.  Ectomycorrhizal fungi are soil-borne mutualistic organisms whose hyphae wrap around host roots and grow into the root apoplastic space where the fungus exchanges nutrients such as nitrogen and phosphorus in return for plant derived sugars.  The MiSSP7 protein is induced by root exudates and is highly expressed throughout the root colonization process.  Its presence was responsible for alterations to the plant transcriptomic profile, a mechanism by which MiSSP7 may aid in the formation of the symbiotic interface. Here we further discuss the implications of these findings and, further, we demonstrate that the production of MiSSP7 is induced by two flavonoids, rutin and quercitrin, a class of compounds normally found within the exudates of plant roots.  We also consider the interesting similarities between the mechanisms of effector induction and action between pathogenic and mutualistic fungi.  

  5. Chemical composition and antifungal activities of essential oils of Satureja thymbra L. and Salvia pomifera ssp. calycina (Sm.) Hayek

    NARCIS (Netherlands)

    Glamoclija, J.; Sokovic, M.; Vukojevic, J.; Milenkovic, I.; Griensven, van L.J.L.D.

    2006-01-01

    This work covers the chemical composition and antifungal activities of essential oils isolated from savory (Satureja thymbra) and sage (Salvia pomifera ssp. calycina) analyzed using GC/MS. The main components of S. thymbra oil were gamma-terpinene (23.2%) and carvacrol (48.5%). The main components i

  6. Introgression of genetic material from Zea mays ssp. Mexicana into cultivated maize was facilitated by tissue culture

    International Nuclear Information System (INIS)

    Zea mays ssp. mexicana, a wild relative of cultivated maize (Z. mays ssp. mays), is a useful gene resource for maize breeding. In this study, two populations were generated by conventional breeding scheme (population I) or tissue culture regime (population II), respectively, to introgress genetic material of Z. mays ssp. mexicana into maize. Karyotype analysis showed that the arm ratios of 10 pairs of chromosomes in parent maize Ye515 and derivative lines from 2 different populations with 26% and 38% chromosome variation frequencies, respectively. Alien chromatin was detected in the root tip cells of progeny plants through genomic in situ hybridization (GISH). There were 3.3 chromosomes carrying alien chromatin on average in population I and 6.5 in population II. The hybridization signals were located mainly at the terminal or sub terminal regions of the chromosomes and the sizes were notably variant among lines. Based on those results, it is concluded that the introgression of genetic material from Z. mays ssp. mexicana into cultivated maize was facilitated by tissue culture, and subsequently some excellent materials for maize breeding were created. (author)

  7. Fate of Clavibacter michiganensis ssp. sepedonicus, the causal organism of bacterial ring rot in potato, in weeds and field crops.

    NARCIS (Netherlands)

    Wolf, van der J.M.; Beckhoven, van J.R.C.M.; Hukkanen, A.; Karjalainen, R.; Muller, P.

    2005-01-01

    Crops and weeds were tested for their ability to host Clavibacter michiganensis ssp. sepedonicus (Cms), the causal agent of bacterial ring rot in potato. Ten crops grown in rotation with potato in Europe, namely maize, wheat, barley, oat, bush bean, broad bean, rape, pea and onion and five cultivars

  8. Molecular genetic tagging of Beta vulgaris ssp. maritima-derived resistance to the sugar beet cyst nematode, Heterodera schachtii

    Science.gov (United States)

    Resistance in commercial sugar beet hybrids to the sugar beet cyst nematode (SBCN) principally has been based on the Hs1 gene from the wild beet Beta procumbens, yet incorporation of this resistance has been detrimental to crop yield in nematode-free fields. Accessions of B. vulgaris ssp maritima w...

  9. Full Scale Test SSP 34m blade, edgewise loading LTT. Extreme load and PoC_InvE Data report

    DEFF Research Database (Denmark)

    Nielsen, Magda; Roczek-Sieradzan, Agnieszka; Jensen, Find Mølholt;

    This report is the second report covering the research and demonstration project “Eksperimentel vingeforskning: Strukturelle mekanismer i nutidens og fremtidens store vinger under kombineret last”, supported by the EUDP program. A 34m wind turbine blade from SSP-Technology A/S has been tested...

  10. The response of Plantago major ssp pleiosperma to elevated CO2 is modulated by the formation of secondary shoots

    NARCIS (Netherlands)

    Fonseca, F; DenHertog, J; Stulen, [No Value

    1996-01-01

    The effect of elevated CO2 on the relative growth rate (RGR) of Plantago major ssp. pleiosperma was studied during the vegetative stage, in relation to plant development, by growing plants at 350 mu l l(-1) or at 700 mu l l(-1) CO2 in non-limiting nutrient solution with nitrate. To minimize interfer

  11. A black, non-troglomorphic amphibian from the karst of Slovenia: Proteus anguinus parkelj n. ssp. (Urodela: Proteidae)

    NARCIS (Netherlands)

    Sket, B.; Arntzen, J.W.

    1994-01-01

    A morphologically distinct cavernicolous salamander Proteus anguinus from southeastern Slovenia (Bela Krajina) is described as P. a. parkelj ssp. n. It differs from P. a. anguinus in a dark pigmentation, fully developed eyes, a skull with broader and shorter bones and fewer teeth, a voluminous jaw m

  12. CITOGENETICS EFFECTS INDUCED BY THE ASCORBIC ACID TREATMENT OF LARIX DECIDUA MILL. SSP. CARPATICA AND PICEA ABIES (L. KARST

    Directory of Open Access Journals (Sweden)

    Ioana Ieremia

    2006-08-01

    Full Text Available The paper present the influence of ascorbic acid upon the mitotic division of Larix decidua Mill ssp. carpatica and Picea abies (L. Karst. The treatment is applied of two variants, germinated seed in ascorbic acid (variantAand germinated seeds in disttilate water, than treated with ascorbic acid in 3 concentrations (variant B.

  13. Effect of a switch from elevated to ambient CO2 on growth and carbohydrate allocation of Plantago major ssp pleiosperma

    NARCIS (Netherlands)

    Fonseca, F; Stulen, [No Value

    2000-01-01

    Transfer of plants of Plantago major ssp. pleiosperma (L.) Pilger to elevated CO2 (700 mul l(-1)) showed a transient stimulation of the relative growth rate (RGR). Thereafter the RGR of the plants grown at elevated CO2 was the same as for plants grown at ambient CO2 (350 mul l(-1)). At that time sta

  14. Arabidopsis CDS blastp result: AK240730 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240730 J043030K09 At2g32440.1 68415.m03963 ent-kaurenoic acid hydroxylase, putati...ve / cytochrome P450, putative identical to ent-kaurenoic acid hydroxylase / cytochrome P450 CYP88A (GI:1302...1856) [Arabidopsis thaliana]; similar to ent-kaurenoic acid hydroxylase [Arabidopsis thaliana] GI:13021853 2e-11 ...

  15. Arabidopsis CDS blastp result: AK288052 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288052 J075151I09 At2g32440.1 68415.m03963 ent-kaurenoic acid hydroxylase, putati...ve / cytochrome P450, putative identical to ent-kaurenoic acid hydroxylase / cytochrome P450 CYP88A (GI:1302...1856) [Arabidopsis thaliana]; similar to ent-kaurenoic acid hydroxylase [Arabidopsis thaliana] GI:13021853 6e-14 ...

  16. Arabidopsis CDS blastp result: AK240911 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240911 J065037E05 At2g32440.1 68415.m03963 ent-kaurenoic acid hydroxylase, putati...ve / cytochrome P450, putative identical to ent-kaurenoic acid hydroxylase / cytochrome P450 CYP88A (GI:1302...1856) [Arabidopsis thaliana]; similar to ent-kaurenoic acid hydroxylase [Arabidopsis thaliana] GI:13021853 4e-22 ...

  17. Arabidopsis CDS blastp result: AK241119 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241119 J065094C22 At2g32440.1 68415.m03963 ent-kaurenoic acid hydroxylase, putati...ve / cytochrome P450, putative identical to ent-kaurenoic acid hydroxylase / cytochrome P450 CYP88A (GI:1302...1856) [Arabidopsis thaliana]; similar to ent-kaurenoic acid hydroxylase [Arabidopsis thaliana] GI:13021853 2e-13 ...

  18. Arabidopsis CDS blastp result: AK243149 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243149 J100032I21 At2g32440.1 68415.m03963 ent-kaurenoic acid hydroxylase, putati...ve / cytochrome P450, putative identical to ent-kaurenoic acid hydroxylase / cytochrome P450 CYP88A (GI:1302...1856) [Arabidopsis thaliana]; similar to ent-kaurenoic acid hydroxylase [Arabidopsis thaliana] GI:13021853 7e-12 ...

  19. Arabidopsis CDS blastp result: AK241581 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241581 J065181K09 At2g32440.1 68415.m03963 ent-kaurenoic acid hydroxylase, putati...ve / cytochrome P450, putative identical to ent-kaurenoic acid hydroxylase / cytochrome P450 CYP88A (GI:1302...1856) [Arabidopsis thaliana]; similar to ent-kaurenoic acid hydroxylase [Arabidopsis thaliana] GI:13021853 4e-15 ...

  20. Arabidopsis CDS blastp result: AK287479 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287479 J043023O14 At2g32440.1 68415.m03963 ent-kaurenoic acid hydroxylase, putati...ve / cytochrome P450, putative identical to ent-kaurenoic acid hydroxylase / cytochrome P450 CYP88A (GI:1302...1856) [Arabidopsis thaliana]; similar to ent-kaurenoic acid hydroxylase [Arabidopsis thaliana] GI:13021853 1e-17 ...

  1. Using "Arabidopsis" Genetic Sequences to Teach Bioinformatics

    Science.gov (United States)

    Zhang, Xiaorong

    2009-01-01

    This article describes a new approach to teaching bioinformatics using "Arabidopsis" genetic sequences. Several open-ended and inquiry-based laboratory exercises have been designed to help students grasp key concepts and gain practical skills in bioinformatics, using "Arabidopsis" leucine-rich repeat receptor-like kinase (LRR RLK) genetic…

  2. An International Bioinformatics Infrastructure to Underpin the Arabidopsis Community

    Science.gov (United States)

    The future bioinformatics needs of the Arabidopsis community as well as those of other scientific communities that depend on Arabidopsis resources were discussed at a pair of recent meetings held by the Multinational Arabidopsis Steering Committee (MASC) and the North American Arabidopsis Steering C...

  3. Aspectos ecológicos y distribución de Tropaeolum tuberosum ssp. silvestre (Tropaeolaceae en Argentina

    Directory of Open Access Journals (Sweden)

    Eva Bulacio

    2012-06-01

    Full Text Available Tropaeolum tuberosum Ruiz et Pav. ssp. silvestre Sparre es una hierba rizomatosa trepadora que en Argentina fue encontrada en las Sierras de Calilegua (Jujuy y en áreas montanas de Catamarca, aunque de esta última localidad sólo se conoce un único e incompleto ejemplar. Habita quebradas húmedas, entre los 2.100 y 2.650 m s.n.m., en el límite superior del bosque montano. El tallo es grácil de hasta 3 m de largo y la porción subterránea está constituida por rizomas alargados y de hasta 1 cm de diámetro. Estas son las principales diferencias con la ssp. tuberosum, en la cual el tallo es más corto, erguido y desarrolla tubérculos bien definidos.Ecological features and distribution of Tropaeolum tuberosum ssp. silvestre (Tropaeolaceae in Argentina. Tropaeolum tuberosum Ruiz et Pav. ssp. silvestre Sparre is a rhizomatous climbing herb that in Argentina was found in the Sierras of Calilegua (Jujuy and Catamarca mountains, yet of this last locality only is known an one and incomplete specimen. It inhabits humid gorges, between 2100-2650 masl, in the upper limit of the montane forest. The slender stem reaches 3 meters in lenght and the underground portion shows elongated rhizomes up to 1 cm in diameter. These are the main differences with the ssp. tuberosum, in which the stem is shorter, erect and develop well-defned tubers.

  4. Identification of a small molecule that modifies MglA/SspA interaction and impairs intramacrophage survival of Francisella tularensis.

    Directory of Open Access Journals (Sweden)

    Algevis P Wrench

    Full Text Available The transcription factors MglA and SspA of Francisella tularensis form a heterodimer complex and interact with the RNA polymerase to regulate the expression of the Francisella pathogenicity island (FPI genes. These genes are essential for this pathogen's virulence and survival within host cells. In this study, we used a small molecule screening to identify quinacrine as a thermal stabilizing compound for F. tularensis SCHU S4 MglA and SspA. A bacterial two-hybrid system was used to analyze the in vivo effect of quinacrine on the heterodimer complex. The results show that quinacrine affects the interaction between MglA and SspA, indicated by decreased β-galactosidase activity. Further in vitro analyses, using size exclusion chromatography, indicated that quinacrine does not disrupt the heterodimer formation, however, changes in the alpha helix content were confirmed by circular dichroism. Structure-guided site-directed mutagenesis experiments indicated that quinacrine makes contact with amino acid residues Y63 in MglA, and K97 in SspA, both located in the "cleft" of the interacting surfaces. In F. tularensis subsp. novicida, quinacrine decreased the transcription of the FPI genes, iglA, iglD, pdpD and pdpA. As a consequence, the intramacrophage survival capabilities of the bacteria were affected. These results support use of the MglA/SspA interacting surface, and quinacrine's chemical scaffold, for the design of high affinity molecules that will function as therapeutics for the treatment of Tularemia.

  5. Full scale test SSP 34m blade, combined load. Data report

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Per H.; Nielsen, Magda; Jensen, Find M. (and others)

    2010-11-15

    This report is part of the research project where a 34m wind turbine blade from SSP-Technology A/S was tested in combined flap and edgewise load. The applied load is 55% of an imaginary extreme event based on the certification load of the blade. This report describes the reason for choosing the loads and the load direction and the method of applying the loads to the blade. A novel load introduction allows the blade to deform in a more realistic manner, allowing the observation of e.g. transverse shear distortion. The global and local deformation of the blade as well as the blades' respond to repeated tests has been studied and the result from these investigations are presented, including the measurements performed. (Author)

  6. Combining ability for maturity and plant height in brassica rapa (l.) ssp. dichotoma (roxb.) hanelt

    International Nuclear Information System (INIS)

    A 5 * 5 F1 diallel cross hybrids of Brassica rapa (L.) ssp. dichotoma (Roxb.) Hanelt along with parents were evaluated through combining ability for days to flowering (initiation and completion), days to maturity and plant height. Highly significant differences were recorded for all the traits. Mean squares due to general, specific and reciprocal combining ability were significant for all the traits except plant height for which the latter two components were non-significant. Prevalence of additive (plant height), non-additive (days to flowering completion; days to maturity) and reciprocal effects (days to flowering initiation) were detected. Parental line G-403 was best general combiner for all the traits. The F1 hybrids G-902 * G-265 (days to flowering initiation), G-902 * G-403 (days to flowering completion), G-265 * G-1500 (days to maturity) and G-909 * G-265 (plant height) were superior and may be exploited for future breeding programs. (author)

  7. Herbaspirillum sp. strain GW103 alleviates salt stress in Brassica rapa L. ssp. pekinensis.

    Science.gov (United States)

    Lee, Gun Woong; Lee, Kui-Jae; Chae, Jong-Chan

    2016-05-01

    Mutual interactions between plant and rhizosphere bacteria facilitate plant growth and reduce risks of biotic and abiotic stresses. The present study demonstrates alleviation of salt stress in Brassica rapa L. ssp. perkinensis (Chinese cabbage) by Herbaspirillum sp. strain GW103 isolated from rhizosphere soil of Phragmites australis. The strain was capable of producing plant beneficial factors, such as auxin, siderophore, and 1-aminocylopropane-1-carboxylic acid deaminase. Treatment of strain GW103 on Chinese cabbage under salt stress increased K(+)/Na(+) ratio in roots generating balance in the ratio of ion homeostasis and consequently contributed to the increase of biomass. In addition, root colonization potential of the strain was observed by green fluorescent protein (GFP)-tagging approach. These results strongly suggest the beneficial impact of strain GW103 by inducing the alleviation of salt stress and development of stress tolerance in Chinese cabbage via plant-microbe interaction. PMID:26358119

  8. Acetylcholinesterase inhibitory activity of lycopodane-type alkaloids from the Icelandic Lycopodium annotinum ssp. alpestre

    DEFF Research Database (Denmark)

    Halldórsdóttir, Elsa Steinunn; Jaroszewski, Jerzy W; Olafsdottir, Elin Soffia

    2010-01-01

    The aim of this study was to investigate structures and acetylcholinesterase inhibitory activities of lycopodane-type alkaloids isolated from an Icelandic collection of Lycopodium annotinum ssp. alpestre. Ten alkaloids were isolated, including annotinine, annotine, lycodoline, lycoposerramine M......, anhydrolycodoline, gnidioidine, lycofoline, lannotinidine D, and acrifoline, as well as a previously unknown N-oxide of annotine. (1)H and (13)C NMR data of several of the alkaloids were provided for the first time. Solvent-dependent equilibrium constants between ketone and hemiketal form of acrifoline were...... determined. Conformation of acrifoline was characterized using NOESY spectroscopy and molecular modelling. The isolated alkaloids were evaluated for their in vitro inhibitory activity against acetylcholinesterase and butyrylcholinesterase. Ligand docking studies based on mutated 3D structure of Torpedo...

  9. The identification of MacSe in Streptococcus equi ssp. equi

    Institute of Scientific and Technical Information of China (English)

    Jiande YANG; Yanfei LIU; Jun XU; Jifei MA

    2009-01-01

    Streptococcus equi subsp, equi (S. equi ssp. equi) causes equine strangles, a highly contagious and widespread purulent lymphadenitis of the head and neck. We have identified MacSe, a novel protein of S. equi, by screening a phage library of 3-8 kb random DNA fragments of S. equi CF32. MacSe shares 62% and 67.5% amino acid homology with Mac5005 and Mac8345 of S. pyogenes respectively. Expression during infection was shown by strong reactivity of the protein with convalescent sera and mucosal wash IgA of ponies infected by commingling exposure. Release into the culture medium was detected during the log phase of growth. Dose dependent anti-phagocytic activity for equine neutrophils involved interaction of MacSe with C3 and neutrophils.

  10. Correction of the structure of a new sesquiterpene from Cistus creticus ssp. creticus.

    Science.gov (United States)

    Hatzellis, Konstantinos; Pagona, Georgia; Spyros, Apostolos; Demetzos, Costas; Katerinopoulos, Haralambos E

    2004-12-01

    In an attempt to identify the structure of a sesquiterpene from Cistus creticus ssp. creticus proposed in the literature as 1,1,4a,6-tetramethyl-5-methylene-1,2,3,4,4alpha,5,8,8alpha-octahydronaphthalene, the synthesis of its cis isomer 2 was carried out in 11 steps and 9.5% yield. Comparison of the spectra of 2 and those reported earlier for the synthetic trans isomer 1 with the spectral profile of the isolated natural product indicated that the latter was not compatible with either 1 or 2. The correct structure was assigned, by detailed spectroscopic analysis of the natural product, as 6-isopropenyl-4,4a-dimethyl-1,2,3,4,4a,5,6,7-octahydronaphthalene (3). PMID:15620240

  11. Lignan formation in hairy root cultures of Edelweiss (Leontopodium nivale ssp. alpinum (Cass.) Greuter)

    Science.gov (United States)

    Wawrosch, Christoph; Schwaiger, Stefan; Stuppner, Hermann; Kopp, Brigitte

    2014-01-01

    A hairy root line of Edelweiss (Leontopodium nivale ssp. alpinum (Cass.) Greuter) was obtained upon transformation with Agrobacterium rhizogenes strain ATCC15834. Elicitation of this line with silver nitrate, sucrose, methyl jasmonate and yeast extract at various concentrations in most cases resulted in a stimulation of lignan biosynthesis. Through elicitation with 6% sucrose the roots accumulated the pharmacologically active lignans leoligin and 5-methoxy-leoligin at levels of 0.0678% and 0.0372%, respectively, without significant growth inhibition. These lignan levels were comparable to those found in intact roots of cultivated Edelweiss. The biotechnological production of leoligin could be an attractive option for the continuous, field culture-independent production of the valuable secondary metabolites leoligin and 5-methoxy-leoligin. PMID:24932777

  12. Antioxidant capacities and polyphenolics of Chinese cabbage (Brassica rapa L. ssp. Pekinensis) leaves.

    Science.gov (United States)

    Seong, Gi-Un; Hwang, In-Wook; Chung, Shin-Kyo

    2016-05-15

    Chinese cabbage (Brassica rapa L. ssp. Pekinensis) is a green leafy vegetable used mainly in kimchi, salted and fermented dishes. Consumer preference for the leaf portion differs according to the type of dishes. In this study, Chinese cabbage was divided into three parts, and their antioxidant activities were investigated through in vitro assays. The total phenolic contents (TPC), total flavonoid contents (TFC), and vitamin C contents were also determined as indicators of antioxidant contents. The phenolic acids and flavonoids were separated and identified using high performance liquid chromatography (HPLC) and liquid chromatography/mass spectrometry (LC/MS). The outer leaf had the strongest antioxidant activity with the maximum antioxidant contents, followed by the mid- and inner leaves. Principal component analysis (PCA) revealed that outer leaf is positively related to caffeic acid, p-coumaric acid, ferulic acid, and myricetin contents, whereas the mid- and inner leaves are negatively related to sinapic acid contents. PMID:26776015

  13. meta-Tyrosine in Festuca rubra ssp. commutata (Chewings fescue) is synthesized by hydroxylation of phenylalanine.

    Science.gov (United States)

    Huang, Tengfang; Rehak, Ludmila; Jander, Georg

    2012-03-01

    m-Tyrosine is a non-protein amino acid that is structurally similar to the common protein amino acids p-tyrosine and phenylalanine. Copious amounts of m-tyrosine can be found in root exudates of the fine fescue cultivar, Festuca rubra L. ssp. commutata (Chewings fescue). The phytotoxicity of m-tyrosine may contribute to the allelopathic potential of F. rubra. m-Tyrosine in Euphorbia myrsinites (donkey-tail spurge), was previously shown to be synthesized via transamination of m-hydroxyphenylpyruvate. Here we show that m-tyrosine biosynthesis in F. rubra occurs through direct hydroxylation of phenylalanine in the root tips, perhaps through the activity of a cytochrome P450 enzyme. Hence, E. myrsinites and F. rubra, the only two plant species known to produce m-tyrosine, use distinct biosynthetic pathways that likely arose independently in evolutionary history.

  14. Tape-Arabidopsis Sandwich - a simpler Arabidopsis protoplast isolation method

    Directory of Open Access Journals (Sweden)

    Lee Shu-Hong

    2009-11-01

    Full Text Available Abstract Background Protoplasts isolated from leaves are useful materials in plant research. One application, the transient expression of recombinant genes using Arabidopsis mesophyll protoplasts (TEAMP, is currently commonly used for studies of subcellular protein localization, promoter activity, and in vivo protein-protein interactions. This method requires cutting leaves into very thin slivers to collect mesophyll cell protoplasts, a procedure that often causes cell damage, may yield only a few good protoplasts, and is time consuming. In addition, this protoplast isolation method normally requires a large number of leaves derived from plants grown specifically under low-light conditions, which may be a concern when material availability is limited such as with mutant plants, or in large scale experiments. Results In this report, we present a new procedure that we call the Tape-Arabidopsis Sandwich. This is a simple and fast mesophyll protoplast isolation method. Two kinds of tape (Time tape adhered to the upper epidermis and 3 M Magic tape to the lower epidermis are used to make a "Tape-Arabidopsis Sandwich". The Time tape supports the top side of the leaf during manipulation, while tearing off the 3 M Magic tape allows easy removal of the lower epidermal layer and exposes mesophyll cells to cell wall digesting enzymes when the leaf is later incubated in an enzyme solution. The protoplasts released into solution are collected and washed for further use. For TEAMP, plasmids carrying a gene expression cassette for a fluorescent protein can be successfully delivered into protoplasts isolated from mature leaves grown under optimal conditions. Alternatively, these protoplasts may be used for bimolecular fluorescence complementation (BiFC to investigate protein-protein interactions in vivo, or for Western blot analysis. A significant advantage of this protocol over the current method is that it allows the generation of protoplasts in less than 1 hr

  15. VizieR Online Data Catalog: SSP in NIR. II. Synthesis models (Meneses-Goytia+, 2015)

    Science.gov (United States)

    Meneses-Goytia, S.; Peletier, R. F.; Trager, S. C.; Vazdekis, A.

    2015-08-01

    The present Single Stellar Populations (SSP) models are derived from my Ph.D.'s thesis and this paper. The following nomenclature is used throughout the paper and the website (http://smg.astro-research.net/ssp-models/the-models/) to describe the models, e.g. MarS models use the M08 isochrones (Mar) and the Salpeter (S) IMF. General information about the models is given in table1. For further information, please refer to the paper. Each set of models and their corresponding predictions are available in the website and VIZIER. The spectral energy distributions (SEDs) can be downloaded in a zip-file from those pages in ascii format . The spectral energy distributions (SEDs) can be downloaded in a zip-file from t hose pages in ascii format . The nomenclature of each SED is as follows: isochroneIMFsedXXXXHZX.XXXXXXXXXTgXX.XXXXXXXe+XX - where XXXX tells whether those models contain C-stars or no (COMBO or NOCS respectively) H is the spectral band in which normalization occurred Z_X.XXXXXXXXX is the metallicity in terms of Z Tg_XX.XXXXXXXe+XX is the age in years. Each set of models contains MarS - 96 SEDs GirS - 96 SEDs BaSS - 116 SEDs We have also included in the websites the Integrated colours and line-strength indices from all our models (MarS, GirS and BaSS). The SEDs were convolved to a velocity dispersion of 350km/s before calculating indices. (5 data files).

  16. Jasmonate Signal Pathway in Arabidopsis

    Institute of Scientific and Technical Information of China (English)

    Xiao-Yi Shan; Zhi-Long Wang; Daoxin Xie

    2007-01-01

    Jasmonates (JAs), which include jasmonic acid and its cyclopentane derivatives are synthesized from the octadecanoid pathway and widely distributed throughout the plant kingdom. JAs modulate the expression of numerous genes and mediate responses to stress, wounding, insect attack, pathogen infection, and UV damage. They also affect a variety of processes in many plant developmental processes. The JA signal pathway involves two important events: the biosynthesis of JA and the transduction of JA signal. Several important Arabidopsis mutants in jasmonate signal pathway were described in this review.

  17. Polyploidy in the Arabidopsis genus.

    Science.gov (United States)

    Bomblies, Kirsten; Madlung, Andreas

    2014-06-01

    Whole genome duplication (WGD), which gives rise to polyploids, is a unique type of mutation that duplicates all the genetic material in a genome. WGD provides an evolutionary opportunity by generating abundant genetic "raw material," and has been implicated in diversification, speciation, adaptive radiation, and invasiveness, and has also played an important role in crop breeding. However, WGD at least initially challenges basic biological functions by increasing cell size, altering relationships between cell volume and DNA content, and doubling the number of homologous chromosome copies that must be sorted during cell division. Newly polyploid lineages often have extensive changes in gene regulation, genome structure, and may suffer meiotic or mitotic chromosome mis-segregation. The abundance of species that persist in nature as polyploids shows that these problems are surmountable and/or that advantages of WGD might outweigh drawbacks. The molecularly especially tractable Arabidopsis genus has several ancient polyploidy events in its history and contains several independent more recent polyploids. This genus can thus provide important insights into molecular aspects of polyploid formation, establishment, and genome evolution. The ability to integrate ecological and evolutionary questions with molecular and genetic understanding makes comparative analyses in this genus particularly attractive and holds promise for advancing our general understanding of polyploid biology. Here, we highlight some of the findings from Arabidopsis that have given us insights into the origin and evolution of polyploids. PMID:24788061

  18. Bacillus amyloliquefaciens ssp. plantarum strains as potential protective starter cultures for the production of Bikalga, an alkaline fermented food

    DEFF Research Database (Denmark)

    Compaor, C.S.; Nielsen, D.S.; Sawadogo-Lingani, H.;

    2013-01-01

    and fungi. Antimicrobial activity against Bacillus cereus was produced in H. sabdariffa seed-based medium. PCR results revealed that the isolates have potential for the lipopeptides iturin, fengycin, surfactin, the polyketides difficidin, macrolactin, bacillaene and the dipeptide bacilysin production. Ultra......-highperformance liquid chromatography-time of flight mass spectrometry analysis of antimicrobial substance produced in BHI broth allowed identification of iturin, fengycin and surfactin. Conclusions: The Bacillus amyloliquefaciens ssp. plantarum exhibited broadspectrum antifungal and antibacterial properties....... They produced several lipopeptide antibiotics and showed good potential for biological control of Bikalga. Significance and Impact of the Study: Pathogenic bacteria often occur in spontaneous food fermentations. This is the first report to identify indigenous B. amyloliquefaciens ssp. plantarum strains...

  19. Generation and characterization of Brassica rapa ssp. pekinensis – B. oleracea var. capitata monosomic and disomic alien addition lines

    Indian Academy of Sciences (India)

    Ai xia Gu; Shu Xing Shen; Yan Hua Wang; Jian Jun Zhao; Shu Xin Xuan; Xue Ping Chen; Xiao Feng Li; Shuang Xia Luo; Yu Jing Zhao

    2015-09-01

    Five monosomic alien addition lines (MAALs) of Brassica rapa ssp. pekinensis – B. oleracea var. capitata were obtained by hybridization and backcrossing between B. rapa ssp. pekinensis (female parent) and B. oleracea var. capitata. The alien linkage groups were identified using 42 B. oleracea var. capitata linkage group-specific markers as B. oleracea linkage groups C2, C3, C6, C7 and C8. Based on the chromosomal karyotype of root tip cells, these five MAALs added individual chromosomes from B. oleracea var. capitata: chr 1 (the longest), chr 2 or 3, chr 5 (small locus of 25S rDNA), chr 7 (satellite-carrying) and chr 9 (the shortest). Five disomic alien addition lines were then generated by selfing their corresponding MAALs.

  20. Schizosaccharomyces pombe cell division cycle under limited glucose requires Ssp1 kinase, the putative CaMKK, and Sds23, a PP2A-related phosphatase inhibitor.

    Science.gov (United States)

    Hanyu, Yuichiro; Imai, Kumiko K; Kawasaki, Yosuke; Nakamura, Takahiro; Nakaseko, Yukinobu; Nagao, Koji; Kokubu, Aya; Ebe, Masahiro; Fujisawa, Asuka; Hayashi, Takeshi; Obuse, Chikashi; Yanagida, Mitsuhiro

    2009-05-01

    Calcium/calmodulin-dependent protein kinase (CaMK) is required for diverse cellular functions, and similar kinases exist in fungi. Although mammalian CaMK kinase (CaMKK) activates CaMK and also evolutionarily-conserved AMP-activated protein kinase (AMPK), CaMKK is yet to be established in yeast. We here report that the fission yeast Schizosaccharomyces pombe Ssp1 kinase, which controls G2/M transition and response to stress, is the putative CaMKK. Ssp1 has a CaM binding domain (CBD) and associates with 14-3-3 proteins as mammalian CaMKK does. Temperature-sensitive ssp1 mutants isolated are defective in the tolerance to limited glucose, and this tolerance requires the conserved stretch present between the kinase domain and CBD. Sds23, multi-copy suppressor for mutants defective in type 1 phosphatase and APC/cyclosome, also suppresses the ssp1 phenotype, and is required for the tolerance to limited glucose. We demonstrate that Sds23 binds to type 2A protein phosphatases (PP2A) and PP2A-related phosphatase Ppe1, and that Sds23 inhibits Ppe1 phosphatase activity. Ssp1 and Ppe1 thus seem to antagonize in utilizing limited glucose. We also show that Ppk9 and Ssp2 are the catalytic subunits of AMPK and AMPK-related kinases, respectively, which bind to common beta-(Amk2) and gamma-(Cbs2) subunits.

  1. Ectopically expressed sweet pepper ferredoxin PFLP enhances disease resistance to Pectobacterium carotovorum subsp. carotovorum affected by harpin and protease-mediated hypersensitive response in Arabidopsis.

    Science.gov (United States)

    Ger, Mang-Jye; Louh, Guan-Yu; Lin, Yi-Hsien; Feng, Teng-Yung; Huang, Hsiang-En

    2014-12-01

    Plant ferredoxin-like protein (PFLP) is a photosynthesis-type ferredoxin (Fd) found in sweet pepper. It contains an iron-sulphur cluster that receives and delivers electrons between enzymes involved in many fundamental metabolic processes. It has been demonstrated that transgenic plants overexpressing PFLP show a high resistance to many bacterial pathogens, although the mechanism remains unclear. In this investigation, the PFLP gene was transferred into Arabidopsis and its defective derivatives, such as npr1 (nonexpresser of pathogenesis-related gene 1) and eds1 (enhanced disease susceptibility 1) mutants and NAHG-transgenic plants. These transgenic plants were then infected with the soft-rot bacterial pathogen Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora ssp. carotovora, ECC) to investigate the mechanism behind PFLP-mediated resistance. The results revealed that, instead of showing soft-rot symptoms, ECC activated hypersensitive response (HR)-associated events, such as the accumulation of hydrogen peroxide (H2 O2 ), electrical conductivity leakage and expression of the HR marker genes (ATHSR2 and ATHSR3) in PFLP-transgenic Arabidopsis. This PFLP-mediated resistance could be abolished by inhibitors, such as diphenylene iodonium (DPI), 1-l-trans-epoxysuccinyl-leucylamido-(4-guanidino)-butane (E64) and benzyloxycarbonyl-Val-Ala-Asp-fluoromethylketone (z-VAD-fmk), but not by myriocin and fumonisin. The PFLP-transgenic plants were resistant to ECC, but not to its harpin mutant strain ECCAC5082. In the npr1 mutant and NAHG-transgenic Arabidopsis, but not in the eds1 mutant, overexpression of the PFLP gene increased resistance to ECC. Based on these results, we suggest that transgenic Arabidopsis contains high levels of ectopic PFLP; this may lead to the recognition of the harpin and to the activation of the HR and other resistance mechanisms, and is dependent on the protease-mediated pathway.

  2. Overcoming interspecific incompatibility in the cross Brassica campestris ssp. japonica x Brassica oleracea var. botrytis using irradiated mentor pollen page

    International Nuclear Information System (INIS)

    The cross B. campestris ssp. japonica x B. oleracea var. botrytis fails due to incompatibility barrier at the stigma. To realize this cross, irradiated compatible pollen (mentor pollen) was used before the incompatible pollination. The presence of mentor pollen stimulated the incompatible pollen to germinate and effect fertilization and seed set. One hybrid was thus obtained. Most of the seeds were inviable. Of the 5 plants raised one was a hybrid and 4 resembled the female parent. 1 tab., 7 refs

  3. Application of a Simple In-House PCR-SSP Technique for HLA-B* 27 Typing in Spondyloarthritis Patients

    OpenAIRE

    Parasannanavar, Devraj J.; Anjali Rajadhyaksha; Kanjaksha Ghosh

    2013-01-01

    Background. Microlymphocytotoxicity (MLCT) and flowcytometry (FC) are the conventional serological methods to detect HLA-B* 27. Due to some disadvantages in these methods, most of the HLA laboratories have now switched over to molecular methods. Molecular techniques based on commercial kits are expensive; as such many laboratories with limited funds in developing countries cannot afford these techniques. Aims. Our main aim was to standardize a simple inexpensive in-house PCR-SSP technique for...

  4. Conservation of nuclear SSR loci reveals high affinity of Quercus infectoria ssp. veneris A. Kern (Fagaceae) to section Robur

    OpenAIRE

    Neophytou, Charalambos; Dounavi, Aikaterini; Aravanopoulos, Filippos A.

    2013-01-01

    Conservation of 16 nuclear microsatellite loci, originally developed for Quercus macrocarpa (section Albae), Q. petraea, Q. robur (section Robur) and Q. myrsinifolia, (subgenus Cyclobalanopsis) was tested in a Q. infectoria ssp. veneris population from Cyprus. All loci could be amplified successfully and displayed allele size and diversity patterns that match those of oak species belonging to the section Robur. At least in one case, limited amplification and high levels of homozygosity suppor...

  5. 8th International Conference on Solid State Physics (SSP 2004), Workshop “Mössbauer Spectroscopy of Locally Heterogeneous Systems”

    CERN Document Server

    Kadyrzhanov, K. K; SSP 2004

    2006-01-01

    This volume contains papers presented at the 8th International Conference on Solid State Physics (SSP 2004), Workshop "Mössbauer Spectroscopy of Locally Heterogeneous Systems", held in Almaty, Kazakhstan, 23–26 August 2004. It should be of interest to researchers and PhD students working or interested in recent results in the locally inhomogeneous system investigations by Mössbauer Spectroscopy and the new concepts of data evaluation of complex Mössbauer spectra.

  6. Differences between the rhizosphere microbiome of Beta vulgaris ssp. maritima - ancestor of all beet crops - and modern sugar beets

    OpenAIRE

    Christin eZachow; Henry eMueller; Ralf eTilcher; Gabriele eBerg

    2014-01-01

    The structure and function of the plant microbiome is driven by plant species and prevailing environmental conditions. Effectuated by breeding efforts, modern crops diverge genetically and phenotypically from their wild relatives but little is known about consequences for the associated microbiota. Therefore, we studied bacterial rhizosphere communities associated with the wild beet B. vulgaris ssp. maritima grown in their natural habitat soil from coastal drift lines (CS) and modern sugar be...

  7. Arabidopsis CDS blastp result: AK288065 [KOME

    Lifescience Database Archive (English)

    Full Text Available al to sulfate tansporter Sultr1;3 [Arabidopsis thaliana] GI:10716805; contains Pfam profile PF00916: Sulfate... transporter family; contains Pfam profile PF01740: STAS domain; contains TIGRfam profile TIGR00815: sulfate permease 1e-145 ...

  8. Arabidopsis CDS blastp result: AK061395 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061395 006-305-E02 At2g02180.1 tobamovirus multiplication protein 3 (TOM3) identical to tobamovirus multip...lication protein (TOM3) GI:15425641 from [Arabidopsis thaliana] 1e-125 ...

  9. Arabidopsis CDS blastp result: AK104882 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104882 001-044-H04 At2g02180.1 tobamovirus multiplication protein 3 (TOM3) identical to tobamovirus multip...lication protein (TOM3) GI:15425641 from [Arabidopsis thaliana] 1e-119 ...

  10. Arabidopsis CDS blastp result: AK066854 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066854 J013075C10 At2g02180.1 tobamovirus multiplication protein 3 (TOM3) identical to tobamovirus multipl...ication protein (TOM3) GI:15425641 from [Arabidopsis thaliana] 1e-119 ...

  11. Arabidopsis CDS blastp result: AK101318 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK101318 J033034D12 At2g02180.1 tobamovirus multiplication protein 3 (TOM3) identical to tobamovirus multipl...ication protein (TOM3) GI:15425641 from [Arabidopsis thaliana] 1e-125 ...

  12. Arabidopsis CDS blastp result: AK069960 [KOME

    Lifescience Database Archive (English)

    Full Text Available thyltransferase 1 / caffeic acid/5-hydroxyferulic acid O-methyltransferase (OMT1) identical to O-methyltrans...T1) (Flavonol 3- O-methyltransferase 1) (Caffeic acid/5-hydroxyferulic acid O- methyltransferase) {Arabidopsis thaliana} 5e-60 ...

  13. Arabidopsis CDS blastp result: AK064768 [KOME

    Lifescience Database Archive (English)

    Full Text Available thyltransferase 1 / caffeic acid/5-hydroxyferulic acid O-methyltransferase (OMT1) identical to O-methyltrans...T1) (Flavonol 3- O-methyltransferase 1) (Caffeic acid/5-hydroxyferulic acid O- methyltransferase) {Arabidopsis thaliana} 1e-112 ...

  14. Arabidopsis CDS blastp result: AK061551 [KOME

    Lifescience Database Archive (English)

    Full Text Available ethyltransferase 1 / caffeic acid/5-hydroxyferulic acid O-methyltransferase (OMT1) identical to O-methyltran...MT1) (Flavonol 3- O-methyltransferase 1) (Caffeic acid/5-hydroxyferulic acid O- methyltransferase) {Arabidopsis thaliana} 2e-67 ...

  15. Arabidopsis CDS blastp result: AK104764 [KOME

    Lifescience Database Archive (English)

    Full Text Available ethyltransferase 1 / caffeic acid/5-hydroxyferulic acid O-methyltransferase (OMT1) identical to O-methyltran...MT1) (Flavonol 3- O-methyltransferase 1) (Caffeic acid/5-hydroxyferulic acid O- methyltransferase) {Arabidopsis thaliana} 2e-67 ...

  16. Arabidopsis CDS blastp result: AK098998 [KOME

    Lifescience Database Archive (English)

    Full Text Available thyltransferase 1 / caffeic acid/5-hydroxyferulic acid O-methyltransferase (OMT1) identical to O-methyltrans...T1) (Flavonol 3- O-methyltransferase 1) (Caffeic acid/5-hydroxyferulic acid O- methyltransferase) {Arabidopsis thaliana} 8e-57 ...

  17. Arabidopsis CDS blastp result: AK061859 [KOME

    Lifescience Database Archive (English)

    Full Text Available ethyltransferase 1 / caffeic acid/5-hydroxyferulic acid O-methyltransferase (OMT1) identical to O-methyltran...MT1) (Flavonol 3- O-methyltransferase 1) (Caffeic acid/5-hydroxyferulic acid O- methyltransferase) {Arabidopsis thaliana} 1e-100 ...

  18. Arabidopsis CDS blastp result: AK102695 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK102695 J033103F21 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  19. Arabidopsis CDS blastp result: AK102134 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK102134 J033085F12 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  20. Arabidopsis CDS blastp result: AK066835 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066835 J013087I16 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-171 ...

  1. Arabidopsis CDS blastp result: AK065259 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065259 J013002J18 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  2. Arabidopsis CDS blastp result: AK100523 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100523 J023100P04 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  3. Arabidopsis CDS blastp result: AK242550 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242550 J080319D10 At2g35630.1 68415.m04369 microtubule organization 1 protein (MO...R1) identical to microtubule organization 1 protein GI:14317953 from [Arabidopsis thaliana] 5e-44 ...

  4. Arabidopsis CDS blastp result: AK241043 [KOME

    Lifescience Database Archive (English)

    Full Text Available upted by a stop codon, creating non-consensus donor and acceptor splice sites. 2e-41 ... ...tical to SP|P92997 Germin-like protein subfamily 1 member 13 precursor {Arabidopsis thaliana}; exon 2 interr

  5. Arabidopsis CDS blastp result: AK243135 [KOME

    Lifescience Database Archive (English)

    Full Text Available upted by a stop codon, creating non-consensus donor and acceptor splice sites. 7e-43 ... ...tical to SP|P92997 Germin-like protein subfamily 1 member 13 precursor {Arabidopsis thaliana}; exon 2 interr

  6. The fifth international conference on Arabidopsis research

    Energy Technology Data Exchange (ETDEWEB)

    Hangarter, R.; Scholl, R.; Davis, K.; Feldmann, K.

    1993-12-31

    This volume contains abstracts of oral and poster presentations made in conjunction with the Fifth International Conference on Arabidopsis Research held August 19--22, 1993 at the Ohio State University, Columbus, Ohio.

  7. Arabidopsis CDS blastp result: AK101526 [KOME

    Lifescience Database Archive (English)

    Full Text Available ucosaminyltransferase, putative similar to N-acetylglucosaminyltransferase I from Arabidopsis thaliana [gi:5139335]; contains AT-AC non-consensus splice sites at intron 13 1e-179 ...

  8. Arabidopsis CDS blastp result: AK119708 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119708 002-157-E08 At1g28330.1 dormancy-associated protein, putative (DRM1) identical to dormancy...-associated protein [Arabidopsis thaliana] GI:2995990; similar to dormancy-associated protei

  9. Arabidopsis CDS blastp result: AK060981 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060981 006-202-H08 At1g28330.1 dormancy-associated protein, putative (DRM1) identical to dormancy...-associated protein [Arabidopsis thaliana] GI:2995990; similar to dormancy-associated protei

  10. Arabidopsis CDS blastp result: AK111576 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111576 J013075J23 At1g01510.1 C-terminal binding protein (ANGUSTIFOLIA) nearly id...entical to C-terminal binding protein ANGUSTIFOLIA [Arabidopsis thaliana] GI:15408535; contains Pfam profile

  11. Arabidopsis CDS blastp result: AK120838 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK120838 J023022B11 At1g01510.1 C-terminal binding protein (ANGUSTIFOLIA) nearly id...entical to C-terminal binding protein ANGUSTIFOLIA [Arabidopsis thaliana] GI:15408535; contains Pfam profile

  12. Arabidopsis CDS blastp result: AK111921 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111921 001-013-A10 At1g01510.1 C-terminal binding protein (ANGUSTIFOLIA) nearly i...dentical to C-terminal binding protein ANGUSTIFOLIA [Arabidopsis thaliana] GI:15408535; contains Pfam profil

  13. Computer-assisted diagnostic system for neurodegenerative dementia using brain SPECT and 3D-SSP

    Energy Technology Data Exchange (ETDEWEB)

    Ishii, Kazunari; Kanda, Tomonori; Uemura, Takafumi; Miyamoto, Naokazu; Yoshikawa, Toshiki [Hyogo Brain and Heart Center, Department of Radiology and Nuclear Medicine, Himeji, Hyogo (Japan); Shimada, Kenichi; Ohkawa, Shingo [Hyogo Brain and Heart Center, Institute for Aging Brain and Cognitive Disorders, Himeji, Hyogo (Japan); Minoshima, Satoshi [University of Washington, Radiology and Bioengineering, Department of Radiology, Seattle, WA (United States)

    2009-05-15

    To develop a computer-assisted automated diagnostic system to distinguish among Alzheimer disease (AD), dementia with Lewy bodies (DLB), and other degenerative disorders in patients with mild dementia. Single photon emission computed tomography (SPECT) images with injection of N-Isopropyl-p-[{sup 123}I]iodoamphetamine (IMP) were obtained from patients with mild degenerative dementia. First, datasets from 20 patients mild AD, 15 patients with dementia with DLB, and 17 healthy controls were used to develop an automated diagnosing system based on three-dimensional stereotactic surface projections (3D-SSP). AD- and DLB-specific regional templates were created using 3D-SSP, and critical Z scores in the templates were established. Datasets from 50 AD patients, 8 DLB patients, and 10 patients with non-AD/DLB type degenerative dementia (5 with frontotemporal dementia and 5 with progressive supranuclear palsy) were then used to test the diagnostic accuracy of the optimized automated system in comparison to the diagnostic interpretation of conventional IMP-SPECT images. These comparisons were performed to differentiate AD and DLB from non-AD/DLB and to distinguish AD from DLB. A receiver operating characteristic (ROC) analysis was performed. The area under the ROC curve (Az) and the accuracy of the automated diagnosis system were 0.89 and 82%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 65%, respectively, for AD vs. DLB patients. The mean Az and the accuracy of the visual inspection were 0.84 and 77%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 65%, respectively, for AD vs. DLB patients. The mean Az and the accuracy of the combination of visual inspection and this system were 0.96 and 91%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 66%, respectively, for AD vs. DLB patients. The system developed in the present study achieved as good discrimination of AD, DLB, and other degenerative disorders in patients with mild

  14. Characterizing the Syphilis-Causing Treponema pallidum ssp. pallidum Proteome Using Complementary Mass Spectrometry

    Science.gov (United States)

    Houston, Simon; Lithgow, Karen V.; Meehan, Conor J.; Strouhal, Michal; Šmajs, David; Cameron, Caroline E.; Van Ostade, Xaveer; Kenyon, Chris R.; Van Raemdonck, Geert A.

    2016-01-01

    Background The spirochete bacterium Treponema pallidum ssp. pallidum is the etiological agent of syphilis, a chronic multistage disease. Little is known about the global T. pallidum proteome, therefore mass spectrometry studies are needed to bring insights into pathogenicity and protein expression profiles during infection. Methodology/Principal Findings To better understand the T. pallidum proteome profile during infection, we studied T. pallidum ssp. pallidum DAL-1 strain bacteria isolated from rabbits using complementary mass spectrometry techniques, including multidimensional peptide separation and protein identification via matrix-assisted laser desorption ionization-time of flight (MALDI-TOF/TOF) and electrospray ionization (ESI-LTQ-Orbitrap) tandem mass spectrometry. A total of 6033 peptides were detected, corresponding to 557 unique T. pallidum proteins at a high level of confidence, representing 54% of the predicted proteome. A previous gel-based T. pallidum MS proteome study detected 58 of these proteins. One hundred fourteen of the detected proteins were previously annotated as hypothetical or uncharacterized proteins; this is the first account of 106 of these proteins at the protein level. Detected proteins were characterized according to their predicted biological function and localization; half were allocated into a wide range of functional categories. Proteins annotated as potential membrane proteins and proteins with unclear functional annotations were subjected to an additional bioinformatics pipeline analysis to facilitate further characterization. A total of 116 potential membrane proteins were identified, of which 16 have evidence supporting outer membrane localization. We found 8/12 proteins related to the paralogous tpr gene family: TprB, TprC/D, TprE, TprG, TprH, TprI and TprJ. Protein abundance was semi-quantified using label-free spectral counting methods. A low correlation (r = 0.26) was found between previous microarray signal data and

  15. Engineering and Safety Partnership Enhances Safety of the Space Shuttle Program (SSP)

    Science.gov (United States)

    Duarte, Alberto

    2007-01-01

    Project Management must use the risk assessment documents (RADs) as tools to support their decision making process. Therefore, these documents have to be initiated, developed, and evolved parallel to the life of the project. Technical preparation and safety compliance of these documents require a great deal of resources. Updating these documents after-the-fact not only requires substantial increase in resources - Project Cost -, but this task is also not useful and perhaps an unnecessary expense. Hazard Reports (HRs), Failure Modes and Effects Analysis (FMEAs), Critical Item Lists (CILs), Risk Management process are, among others, within this category. A positive action resulting from a strong partnership between interested parties is one way to get these documents and related processes and requirements, released and updated in useful time. The Space Shuttle Program (SSP) at the Marshall Space Flight Center has implemented a process which is having positive results and gaining acceptance within the Agency. A hybrid Panel, with equal interest and responsibilities for the two larger organizations, Safety and Engineering, is the focal point of this process. Called the Marshall Safety and Engineering Review Panel (MSERP), its charter (Space Shuttle Program Directive 110 F, April 15, 2005), and its Operating Control Plan emphasizes the technical and safety responsibilities over the program risk documents: HRs; FMEA/CILs; Engineering Changes; anomalies/problem resolutions and corrective action implementations, and trend analysis. The MSERP has undertaken its responsibilities with objectivity, assertiveness, dedication, has operated with focus, and has shown significant results and promising perspectives. The MSERP has been deeply involved in propulsion systems and integration, real time technical issues and other relevant reviews, since its conception. These activities have transformed the propulsion MSERP in a truly participative and value added panel, making a

  16. Computer-assisted diagnostic system for neurodegenerative dementia using brain SPECT and 3D-SSP

    International Nuclear Information System (INIS)

    To develop a computer-assisted automated diagnostic system to distinguish among Alzheimer disease (AD), dementia with Lewy bodies (DLB), and other degenerative disorders in patients with mild dementia. Single photon emission computed tomography (SPECT) images with injection of N-Isopropyl-p-[123I]iodoamphetamine (IMP) were obtained from patients with mild degenerative dementia. First, datasets from 20 patients mild AD, 15 patients with dementia with DLB, and 17 healthy controls were used to develop an automated diagnosing system based on three-dimensional stereotactic surface projections (3D-SSP). AD- and DLB-specific regional templates were created using 3D-SSP, and critical Z scores in the templates were established. Datasets from 50 AD patients, 8 DLB patients, and 10 patients with non-AD/DLB type degenerative dementia (5 with frontotemporal dementia and 5 with progressive supranuclear palsy) were then used to test the diagnostic accuracy of the optimized automated system in comparison to the diagnostic interpretation of conventional IMP-SPECT images. These comparisons were performed to differentiate AD and DLB from non-AD/DLB and to distinguish AD from DLB. A receiver operating characteristic (ROC) analysis was performed. The area under the ROC curve (Az) and the accuracy of the automated diagnosis system were 0.89 and 82%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 65%, respectively, for AD vs. DLB patients. The mean Az and the accuracy of the visual inspection were 0.84 and 77%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 65%, respectively, for AD vs. DLB patients. The mean Az and the accuracy of the combination of visual inspection and this system were 0.96 and 91%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 66%, respectively, for AD vs. DLB patients. The system developed in the present study achieved as good discrimination of AD, DLB, and other degenerative disorders in patients with mild dementia

  17. Two Novel Alliin Lyase (Alliinase Genes from Twisted-Leaf Garlic (Allium obliquum and Mountain Garlic (Allium senescens ssp. montanum

    Directory of Open Access Journals (Sweden)

    Nicolae DRAGOŞ

    2011-11-01

    Full Text Available Alliinase (Alliin lyase EC 4.4.1.4, a pyridoxal phosphate-dependent lyase, represents one of the major protein components of Allium species. The enzyme is a homodimeric glycoprotein and catalyzes the synthesis of allicin (diallyl thiosulfinate, a biologically active compound, pyruvate, and ammonia starting from the specific non-protein sulfur-containing amino acid alliin ((+S-allyl-L-cysteine sulfoxide. Using newly developed specific primers two new alliinase genes from Allium obliquum and Allium senescens ssp. montanum were amplified and sequenced, as well as their homologs, from Allium fistulosum and Allium schoenoprasum. The G+C content of the alliinase region ranges between that of other dicot plants and that reported in monocot cereal plants, in all four species. Investigations of gene expression revealed a significantly higher enzyme expression level in bulbs than in leaves in all four taxa. The deduced alliinase sequences displayed a high variability among different species, since the lowest sequence similarity was found to be 55.5% between Allium senescens ssp. montanum and Allium cepa, while the highest similarity is 77.5%, between Allium senescens ssp. montanum and Allium fistulosum. Leucine is the most common amino acid in all four alliinases, while cysteine is also more frequent than in other enzymes, suggesting a high stability of the molecules due to the possible disulfide bonds.

  18. Cu,Cr and As determination in preserved woods (Eucalyptus ssp.) by X-ray fluorescence spectrometries

    International Nuclear Information System (INIS)

    Brazil produces around 2.2 millions of cubic meters of treated wood to meet the annual demand of railway, electric, rural and construction sectors. The most used wood species are eucalyptus (Eucalyptus ssp.) and pine (Pinus ssp.).The treated woods used for poles, sleepers, fence posts and plywoods should be according to Brazilian norms requirements. The most usual wood preservative products used in Brazil are CCA (chromated copper arsenate) and CCB (copper chromium and boron salt). The analytical methods, such as flame atomic absorption spectrometry (FAAS), plasma inductively coupled optical emission spectrometry (ICPOES) and X-ray fluorescence spectrometry (XRFS) have been used for the analytical control of those treatment processes. In this work, the eucalyptus trees (Eucalyptus ssp) samples was obtained from Minas Gerais State, Brazil, cut plantation areas. Under pressure, eucalyptus wood samples were submitted to different concentration of CCA solution reaching 3.9, 6.7, 9.1, 12.4 and 14.0 kg of CCA by m-³ sapwood retentions. Samples in cylinders and sawdust forms were obtained from treated wood samples. Copper, chromium and arsenic determination was performed using the energy dispersive X-ray fluorescence spectrometry (EDXRFS), portable X-ray fluorescence spectrometry (PXRFS), flame atomic absorption spectrometry (FAAS) and instrumental neutron activation analysis. In this work, the method of analysis, sensitivity, precision and accuracy performances of the related techniques were outlined. (author)

  19. Influence of different strains of Agrobacterium rhizogenes on induction of hairy roots and lignan production in Linum tauricum ssp. tauricum

    Directory of Open Access Journals (Sweden)

    Iliana Ionkova

    2009-01-01

    Full Text Available Hairy root cultures were induced from leaf explants of Linum tauricum ssp. Tauricum by infection with Agrobacterium rhizogenes. Different bacterial strains of Agrobacterium rhizogenes - TR 105 and ATCC 15834 were evaluated for induction of transformed hairy roots in Linum tauricum ssp. Tauricum. These different strains varied in their virulence for induction of hairy roots in this species. Acetosyringon in cultivation medium was used to increase of frequency of hairy root induction. Growth kinetics of transgenic roots indicated a similar pattern of growth, with maximum growth occurring between 17 and 20 days. The transformed nature of tissue was confirmed by the production of opines. The lignin production of different clones was found to be growth-related. The cultures produced to 2.6% of the lignin 4′-demethyl-6-methoxypodophylotoxin (4′-DM-MPTOX and to 3.5% of the lignin 6-methoxypodophyllotoxin (6MPTOX on a dry weight basis, which was 10 to 12 times higher than in Linum tauricum ssp. Tauricum cell suspensions. Transformed cultures showed significant differences in lignin content. The highest amount of 4′-DM-MPTOX and MPTOX was found in transformed line induced by strain ATCC 15834. Rapidly growing root lines were selected to increase the efficiency of he production of lignans.

  20. Accumulation of biologically active furanocoumarins in agitated cultures of Ruta graveolens L. and Ruta graveolens ssp. divaricata (Tenore) Gams.

    Science.gov (United States)

    Ekiert, H; Czygan, F-Ch

    2005-08-01

    This study was designed to investigate the dynamics of accumulation of linear furanocoumarins (psoralen, bergapten, xanthotoxin, isopimpinellin, imperatorin) and their biogenetic precursor, umbelliferone, in agitated cultures of Ruta graveolens L. and Ruta graveolens ssp. divaricata (Tenore) Gams during 6-week growth cycles. The metabolites under study were almost exclusively accumulated in the cultured biomass. The total content of all metabolites increased 4.8- and 2.0-fold, in R. graveolens and R. graveolens ssp. divaricata cultures, respectively. Xanthotoxin and bergapten, which are the most important therapeutic compounds, were the dominating metabolites in cultures of both plants. The maximum content of xanthotoxin (25.0 mg/100 g dry wt.) and bergapten (18.4 mg/100 g dry wt) and the maximum content of all metabolites (64.0 mg/100 g dry wt) in R. graveolens ssp. divaricata callus obtained on the 35th culture day were relatively low. However, maximum contents of xanthotoxin (136.8 mg/100 g dry wt), bergapten (210.4 mg/100 g dry wt.) and isopimpinellin (96.7 mg/100 g dry wt), and total content of all metabolites in R. graveolens shoots (520.8 mg/100 g dry wt) obtained on the 42nd culture day are interesting from a practical point of view.

  1. Terpene Specialized Metabolism in Arabidopsis thaliana

    OpenAIRE

    Tholl, Dorothea; Lee, Sungbeom

    2011-01-01

    Terpenes constitute the largest class of plant secondary (or specialized) metabolites, which are compounds of ecological function in plant defense or the attraction of beneficial organisms. Using biochemical and genetic approaches, nearly all Arabidopsis thaliana (Arabidopsis) enzymes of the core biosynthetic pathways producing the 5-carbon building blocks of terpenes have been characterized and closer insight has been gained into the transcriptional and posttranscriptional/translational mech...

  2. Arabidopsis CDS blastp result: AK064342 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK064342 002-107-H07 At5g58270.1 mitochondrial half-ABC transporter (STA1) identical to half...-molecule ABC transporter ATM3 GI:9964121 from [Arabidopsis thaliana]; almost identical to mitochondrial half...-ABC transporter STA1 GI:9187883 from [Arabidopsis thaliana]; identical to cDNA mitochondrial half-ABC transporter (STA1 gene)GI:9187882 0.0 ...

  3. Arabidopsis CDS blastp result: AK287662 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287662 J065112L10 At5g58270.1 68418.m07295 mitochondrial half-ABC transporter (STA1) identical to half...-molecule ABC transporter ATM3 GI:9964121 from [Arabidopsis thaliana]; almost identical to mitochondrial half...-ABC transporter STA1 GI:9187883 from [Arabidopsis thaliana]; identical to cDNA mitochondrial half-ABC transporter (STA1 gene)GI:9187882 1e-65 ...

  4. Arabidopsis CDS blastp result: AK242094 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242094 J075142E09 At5g58270.1 68418.m07295 mitochondrial half-ABC transporter (STA1) identical to half...-molecule ABC transporter ATM3 GI:9964121 from [Arabidopsis thaliana]; almost identical to mitochondrial half...-ABC transporter STA1 GI:9187883 from [Arabidopsis thaliana]; identical to cDNA mitochondrial half-ABC transporter (STA1 gene)GI:9187882 2e-33 ...

  5. Arabidopsis CDS blastp result: AK102879 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK102879 J033112G11 At5g58270.1 mitochondrial half-ABC transporter (STA1) identical to half...-molecule ABC transporter ATM3 GI:9964121 from [Arabidopsis thaliana]; almost identical to mitochondrial half...-ABC transporter STA1 GI:9187883 from [Arabidopsis thaliana]; identical to cDNA mitochondrial half-ABC transporter (STA1 gene)GI:9187882 1e-122 ...

  6. Arabidopsis CDS blastp result: AK287488 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287488 J043029O04 At5g58270.1 68418.m07295 mitochondrial half-ABC transporter (STA1) identical to half...-molecule ABC transporter ATM3 GI:9964121 from [Arabidopsis thaliana]; almost identical to mitochondrial half...-ABC transporter STA1 GI:9187883 from [Arabidopsis thaliana]; identical to cDNA mitochondrial half-ABC transporter (STA1 gene)GI:9187882 4e-27 ...

  7. Protein (Viridiplantae): 297852222 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 24:3181 3398:3181 71240:3723 91827:3723 71275:1324 91836:455 3699:455 3700:455 980083:455 3701:455 59689:256 81972:256 universa...l stress protein family protein Arabidopsis lyrata subsp. lyrata MQFSRNSILRQLSRKEGWRSASKR

  8. Growth Behavior of Phytopathogen Clavibacter michiganensis ssp. sepedonicus Treated with Selenium Biocomposites of Mushroom Origin

    Directory of Open Access Journals (Sweden)

    A.I. Perfileva

    2016-02-01

    Full Text Available The results of studying the effect of biologically obtained selenium nanocomposites on the bacterium Clavibacter michiganensis ssp. sepedonicus (Cms are presented. Cms is a Gram-positive bacterium, which causes one of the most dangerous potato diseases, ring rot. The effective alongside ecologically safe methods for combating Cms are lacking. As the agents feasible for use in this purpose, we examined the selenium nanocomposites obtained from the macrobasidiomycetes' submerged cultures. For exploring the bionanocomposites effect on Cms, the methods of agar well diffusion, the suspension turbidity measurement, and the colony-forming units count were applied. The results showed that all the nanocomposites under study lowered the bacterial suspension's absorption values compared to the reference specimen, that testified to the observation of bacteriostatic effect of the agents tested. The suppression action of nanocompostes was elucidated by means of both agar well diffusion assay and colony-forming units count. Thus, the results obtained demonstrate the occurrence of bacteriostatic and bactericidal effects of the substances under study, and favor the supposition on advisability of further research into the selenium nanocomposites as the agents for agricultural recovery from the bacterial pathogens.

  9. Comparative Transcriptome Analysis Reveals Heat-Responsive Genes in Chinese Cabbage (Brassica rapa ssp. chinensis)

    Science.gov (United States)

    Wang, Aihua; Hu, Jihong; Huang, Xingxue; Li, Xia; Zhou, Guolin; Yan, Zhixiang

    2016-01-01

    Chinese cabbage (Brassica rapa ssp. chinensis) is an economically and agriculturally significant vegetable crop and is extensively cultivated throughout the world. Heat stress disturbs cellular homeostasis and causes visible growth inhibition of shoots and roots, severe retardation in growth and development, and even death. However, there are few studies on the transcriptome profiling of heat stress in non-heading Chinese cabbage. In this study, we investigated the transcript profiles of non-heading Chinese cabbage from heat-sensitive and heat-tolerant varieties “GHA” and “XK,” respectively, in response to high temperature using RNA sequencing (RNA seq). Approximately 625 genes were differentially expressed between the two varieties. The responsive genes can be divided into three phases along with the time of heat treatment: response to stimulus, programmed cell death and ribosome biogenesis. Differentially expressed genes (DEGs) were identified in the two varieties, including transcription factors (TFs), kinases/phosphatases, genes related to photosynthesis and effectors of homeostasis. Many TFs were involved in the heat stress response of Chinese cabbage, including NAC069 TF which was up-regulated at all the heat treatment stages. And their expression levels were also validated by quantitative real-time-PCR (qRT-PCR). These candidate genes will provide genetic resources for further improving the heat-tolerant characteristics in non-heading Chinese cabbage. PMID:27443222

  10. Improving green roofs and rail road greening systems using Bacillus subtilis and Lactobacillus ssp.

    Science.gov (United States)

    Grüneberg, H; Oschmann, C; Dunya, S; Ulrichs, C

    2006-01-01

    Aim of the present study was the improvement of existing methods for green roof and rail road greening systems using soil borne bacteria. Bacillus subtilis and Lactobacillus ssp. alone and in combination with vinasse applied to different growing substrates were tested. The substrates were brick chips, textile mats, mineral wool mats, and a commercial available substrate for the Swedish company VegTech. All four substrates were tested along an artificial rail track on the experimental station at Humboldt University Berlin, and partly on an existing rail track in Munich, Germany. Plants selected for the experiments belong to the genus Sedum, which is relatively tolerant to dry conditions. Inoculation of plants with bacteria had no effect on plant growth parameters and on coverage of different mobile bedding systems with Sedum plants. There was no significant difference between the various treatments in Munich. In both experiments, the addition of vinasse alone improved plant growth. Plant growth was significantly different on all substrates, whereas brick chips and the commercial roof soil was the best substrate. Brick chips are a cheap substrate which can be used for rail track greening. The results indicate that the quality of the substrate is the most important factor for remediation and greening of rail tracks and roof tops. The rapid growth of plants can be influenced by the application of vinasse as additional nutrient solution (potash (K) source) or nutrient enriched substrate.

  11. Complete genome sequence of Treponema pallidum ssp. pallidum strain SS14 determined with oligonucleotide arrays

    Directory of Open Access Journals (Sweden)

    Sodergren Erica

    2008-05-01

    Full Text Available Abstract Background Syphilis spirochete Treponema pallidum ssp. pallidum remains the enigmatic pathogen, since no virulence factors have been identified and the pathogenesis of the disease is poorly understood. Increasing rates of new syphilis cases per year have been observed recently. Results The genome of the SS14 strain was sequenced to high accuracy by an oligonucleotide array strategy requiring hybridization to only three arrays (Comparative Genome Sequencing, CGS. Gaps in the resulting sequence were filled with targeted dideoxy-terminators (DDT sequencing and the sequence was confirmed by whole genome fingerprinting (WGF. When compared to the Nichols strain, 327 single nucleotide substitutions (224 transitions, 103 transversions, 14 deletions, and 18 insertions were found. On the proteome level, the highest frequency of amino acid-altering substitution polymorphisms was in novel genes, while the lowest was in housekeeping genes, as expected by their evolutionary conservation. Evidence was also found for hypervariable regions and multiple regions showing intrastrain heterogeneity in the T. pallidum chromosome. Conclusion The observed genetic changes do not have influence on the ability of Treponema pallidum to cause syphilitic infection, since both SS14 and Nichols are virulent in rabbit. However, this is the first assessment of the degree of variation between the two syphilis pathogens and paves the way for phylogenetic studies of this fascinating organism.

  12. RAPID HLA-DRB1 GENERIC TYPING BY PCR-SSP METHOD

    Institute of Scientific and Technical Information of China (English)

    邱长春; 赵岩; 陶贞寅; 朱席林; 徐作军; 董怡

    1995-01-01

    We report a simple and rapid HLA-DRB1 generic typing metbod,PCR-SSP,which is practical and inexpensive.We use 9 sequence-specific primers and 2 group specific primers to define the HLA-DRB1 specificities DR1,DR2,DR3,DR4,DR5,DR6,DR7,DR8,DR9 and DR10. The HLA DR3,DR5,DR6 and DR8 can be amplified by the two primers of DR3568 are positive.Any individuals can be typed with some exception: the three pairs of phenotype DR3/DR3 and DR3/DR6,DR5/DR5 and DR5/DR6, DR8/DR8 and DR8/DR6 cannot be discriminated from each other.We typed 106 unrelated healthy people from Beijing locations in two weeks.We think this typing method is suitable to replace the error-Prone serologic HLA-DR tests in routine clinical practice,including the prospective typing of cadaveric organ donors.

  13. The essential oil of the protected species: Thymus praecox ssp. penyalarensis

    Directory of Open Access Journals (Sweden)

    José Blanco Salas

    2012-03-01

    Full Text Available The essential oil of a protected Spanish species, Thymus praecox ssp. penyalarensis, was firstly analyzed [Gas Chromatography-Mass Spectrometry (GC-MS] from wild populations during the phenological stages of flowering and fruiting. In flowering, the yield was 1.2%, and the major components were identified as thymol (18.5%, p-cymene (14.6%, carvacrol (11.6%, and γ-terpinene (10.1%. In fruiting, the yield was 0.9% and the major components resulted to be p-cymene (19.0%, carvacrol (16.5%, and borneol (10.5%. An experimental cultivation of the taxa was made also in order to analyze its essential oil as well. The yield was 1.3%, and the main compounds were thymol (19.1%, p-cymene (17.0%, and γ-terpinene (12.3%. Finally, the composition of the essential oil of this plant is discussed in relation to chemotaxonomic and biogeographical aspects.

  14. Anatomical and micromorphological particularities of vegetative organs in endemic Erysimum wittmanii Zaw. ssp. wittmanii

    Directory of Open Access Journals (Sweden)

    Irina Neta GOSTIN

    2009-11-01

    Full Text Available The Erysimum wittmanii ssp. wittmanii is an endemic biennial herbaceous species in South and East Carpathians. In this study the anatomical and micromorphological properties of this specie are investigated. Anatomical properties of root, stem and leaves were underlined. Roots acquire early in ontogenesis the secondary structure. Stems presents collateral vascular bundles both in primary and in secondary structure; cortical small bundles by concentric type, was observed on the cross sections from the top of the stem. The leaves are bifacial and amphystomatic. Scanning electron microscopy investigation regarding upper and lower epidermises of leaves in different developmental stages was carried out. Trichomes occur on both faces of young leaves. The tector hairs are multicelullar, usually three-armed; rarely four-armed or two-armed (especially on the epidermis from the veins. The hairs cell walls are thin and the surface is smooth in the first developmental stages (on very young leaves; on the young and mature leaves the trichomes have thick-walled cells, densely covered by micro-papillae.

  15. Influence of mowing Artemisia tridentata ssp. wyomingensis on winter habitat for wildlife.

    Science.gov (United States)

    Davies, Kirk W; Bates, Jonathan D; Johnson, Dustin D; Nafus, Aleta M

    2009-07-01

    Mowing is commonly implemented to Artemisia tridentata ssp. wyomingensis (Beetle & A. Young) S.L. Welsh (Wyoming big sagebrush) plant communities to improve wildlife habitat, increase forage production for livestock, and create fuel breaks for fire suppression. However, information detailing the influence of mowing on winter habitat for wildlife is lacking. This information is crucial because many wildlife species depended on A. tridentata spp. wyomingensis plant communities for winter habitat and consume significant quantities of Artemisia during this time. Furthermore, information is generally limited describing the recovery of A. tridentata spp. wyomingensis to mowing and the impacts of mowing on stand structure. Stand characteristics and Artemisia leaf tissue crude protein (CP), acid detergent fiber (ADF), and neutral detergent fiber (NDF) concentrations were measured in midwinter on 0-, 2-, 4-, and 6-year-old fall-applied mechanical (mowed at 20 cm height) treatments and compared to adjacent untreated (control) areas. Mowing compared to the control decreased Artemisia cover, density, canopy volume, canopy elliptical area, and height (P plant communities slightly increases the nutritional quality of Artemisia leaves (P winter habitat. Considering the decline in A. tridentata spp. wyomingensis-dominated landscapes, we caution against mowing these communities.

  16. Characterization of a sagebrush (Artemisia tridentata ssp. wyomingensis) die-off on the Handford Site

    International Nuclear Information System (INIS)

    The Hanford Site contains one of the few remaining contiguous areas of shrub-steppe habitat left in Washington State. This habitat is home to many native plant and wildlife species, some of which are threatened with extinction or are unique to the Site. The importance of the Hanford Site increases as other lands surrounding the Site are developed, and these native species and habitats are lost. Stands of Wyoming big sagebrush (Artemisia tridentata ssp. wyomingensis) on the Site are a particularly important component of shrub-steppe habitat, because a number of wildlife require big sagebrush for food and cover. Since 1993, researchers and field biologists have made anecdotal observations of dying and declining sagebrush in stands of shrubs near the 100 Areas. This study was initiated to delineate and document the general boundary where sagebrush stands appear to be declining. We mapped the areal extent of the die-off using a global positioning system and found that the central portion of the die-off encompasses 280 hectares. Shrub stand defoliation was estimated to be near or greater than 80% in this area. The remainder of the die-off area exhibits varying mixtures of completely defoliated, partially defoliated, and healthy-looking stands. Declining sagebrush stands comprise a total of 1776 hectares

  17. Immunostimulatory oligonucleotide, CpG-like motif exists in Lactobacillus delbrueckii ssp. bulgaricus NIAI B6.

    Science.gov (United States)

    Kitazawa, Haruki; Watanabe, Hiroshi; Shimosato, Takeshi; Kawai, Yasushi; Itoh, Takatoshi; Saito, Tadao

    2003-08-15

    The present study was conducted to find an immunostimulatory oligonucleotide derived from yogurt starter cultures. The chromosomal DNA was purified from nine strains of Lactobacillus delbrueckii ssp. bulgaricus and six strains of Streptococcus thermophilus. An immunostimulatory ability of the DNA was examined in a proliferation of peyer's patch and splenic B cells. Only the DNA from L. bulgaricus NIAI B6 induced a significant proliferation of both cells. When the DNA was cloned and amplified using PCR, the mitogenic activities to B cells were significantly increased by 13 of 135 DNA clones. Ten homologous nucleotide sequences were found as possible oligonucleotide sequences of mitogens, and were then chemically synthesized (sOL-LB1 to sOL-LB10). One CpG-like motif (sOL-LB7; 5'-CGGCACGCTCACGATTCTTG-3') was identified as an immunostimulatory oligonucleotide, but it did not contain palindromic CpG structure known as a B cell-specific mitogen. The sOL-LB7 substantially bound to B cells and increased the CD69 positive cells in peyer's patch cells. This study demonstrated that L. bulgaricus NIAI B6 was a good candidate of a starter culture for the production of new functional foods, "Bio-Defense Foods".

  18. Isolation and characterization of Lactobacillus delbrueckii ssp. bulgaricus and Streptococcus thermophilus from plants in Bulgaria.

    Science.gov (United States)

    Michaylova, Michaela; Minkova, Svetlana; Kimura, Katsunori; Sasaki, Takashi; Isawa, Kakuhei

    2007-04-01

    One of the traditional ways of preparation of yogurt starter in Bulgaria is placing a branch of a particular plant species into boiled sheep's milk maintained at about 45 degrees C, which is further incubated until a dense coagulum is obtained. To investigate the possible origin of the yogurt starter bacteria, Lactobacillus delbrueckii ssp. bulgaricus (L. bulgaricus) and Streptococcus thermophilus (S. thermophilus), the traditional way of yogurt-starter preparation was followed. Hundreds of plant samples were collected from four regions in Bulgaria and incubated in sterile skim milk. The two target bacteria at low frequencies from the plant samples collected were successfully isolated. Phenotypic and genotypic characteristics of these bacterial isolates revealed that they were identified as L. bulgaricus and S. thermophilus. Twenty isolates of L. bulgaricus and S. thermophilus, respectively, were selected from the isolated strains and further characterized with regard to their performance in yogurt production. Organoleptic and physical properties of yogurt prepared using the isolated strains from plants were not significantly different from those prepared using commercial yogurt-starter strains. It was therefore suggested that L. bulgaricus and S. thermophilus strains widely used for commercial yogurt production could have originated from plants in Bulgaria. To our knowledge, this is the first report on the isolation and characterization of L. bulgaricus and S. thermophilus strains from plants.

  19. Variation in Nectar Volume and Sugar Concentration of Allium ursinum L. ssp. ucrainicum in Three Habitats

    Directory of Open Access Journals (Sweden)

    Ágnes Farkas

    2012-01-01

    Full Text Available Floral nectar volume and concentration of ramson (Allium ursinum L. ssp. ucrainicum were investigated in three different habitats, including two types of sessile oak-hornbeam association on brown forest soil with clay illuviation and a silver lime-flowering ash rock forest association on rendzina. Daily nectar production ranged from 0.1 to 3.8 μL per flower with sugar concentrations of 25 to 50%. Mean nectar volumes and concentrations showed significant differences between freely exposed flowers and covered flowers, which had been isolated from flower visitors 24 h prior to nectar studies. Both the amount and quality of nectar were affected by microclimatic conditions and soil properties and varied between populations at different habitats. In the silver lime-flowering ash rock-forest association mean nectar volumes and concentrations were lower than in a typical sessile oak-hornbeam association on three occasions, the difference being significant in two cases. During full bloom, the date of sampling did not have a profound effect on either nectar volume or concentration.

  20. Leaf water relations of Eucalyptus globulus ssp. globulus and E. nitens: seasonal, drought and species effects.

    Science.gov (United States)

    White, D A; Beadle, C L; Worledge, D

    1996-05-01

    In August 1990, a 2-ha plantation was established in an area where rainfall (about 515 mm year(-1)) was insufficient to meet evaporative demand. On nine occasions between September 1991 and April 1993, pressure-volume curves were constructed for irrigated and rainfed Eucalyptus globulus ssp. globulus Labill. and E. nitens (Deane and Maiden) Maiden trees. During the experiment, rainfed trees experienced six periods when predawn water potential was significantly lower than that of irrigated trees. In early spring of 1991 and 1992, osmotic potentials at full turgor and turgor loss point in the irrigated E. nitens were significantly lower than at other times of the year, probably because of winter hardening. Water stress reduced osmotic potential and increased bulk elastic modulus in E. nitens, whereas the reverse occurred in E. globulus. However, treatment differences with respect to changes in osmotic and elastic properties were commonly overshadowed by interspecific differences. These were most apparent at the end of the sixth period of water stress when osmotic potentials at full and zero turgor were significantly higher and bulk elastic modulus and relative water content at turgor loss point were significantly lower in E. globulus than in E. nitens. We conclude that the drought-tolerance responses of E. globulus make it a more suitable species than E. nitens for establishment on sites where moderate water stress is experienced.

  1. The Discovery of Resistant Sources of Spring Barley, Hordeum vulgare ssp. spontaneum, and Unique Greenbug Biotypes.

    Science.gov (United States)

    Armstrong, J Scott; Mornhinweg, Dolores W; Payton, Mark E; Puterka, Gary J

    2016-02-01

    The genetic sources for host-plant resistance to the greenbug (Schizaphis graminum Rondani) in barley (Hordeum vulgare ssp. spontaneum) are limited in that only two single dominant genes Rsg1 and Rsg2 are available for the complex of greenbug biotypes. We evaluated four new barley lines from the Wild Barley Diversity Collection (WBDC) that previously showed potential for greenbug resistance. Three of those entries, WBDC 53, WBDC 117, WBDC 336, exhibited very dominant sources of resistance to older known biotypes B, C, E, F, H, I, and TX1, which also add to the host-plant differentials used to separate these greenbug biotypes. We also re-evaluated the earlier known set of greenbug biotypes that have been in culture for several years against the known host-plant differentials, and included seven newer greenbug isolates collected from Wyoming to the full complement of small grain differentials. This resulted in the discovery of five new greenbug biotypes, WY10 MC, WY81, WY10 B, WY12 MC, and WY86. Wyoming isolates WY4 A and WY4 B were identical in their phenotypic profile, and should be combined as a single unique greenbug biotype. These barley trials resulted in finding new sources of host-plant resistance, although more research needs to be conducted on what type of resistance was found, and how it can be used. We also document that the Wheatland, Wyoming area serves as a very conducive environment for the development of new greenbug biotypes. PMID:26527793

  2. Chemical composition and nutritional evaluation of the seeds of Acacia tortilis (Forssk.) Hayne ssp. raddiana.

    Science.gov (United States)

    Embaby, Hassan E; Rayan, Ahmed M

    2016-06-01

    Chemical composition and nutritional evaluation as well as physicochemical and functional properties of seed flour of Acacia tortilis (Forssk.) Hayne ssp. raddiana were studied. The results indicated that seeds contained 5.30% moisture, 3.99% ash, 9.19% fat, 14.31% fiber, 27.21% protein and 45.30% carbohydrates. Potassium was the predominant element followed by calcium and then phosphorous. Phytic acid, tannins and trypsin inhibitor as antinutrients were detected. The amino acid profile compared well with FAO/WHO recommended pattern except for cystine/methionine, isoleucine, tyrosine/phenylalanine, lysine and threonine. Also, the first limiting amino acid was lysine. Fatty acid composition showed that linoleic acid was the major fatty acid, followed by palmitic, stearic, oleic and arachidic acids. The seed oil showed absorbance in the ultraviolet ranges, thus it can be used as a broad spectrum UV protectant. For physicochemical and functional properties, acacia seeds flour had excellent water holding index, swelling index, foaming capacity and foam stability. PMID:26830561

  3. Comparative Transcriptome Analysis Reveals Heat-Responsive Genes in Chinese Cabbage (Brassica rapa ssp. chinensis).

    Science.gov (United States)

    Wang, Aihua; Hu, Jihong; Huang, Xingxue; Li, Xia; Zhou, Guolin; Yan, Zhixiang

    2016-01-01

    Chinese cabbage (Brassica rapa ssp. chinensis) is an economically and agriculturally significant vegetable crop and is extensively cultivated throughout the world. Heat stress disturbs cellular homeostasis and causes visible growth inhibition of shoots and roots, severe retardation in growth and development, and even death. However, there are few studies on the transcriptome profiling of heat stress in non-heading Chinese cabbage. In this study, we investigated the transcript profiles of non-heading Chinese cabbage from heat-sensitive and heat-tolerant varieties "GHA" and "XK," respectively, in response to high temperature using RNA sequencing (RNA seq). Approximately 625 genes were differentially expressed between the two varieties. The responsive genes can be divided into three phases along with the time of heat treatment: response to stimulus, programmed cell death and ribosome biogenesis. Differentially expressed genes (DEGs) were identified in the two varieties, including transcription factors (TFs), kinases/phosphatases, genes related to photosynthesis and effectors of homeostasis. Many TFs were involved in the heat stress response of Chinese cabbage, including NAC069 TF which was up-regulated at all the heat treatment stages. And their expression levels were also validated by quantitative real-time-PCR (qRT-PCR). These candidate genes will provide genetic resources for further improving the heat-tolerant characteristics in non-heading Chinese cabbage. PMID:27443222

  4. Full Scale Test of SSP 34m blade, edgewise loading LTT. Data Report 1

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Magda; Jensen, Find M.; Nielsen, Per H. (and others)

    2010-01-15

    This report is a part of a research project where a 34m wind turbine blade from SSP-Technology A/S has been tested in edgewise direction (LTT). The applied load is 60% of an unrealistic extreme event, corresponding to 75% of a certificated extreme load. This report describes the background, the test set up, the tests and the results. For this project, a new solution has been used for the load application and the solution for the load application is described in this report as well. The blade has been submitted to thorough examination. More areas have been examined with DIC, both global and local deflections have been measured, and also 378 strain gauge measurements have been performed. Furthermore Acoustic Emission has been used in order to detect damage while testing new load areas. The global deflection is compared with results from a previous test and results from FEM analyses in order to validate the solution as to how the gravity load on the blade was handled. Furthermore, the DIC measurement and the displacement sensors measurements are compared in order to validate the results from the DIC measurements. The report includes the results from the test and a description of the measurement equipment and the data acquisition. (author)

  5. Effects of amendments on the uptake and distribution of DDT in Cucurbita pepo ssp pepo plants

    International Nuclear Information System (INIS)

    The effects of soil amendments on the phytoextraction of ΣDDT (DDT + DDD + DDE) from soil ([ΣDDT] ∼ 1500 ng/g) by a pumpkin variety of Cucurbita pepo ssp pepo were tested and the patterns of ΣDDT storage throughout the plant shoot were examined. The soil amendments did not increase the total amount of ΣDDT extracted into plant shoots, but new information about ΣDDT distribution in the plants was obtained. As observed previously, the ΣDDT concentration in plant leaves (mean 290 ng/g) was significantly lower than in plant stems (mean 2600 ng/g). Further analysis revealed that ΣDDT composition was consistent throughout the plant shoot and that ΣDDT concentration in leaves and stems decreased exponentially as distance from the root increased, which was previously unknown. This new information about the patterns of ΣDDT uptake and translocation within pumpkin plants highlights the need for appropriate plant sampling strategies in future POPs phytoextraction research. - Patterns of ΣDDT storage in a pumpkin plant are elucidated and specific surfactant and mycorrhizal soil amendments did not increase the total amount of ΣDDT phytoextracted into plant shoots.

  6. 大白菜BrTCP24基因的克隆与功能分析%Cloning and Functional Analysis of BrTCP24 Gene in Chinese Cabbage (Brassica rapa L.ssp.pekinensis)

    Institute of Scientific and Technical Information of China (English)

    王凤德; 谭婷婷; 张一卉; 李景娟; 李化银; 李利斌; 刘立锋; 高建伟

    2013-01-01

    It is very important to isolate and characterize the genes responsible for negative control of the leaf heading growth of Chinese cabbage,which can be help to speed up breeding progress of the small heading Chinese cabbage varieties that meet the current market demands.Here,a full-length TCP cDNA named BrTCP24,which belongs to the second subgroups of TCP domain family,was isolated from leaves of Chinese cabbage inbred line Fushanbaotou (Brassica rapa L.ssp.pekinensis).The full-length cDNA of BrTCP24 consisted of 1 221 nucleotides,and was predicted to code a 406-amino acid polypeptide.In addition,there were no introns in BrTCP24 gene.The phylogenetic analysis about BrTCP24 and TCP families in Arabidopsis was carried out using the software of MEGA4.0.The result indicated that BrTCP24 gene and Arabidopsis AtTCP3 gene would belong to the same branch,which suggested they had closely genetic relationship.The alignment of predicted amino acid sequences of BrTCP24 and Arabidopsis AtTCP3 indicated that there was 55.15% identity between them.Additionally,these two proteins contained conserved TCP domain and had 91.53% identity in this domain.These results suggested that BrTCP24 and Arabidopsis AtTCP3 would have similar biological functions.The semiquantitive RT-PCR indicated that BrTCP24 gene was expressed in roots,dwarf stems,rosette leaves,folding leaves,flowers,siliques and bud flowers examined in Chinese cabbage.Among them,rosette leaves had the highest mRNA level,followed by roots,folding leaves,flowers,siliques and bud flowers,while dwarf stems had the lowest mRNA level.Interestingly,the expression level of BrTCP24 didn't effect by 5 μmol NAA treatment in 12 h period.To test the function of BrTCP24,we then engineered Arabidopsis plants that would over-express BrTCP24 ectopically,driven by CaMV 35S promoter,and obtained 17 transgenic lines by Kanamycin and PCR screening.Using RT-PCR method,we randomly detected 5 transgenic lines and found all of them could express

  7. Identification of an HLA-A* 0201-restricted CD8+ T-cell epitope SSp-1 of SARS-CoV spike protein

    Institute of Scientific and Technical Information of China (English)

    Wang B; Yu Y; Wang X; Yang R; Cao X; Chen H; Jiang X; Zhang M; Wan T; Li N; Zhou X; Wu Y; Yang F

    2004-01-01

    A novel coronavirus, severe acute respiratory syndrome (SARS)-associated coronavirus (SARS-CoV), has been identified as the causal agent of SARS. Spike (S) protein is a major structural glycoprotein of the SARS virus and a potential target for SARS-specific cell-mediated immune responses. A panel of S protein-derived peptides was tested for their binding affinity to HLA-A * 0201 molecules. Peptides with high affinity for HLA-A * 0201 were then assessed for their capacity to elicit specific immune responses mediated by cytotoxic T lymphocytes (CTLs) both in vivo, in HLA-A2. 1/Kb transgenic mice, and in vitro, from peripheral blood lymphocytes (PBLs) harvested from healthy HLA-A2.1 + donors. SARS-CoV protein-derived peptide-1 (SSp-1 RLNEVAKNL), induced peptide-specific CTLs both in vivo (transgenic mice) and in vitro (human PBLs), which specifically released interferon-gamma (IFN-gamma) upon stimulation with SSp-1-pulsed autologous dendritic cells (DCs) or T2 cells. SSp-1-specific CTLs also lysed major histocompatibility complex (MHC)-matched tumor cell lines engineered to express S proteins. HLA-A * 0201-SSp-1 tetramer staining revealed the presence of significant populations of SSp-1-specific CTLs in SSp-1-induced CD8+ T cells. We propose that the newly identified epitope SSp-1 will help in the characterization of virus control mechanisms and immunopathology in SARS-CoV infection, and may be relevant to the development of immunotherapeutic approaches for SARS.

  8. Advances in Arabidopsis research in China from 2006 to 2007

    Institute of Scientific and Technical Information of China (English)

    LIANG Yan; ZUO JianRu; YANG WeiCai

    2007-01-01

    @@ Arabidopsis thaliana, a model plant species, has a number of advantages over other plant species as an experimental organism due to many of its genetic and genomic features. The Chinese Arabidopsis community has made significant contributions to plant biology research in recent years[1,2]. In 2006, studies of plant biology in China received more attention than ever before, especially those pertaining to Arabidopsis research. Here we briefly summarize recent advances in Arabidopsis research in China.

  9. Cis-regulatory Evolution of Chalcone-Synthase Expression in the Genus Arabidopsis

    OpenAIRE

    de Meaux, J. (Juliette); Pop, A.(National Institute for Physics and Nuclear Engineering, Bucharest, Romania); Mitchell-Olds, T.

    2006-01-01

    The contribution of cis-regulation to adaptive evolutionary change is believed to be essential, yet little is known about the evolutionary rules that govern regulatory sequences. Here, we characterize the short-term evolutionary dynamics of a cis-regulatory region within and among two closely related species, A. lyrata and A. halleri, and compare our findings to A. thaliana. We focused on the cis-regulatory region of chalcone synthase (CHS), a key enzyme involved in the synthesis of plant sec...

  10. Cloning by 3′-RACE and Expression of BrMYB34-3 Gene from Brassica rapa ssp.pekinensis%大白菜BrMYB34-3基因的3′-RACE克隆及表达

    Institute of Scientific and Technical Information of China (English)

    国静; 刘庆霞; 李梦莎; 张耀伟; 阎秀峰

    2011-01-01

    以大白菜叶片为材料,根据NCBI数据库中BrMYB34-3基因序列的已知信息,利用3-RACE获得了BrMYB34-3基因全长,用RT-PCR方法对BrMYB34-3在不同组织中的表达进行分析.结果显示,该基因全长1 135 bp,编码280个氨基酸.BrMYB34-3具有R2R3-MYB(含有2个MYB结构域的转录因子)典型的R2、R3结构域及基序.其氨基酸序列与大白菜的BrMYB34-1和BrMYB34-2、拟南芥的AtMYB34具有较高的一致性.BrMYB34-3在莲座叶、当天开的花中表达水平较高,在花序顶端表达水平较低,在根和花序轴中未检测到表达,这与拟南芥AtMYB34的表达模式不同.研究表明,BrMYB34-3是大白菜中的MYB34同源基因,在功能上可能与拟南芥AtMYB34基因存在差异.%An R2R3-MYB gene,BrMYB34-3, was isolated from the leaves of Brassica rapa ssp. pekinensis by 3′-RACE techniques based on the partial sequence in NCBI database. The full length of BrMYB34-3 cDNA was 1 135 bp,encoding 280 amino acids. The deduced amino acid sequence contained the conserved R2 and R3 domains near the N-terminus and a conserved motif which is the characteristic of R2R3-MYB transcription factor. Phylogenetic analysis revealed that BrMYB34-3 was clustered with BrMYB34-1 and BrMYB34-2 from Brassica rapa ssp. pekinensis and AtMYB34 from Arabidopsis thaliana. Expression analysis by RT-PCR showed that BrMYB34-3 was highly expressed in rosette leaves and flowers and lowly expressed in the tip of inflorescences,but not expressed in the roots and the inflorescence stems, which is different from the expression pattern of AtMYB34 in Arabidopsis thaliana. These results indicate that BrMYB34-3 is a homologous gene of MYB34 in Brassica rapa ssp. pekinensis,and it might have at least partial different functions with Arabidopsis AtMYB34.

  11. Bioavailability of nanoparticulate hematite to Arabidopsis thaliana

    International Nuclear Information System (INIS)

    The environmental effects and bioavailability of nanoparticulate iron (Fe) to plants are currently unknown. Here, plant bioavailability of synthesized hematite Fe nanoparticles was evaluated using Arabidopsis thaliana (A. thaliana) as a model. Over 56-days of growing wild-type A. thaliana, the nanoparticle-Fe and no-Fe treatments had lower plant biomass, lower chlorophyll concentrations, and lower internal Fe concentrations than the Fe-treatment. Results for the no-Fe and nanoparticle-Fe treatments were consistently similar throughout the experiment. These results suggest that nanoparticles (mean diameter 40.9 nm, range 22.3–67.0 nm) were not taken up and therefore not bioavailable to A. thaliana. Over 14-days growing wild-type and transgenic (Type I/II proton pump overexpression) A. thaliana, the Type I plant grew more than the wild-type in the nanoparticle-Fe treatment, suggesting Type I plants cope better with Fe limitation; however, the nanoparticle-Fe and no-Fe treatments had similar growth for all plant types. -- Highlights: ► Iron nanoparticles were synthesized and assessed for bioavailability to Arabidopsis. ► Arabidopsis grew better in the presence of EDTA-bound iron than nanoparticulate iron. ► Arabidopsis grew the same in the presence of nanoparticulate iron compared to no iron. -- Synthesized iron nanoparticles were not bioavailable to Arabidopsis thaliana in agar nutrient media

  12. Mining the active proteome of Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Renier A. L. Van Der Hoorn

    2011-11-01

    Full Text Available Assigning functions to the >30.000 proteins encoded by the Arabidopsis genome is a challenging task of the Arabidopsis Functional Genomics Network. Although genome-wide technologies like proteomics and transcriptomics have generated a wealth of information that significantly accelerated gene annotation, protein activities are poorly predicted by transcript or protein levels as protein activities are post-translationally regulated. To directly display protein activities in Arabidopsis proteomes, we developed and applied Activity-based Protein Profiling (ABPP. ABPP is based on the use of small molecule probes that react with the catalytic residues of distinct protein classes in an activity-dependent manner. Labeled proteins are separated and detected from proteins gels and purified and identified by mass spectrometry. Using probes of six different chemotypes we have displayed of activities of 76 Arabidopsis proteins. These proteins represent over ten different protein classes that contain over 250 Arabidopsis proteins, including cysteine- serine- and metallo-proteases, lipases, acyltransferases, and the proteasome. We have developed methods for identification of in vivo labeled proteins using click-chemistry and for in vivo imaging with fluorescent probes. In vivo labeling has revealed novel protein activities and unexpected subcellular activities of the proteasome. Labeling of extracts displayed several differential activities e.g. of the proteasome during immune response and methylesterases during infection. These studies illustrate the power of ABPP to display the functional proteome and testify to a successful interdisciplinary collaboration involving chemical biology, organic chemistry and proteomics.

  13. Ontogenetic differences in mesophyll structure and chlorophyll distribution in Eucalyptus globulus ssp. globulus.

    Science.gov (United States)

    James, S A; Smith, W K; Vogelmann, T C

    1999-02-01

    Mesophyll structure has been associated with the photosynthetic performance of leaves via the regulation of internal light and CO(2) profiles. Differences in mesophyll structure and chlorophyll distribution within three ontogenetically different leaf types of Eucalyptus globulus ssp. globulus were investigated. Juvenile leaves are blue-grey in color, dorsiventral (adaxial palisade layer only), hypostomatous, and approximately horizontal in orientation. In contrast, adult leaves are dark green in color, isobilateral (adaxial and abaxial palisade), amphistomatous, and nearly vertical in orientation. The transitional leaf type has structural features that appear intermediate between the juvenile and adult leaves. The ratio of mesophyll cell surface area per unit leaf surface area (A(mes)/A) of juvenile leaves was maximum at the base of a single, adaxial palisade layer and declined through the spongy mesophyll. Chlorophyll a + b content showed a coincident pattern, while the chlorophyll a:b ratio declined linearly from the adaxial to abaxial epidermis. In comparison, the mesophyll of adult leaves had a bimodal distribution of A(mes)/A, with maxima occurring beneath both the adaxial and abaxial surfaces within the first layer of multiple palisade layers. The distribution of chlorophyll a + b content had a similar pattern, although the maximum ratio of chlorophyll a:b occurred immediately beneath the adaxial and abaxial epidermis. The matching distributions of A(mes)/A and chlorophyll provide further evidence that mesophyll structure may act to influence photosynthetic performance. These changes in internal leaf structure at different life stages of E. globulus may be an adaptation for increased xeromorphy under increasing light exposure experienced from the seedling to adult tree, similar to the characteristics reported for different species according to sunlight exposure and water availability within their native habitats.

  14. Systemic and mucosal immune reactivity upon Mycobacterium avium ssp. paratuberculosis infection in mice.

    Directory of Open Access Journals (Sweden)

    Arzu Koc

    Full Text Available Mycobacterium avium ssp. paratuberculosis (MAP is the cause of Johne's disease, an inflammatory bowel disorder of ruminants. Due to the similar pathology, MAP was also suggested to cause Crohn's disease (CD. Despite of intensive research, this question is still not settled, possibly due to the lack of versatile mouse models. The aim of this study was to identify basic immunologic mechanisms in response to MAP infection. Immune compromised C57BL/6 Rag2-/- mice were infected with MAP intraperitoneally. Such chronically infected mice were then reconstituted with CD4+ and CD8+ T cells 28 days after infection. A systemic inflammatory response, detected as enlargement of the spleen and granuloma formation in the liver, was observed in mice infected and reconstituted with CD4+ T cells. Whereby inflammation in infected and CD4+CD45RB(hi T cell reconstituted animals was always higher than in the other groups. Reconstitution of infected animals with CD8+ T cells did not result in any inflammatory signs. Interestingly, various markers of inflammation were strongly up-regulated in the colon of infected mice reconstituted with CD4+CD45RB(lo/int T cells. We propose, the usual non-colitogenic CD4+CD45RB(lo/int T cells were converted into inflammatory T cells by the interaction with MAP. However, the power of such cells might be not sufficient for a fully established inflammatory response in the colon. Nevertheless, our model system appears to mirror aspects of an inflammatory bowel disease (IBD like CD and Johne's diseases. Thus, it will provide an experimental platform on which further knowledge on IBD and the involvement of MAP in the induction of CD could be acquired.

  15. [Effects of ruta SSP on the activity of the smooth gastrointestinal muscle isolated of rat].

    Science.gov (United States)

    Grigorjev, Carlota A; Brizuela, Nilda Y

    2010-01-01

    Ruta graveolens L. and Ruta chalepensis L. are plants used in folkloric medicine as antispasmodics, digestive and for intestinal gases. Animals used as experimental model were rats of the Wistar line, adult females, clinically healthy and with a weight average of 250 grams. We used strips of stomach and duodenum. Each one of the segments mounted on two stirrups in a bath of organ isolated with Ringer-lactate solution, at 37° C , pH: 7.3-7.4, and bubbled with 95% O2, 5% CO2. One of the stirrups was connected vertically to the bottom of the bath and the other to a transducer of tension connected to a Beckman polygraph. We applied 500 mgs of basal tension. After the stabilization, the ethanolic extract of Ruta ssp was added in increasing doses. At 50μl/ml the tone lower 23% in small intestine and lower 27% in stomach. However at 100 μl/ml the tone lower 32% and 35% respectively. In the other parameters the amplitude decrease 50% in the stomach at dose of 5 μl/ml while in the small intestine the amplitude lower 60%. With 10 μl/ml the amplitude change in both organs ( 96% in small intestine, and 75% in stomach). The frequency changes in both organs ( 32% in small intestine, and 50% in stomach) at 10 μl/ml Rue showed decreased effects on isolated small intestine and stomach were is dose dependent, maybe we were demonstrated the effects digestive of Ruta.

  16. Flowering time in wild beet ( Beta vulgaris ssp. maritima) along a latitudinal cline

    Science.gov (United States)

    Dijk, Henk Van; Boudry, Pierre; McCombre, Helen; Vernet, Philippe

    The wild beet ( Beta vulgaris ssp. maritima, a perennial species from the Mediterranean and the European Atlantic coasts) shows marked variation in flowering time in terms of both the year of first flowering and flowering date in a given year. Much of this variability is related to latitude. Beta vulgaris plants flower either in the same year as they germinate or in their second year. This is mainly due to differences in their requirement for vernalization, which is determined by a single gene B/b and by quantitative trait loci. The more southern the origin of the plants, the less vernalization is required. Also the B allele, which cancels vernalization requirement completely, has a high frequency in the Mediterranean region, but is completely absent in the northern part of the distribution of this species. We found that flowering date variation in relation to the latitude of origin is maintained under greenhouse conditions but does not follow a simple clinal relationship. From the Mediterranean northwards to the west coast of Brittany, flowering occurs progressively earlier, but from Brittany northwards to south-east England and The Netherlands it is progressively later. A possible explanation for this difference is that in the southern part of the range sensitivity to daylength and warmth control flowering time, whereas further north vernalization requirement is also a key factor. A substantial part of all differences in flowering time was heritable: heritability within populations was measured as 0.33 under greenhouse conditions. The high heritability implies evolutionary change may occur in this character.

  17. Khorasan wheat population researching (Triticum turgidum, ssp. Turanicum (McKey in the minimum tillage conditions

    Directory of Open Access Journals (Sweden)

    Ikanović Jela

    2014-01-01

    Full Text Available Khorasan wheat occupies a special place in the group of new-old cereals (Triticum turgidum, ssp. Turanicum McKey. It is an ancient species, native to eastern Persia, that is very close to durum wheat by morphological characteristics. Investigations were carried out in agro ecological conditions of the eastern Srem, with two wheat populations with dark and bright awns as objects of study. The following morphological and productive characteristics were investigated: plant height (PH, spike length (SH, number of spikelets per spike (NSS, absolute weight (AW and grain weight per spike (GW, seed germination (G and grains yield (YG. Field micro-experiments were set on the carbonate chernozem soil type on loess plateau in 2011 and 2012. Hand wheat sowing was conducted in early March with drill row spacing of 12 cm. The experiment was established as complete randomized block system with four replications. Tending crops measures were not applied during the growing season. Plants were grown without usage of NPK mineral nutrients. Chemical crop protection measures were not applied, although powdery mildew (Erysiphe graminis was appeared before plants spike formation in a small extent. The results showed that both populations have a genetic yield potential. In general, both populations manifested a satisfactory tolerance on lodging and there was no seed dispersal. Plants from bright awns population were higher, had longer spikes and larger number of spikelet’s per spike. However, plants from dark awns population had higher absolute weight and grains weight per spike, as well as grain yield per plant. Strong correlation connections were identified among the investigated characteristics. The determination of correlations, as well as direct and indirect affects, enabled easier understanding of the mutual relationships and their balancing in order to improve the yield per unit area. [Projekat Ministarstva nauke Republike Srbije, br. TR 31078 i br. TR 31022

  18. A draft sequence of the rice(Oryza sativa ssp. indica) genome

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The sequence of the rice genome holds fundamental information for its biology, including physiology, genetics, development, and evolution, as well as information on many beneficial phenotypes of economic significance. Using a "whole genome shotgun" approach, we have produced a draft rice genome sequence of Oryza sativa ssp. indica, the major crop rice subspecies in China and many other regions of Asia. The draft genome sequence is constructed from over 4.3 million successful sequencing traces with an accumulative total length of 2214.9 Mb. The initial assembly of the non-redundant sequences reached 409.76 Mb in length, based on 3.30 million successful sequencing traces with a total length of 1797.4 Mb from an indica variant cultivar 93-11, giving an estimated coverage of 95.29% of the rice genome with an average base accuracy of higher than 99%. The coverage of the draft sequence, the randomness of the sequence distribution, and the consistency of BIG-ASSEM- BLER, a custom-designed software package used for the initial assembly, were verified rigorously by comparisons against finished BAC clone sequences from both indica and japanica strains, available from the public databases. Over all, 96.3% of full-length cDNAs, 96.4% of STS, STR, RFLP markers, 94.0% of ESTs and 94.9% unigene clusters were identified from the draft sequence. Our preliminary analysis on the data set shows that our rice draft sequence is consistent with the comman standard accepted by the genome sequencing community. The unconditional release of the draft to the public also undoubtedly provides a fundamental resource to the international scientific communities to facilitate genomic and genetic studies on rice biology.

  19. Salmonella enterica ssp. arizonae infection in a 43-year-old Italian man with hypoglobulinemia: a case report and review of the literature

    Directory of Open Access Journals (Sweden)

    Noto Pasquale

    2011-07-01

    Full Text Available Abstract Introduction Salmonella enterica ssp. arizonae is an uncommon human pathogen with serious infections reported in immunocompromised hosts. In Europe, only a few cases have been described. Patients with this infection usually have a history of contact with reptiles or travel abroad. We present a case report of infection in a patient with hypoglobulinemia and a literature review. Case presentation We describe the case of a 43-year-old Caucasian Italian man with hypoglobulinemia who presented to our hospital with sepsis and diarrhea. A stool culture yielded S. enterica ssp. arizonae. Our patient was treated with oral ciprofloxacin and made a full recovery. We also present a review of the cases of S. enterica ssp. arizonae infections previously reported in Europe. Conclusions The majority of infections from S. enterica ssp. arizonae occur in patients who are immunocompromised. Data from the literature suggests that it may be difficult to eradicate the bacteria and thus, prolonged antibiotic courses are often used. It would be advisable for clinicians to investigate for pre-existing immune dysfunction if S. enterica ssp. arizonae is isolated. In Italy, although there have only been a few cases, the likely route of transmission remains unclear and requires further surveillance.

  20. The development-specific protein (Ssp1) from Sclerotinia sclerotiorum is encoded by a novel gene expressed exclusively in sclerotium tissues.

    Science.gov (United States)

    Li, Moyi; Rollins, Jeffrey A

    2009-01-01

    The gene encoding a development-specific protein (Ssp1) was identified; it previously was described as the major protein present in mature sclerotia of Sclerotinia sclerotiorum. To determine the developmental specificity of ssp1 gene expression in relation to protein accumulation we examined transcript and protein accumulation during various growth and development stages of the lifecycle. We found that ssp1 transcript accumulated exclusively within developing sclerotium tissue and not in any other examined stage of growth or development. In contrast high levels of Sspl protein were detectable by western blot and tandem mass spectrometry analyses in all stages of sclerotium as well as apothecium development. Immunolocalization further indicated that Ssp1 protein bodies were depleted from the sclerotium tissue surrounding the site of apothecium germination, but by this method Sspl was not detected in the apothecium. Together these findings suggest that Sspl is not metabolized during carpogenic germination, instead it is translocated from the sclerotium to the apothecium in an antigenically novel form. Outside the Sclerotiniaceae ssp1 homologs were found only from the sclerotium-forming Aspergillus species A. flavus and A. oryzae. Further studies concerning the regulation and function of this gene and its occurrence in other species have the potential to inform our understanding of sclerotium development and the evolution of sclerotia and other forms of fungal stroma. PMID:19271669

  1. The arabidopsis cyclic nucleotide interactome

    KAUST Repository

    Donaldson, Lara

    2016-05-11

    Background Cyclic nucleotides have been shown to play important signaling roles in many physiological processes in plants including photosynthesis and defence. Despite this, little is known about cyclic nucleotide-dependent signaling mechanisms in plants since the downstream target proteins remain unknown. This is largely due to the fact that bioinformatics searches fail to identify plant homologs of protein kinases and phosphodiesterases that are the main targets of cyclic nucleotides in animals. Methods An affinity purification technique was used to identify cyclic nucleotide binding proteins in Arabidopsis thaliana. The identified proteins were subjected to a computational analysis that included a sequence, transcriptional co-expression and functional annotation analysis in order to assess their potential role in plant cyclic nucleotide signaling. Results A total of twelve cyclic nucleotide binding proteins were identified experimentally including key enzymes in the Calvin cycle and photorespiration pathway. Importantly, eight of the twelve proteins were shown to contain putative cyclic nucleotide binding domains. Moreover, the identified proteins are post-translationally modified by nitric oxide, transcriptionally co-expressed and annotated to function in hydrogen peroxide signaling and the defence response. The activity of one of these proteins, GLYGOLATE OXIDASE 1, a photorespiratory enzyme that produces hydrogen peroxide in response to Pseudomonas, was shown to be repressed by a combination of cGMP and nitric oxide treatment. Conclusions We propose that the identified proteins function together as points of cross-talk between cyclic nucleotide, nitric oxide and reactive oxygen species signaling during the defence response.

  2. Recent Progress in Arabidopsis Research in China: A Preface

    Institute of Scientific and Technical Information of China (English)

    Zhi-Hong Xu

    2006-01-01

    @@ In 2002, a workshop on Arabidopsis research in China was held in Shanghai, when a small group of Chinese plant scientists was working on this model species. Since then, we have witnessed the rapid growth of Arabidopsis research in China. This special issue of Journal of Integrative Plant Biology is dedicated exclusively to the Fourth Workshop on Arabidopsis Research in China, scheduled on November 30, 2005, in Beijing. In addition to reports collected in this special issue, the Chinese Arabidopsis community has been able to make significant contributions to many research fields. Here, I briefly summarize recent advances in Arabidopsis research in China.

  3. Evaluation of the wood CCA preservative treatment process of Eucalyptus (Eucaliptus ssp) by X-ray fluorescence technique

    International Nuclear Information System (INIS)

    Brazil produces around 1,2 mi m3 of treated wood to meet the annual demand of railway, electric, rural and construction sectors. The treated woods used for poles, sleepers, fence posts and plywoods should be according to Brazilian norms requirements. The most used wood species are eucalyptus (Eucaliptus ssp)and pine (Pinus ssp). The most wood preservative products used in Brazil are CCA (Chromated Copper Arsenate) and CCB (Copper Chromium and Boron Salt). The analytical methods, such as Flame Atomic Absorption Spectrometry (FAAS) and Plasma Inductively Coupled Optical Emission Spectrometry (ICPOES) have been used for the evaluation of those treatment processes. In this work, the sapwood sample was obtained from eucalyptus trees (Eucaliptus ssp) obtained from Minas Gerais State, Brazil, cut plantation areas. Sawdust sapwood sample was grounded and submitted to different additions of CCA solutions (0.2, 0.7, 1.3, 2.3, 3.6, 6.3, 11.7and17.9 kg m-3). Power and pressed pellets sapwood samples, analyzed by EDXRFS, showed a good linear relation (r2>0.99) between the characteristic intensity fluorescent lines (CuΚα, CrΚαand AsΚΒ) and their concentration, also, showed adequate sensitivity (LQ -1) for Cu, Cr and As determination in treated woods. Cu, Cr and As were determined in powdered sawdust samples by FAA spectrometry, using the AWPA A11-93 standard method; the relation between the CCA retention and their concentration showed a lower linear relation than EDXRFS; the FAAS spreading result could be attributed to laboratorial CCA addition process. (author)

  4. Evaluation of the wood CCA preservative treatment process of Eucalyptus (Eucaliptus ssp) by X-ray fluorescence technique

    Energy Technology Data Exchange (ETDEWEB)

    Pereira Junior, Sergio Matias, E-mail: matias@ipt.br [Instituto de Pesquisas Tecnologicas (IPT), Sao Paulo, SP (Brazil); Salvador, Vera Lucia Ribeiro; Sato, Ivone Mulako, E-mail: imsato@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    Brazil produces around 1,2 mi m{sup 3} of treated wood to meet the annual demand of railway, electric, rural and construction sectors. The treated woods used for poles, sleepers, fence posts and plywoods should be according to Brazilian norms requirements. The most used wood species are eucalyptus (Eucaliptus ssp)and pine (Pinus ssp). The most wood preservative products used in Brazil are CCA (Chromated Copper Arsenate) and CCB (Copper Chromium and Boron Salt). The analytical methods, such as Flame Atomic Absorption Spectrometry (FAAS) and Plasma Inductively Coupled Optical Emission Spectrometry (ICPOES) have been used for the evaluation of those treatment processes. In this work, the sapwood sample was obtained from eucalyptus trees (Eucaliptus ssp) obtained from Minas Gerais State, Brazil, cut plantation areas. Sawdust sapwood sample was grounded and submitted to different additions of CCA solutions (0.2, 0.7, 1.3, 2.3, 3.6, 6.3, 11.7and17.9 kg m{sup -3}). Power and pressed pellets sapwood samples, analyzed by EDXRFS, showed a good linear relation (r{sup 2}>0.99) between the characteristic intensity fluorescent lines (CuΚα, CrΚαand AsΚΒ) and their concentration, also, showed adequate sensitivity (LQ < 5mgkg{sup -1}) for Cu, Cr and As determination in treated woods. Cu, Cr and As were determined in powdered sawdust samples by FAA spectrometry, using the AWPA A11-93 standard method; the relation between the CCA retention and their concentration showed a lower linear relation than EDXRFS; the FAAS spreading result could be attributed to laboratorial CCA addition process. (author)

  5. Aspectos ecológicos y distribución de Tropaeolum tuberosum ssp. silvestre (Tropaeolaceae) en Argentina

    OpenAIRE

    Eva Bulacio; Hugo Ayarde

    2012-01-01

    Tropaeolum tuberosum Ruiz et Pav. ssp. silvestre Sparre es una hierba rizomatosa trepadora que en Argentina fue encontrada en las Sierras de Calilegua (Jujuy) y en áreas montanas de Catamarca, aunque de esta última localidad sólo se conoce un único e incompleto ejemplar. Habita quebradas húmedas, entre los 2.100 y 2.650 m s.n.m., en el límite superior del bosque montano. El tallo es grácil de hasta 3 m de largo y la porción subterránea está constituida por rizomas alargados y de hasta 1 cm de...

  6. Analysis of expressed sequence tags from Musa acuminata ssp. burmannicoides, var. Calcutta 4 (AA) leaves submitted to temperature stresses

    OpenAIRE

    Santos, C R; Martins, N.F.; Horberg, H.M.; Almeida, E.R.P.; Coelho, M.C.F.; Togawa, R.; F. R. Silva; Caetano, A.R.; Miller, R.N.G.; de Souza, M T

    2005-01-01

    In order to discover genes expressed in leaves of Musa acuminata ssp. burmannicoides var. Calcutta 4 (AA), from plants submitted to temperature stress, we produced and characterized two full-length enriched cDNA libraries. Total RNA from plants subjected to temperatures ranging from 5°C to 25°C and from 25°C to 45°C was used to produce a COLD and a HOT cDNA library, respectively. We sequenced 1,440 clones from each library. Following quality analysis and vector trimming, we assembled 2,286 se...

  7. Gibberellins control fruit patterning in Arabidopsis thaliana.

    Science.gov (United States)

    Arnaud, Nicolas; Girin, Thomas; Sorefan, Karim; Fuentes, Sara; Wood, Thomas A; Lawrenson, Tom; Sablowski, Robert; Østergaard, Lars

    2010-10-01

    The Arabidopsis basic helix-loop-helix (bHLH) proteins INDEHISCENT (IND) and ALCATRAZ (ALC) specify tissues required for fruit opening that have major roles in seed dispersal and plant domestication. Here, we show that synthesis of the phytohormone gibberellin is a direct and necessary target of IND, and that ALC interacts directly with DELLA repressors, which antagonize ALC function but are destabilized by gibberellin. Thus, the gibberellin/DELLA pathway has a key role in patterning the Arabidopsis fruit, and the interaction between DELLA and bHLH proteins, previously shown to connect gibberellin and light responses, is a versatile regulatory module also used in tissue patterning. PMID:20889713

  8. SspA对生物材料细菌黏附及生物膜形成的影响%Influence of SspA on bacterial adherence and formation of bacterial biofilm to biomaterials

    Institute of Scientific and Technical Information of China (English)

    林兴; 黄云超; 杨达宽; 奚廷斐

    2005-01-01

    金黄色葡萄球菌(staphylococcus aureus,SA)是以生物材料为中心感染的主要致病菌之一,主要通过细菌黏附并形成生物膜造成感染,给患者带来灾难性的后果.SA的表面蛋白纤维连接蛋白结合蛋白(fibronectin-binding protein,FnBP)是其关键的黏附因子,而金黄色葡萄球菌丝氨酸蛋白酶(staphylococcal serine protease,SspA)可降低细菌的FnBP,抑制自溶素(autolysin,AtlE)分泌,降解表面A蛋白(surfaceproteinA,Spa)从而抑制细菌黏附和生物膜(bacterial biofilm,BF)的形成,为SspA在控制SA感染方面提供了一个重要的治疗途径.

  9. Effector MiSSP7 of the mutualistic fungus Laccaria bicolor stabilizes the Populus JAZ6 protein and represses jasmonic acid (JA) responsive genes.

    Science.gov (United States)

    Plett, Jonathan M; Daguerre, Yohann; Wittulsky, Sebastian; Vayssières, Alice; Deveau, Aurelie; Melton, Sarah J; Kohler, Annegret; Morrell-Falvey, Jennifer L; Brun, Annick; Veneault-Fourrey, Claire; Martin, Francis

    2014-06-01

    Ectomycorrhizal fungi, such as Laccaria bicolor, support forest growth and sustainability by providing growth-limiting nutrients to their plant host through a mutualistic symbiotic relationship with host roots. We have previously shown that the effector protein MiSSP7 (Mycorrhiza-induced Small Secreted Protein 7) encoded by L. bicolor is necessary for the establishment of symbiosis with host trees, although the mechanistic reasoning behind this role was unknown. We demonstrate here that MiSSP7 interacts with the host protein PtJAZ6, a negative regulator of jasmonic acid (JA)-induced gene regulation in Populus. As with other characterized JASMONATE ZIM-DOMAIN (JAZ) proteins, PtJAZ6 interacts with PtCOI1 in the presence of the JA mimic coronatine, and PtJAZ6 is degraded in plant tissues after JA treatment. The association between MiSSP7 and PtJAZ6 is able to protect PtJAZ6 from this JA-induced degradation. Furthermore, MiSSP7 is able to block--or mitigate--the impact of JA on L. bicolor colonization of host roots. We show that the loss of MiSSP7 production by L. bicolor can be complemented by transgenically varying the transcription of PtJAZ6 or through inhibition of JA-induced gene regulation. We conclude that L. bicolor, in contrast to arbuscular mycorrhizal fungi and biotrophic pathogens, promotes mutualism by blocking JA action through the interaction of MiSSP7 with PtJAZ6. PMID:24847068

  10. A new synonym of Hylodesmum podocarpum ssp.podocarpum (Leguminosae)%圆菱叶长柄山蚂蝗一新异名

    Institute of Scientific and Technical Information of China (English)

    高信芬

    2004-01-01

    Close examination of the type material of Podocarpium lancangense Y. Y. Qian has shown that this species is indistinguishable from Hylodesmum podocarpum (DC.) H. Ohashi & R. R. Mill ssp. Podocarpum, and thus is reduced to synonymy herein.%查阅了澜沧长柄山蚂蝗Hylodesmum lancangense (Y. Y. Qian) X. Y. Zhu & H. Ohashi的模式标本后,确认该种应归并入圆菱叶长柄山蚂蝗H. podocarpum (DC.) H. Ohashi & R. R. Mill ssp. podocarpum.

  11. Subsurface irrigation of potato crop (Solanum tuberosum ssp. Andigena) in Suka Kollus with different drainage systems

    Science.gov (United States)

    Serrano-Coronel, Genaro; Chipana-Rivera, René; Fátima Moreno-Pérez, María; Roldán-Cañas, José

    2016-04-01

    Among the most important hydraulic structures of pre-Hispanic ancestral technology developed in the Andean region, we find the suka kollus, aymara word, called also waru waru, en quechua or raised fields, in English. They are raised platforms surrounded by water canals that irrigate subsurface, but also have the function of draining, to deal with floods because they are surrounding Lake Titicaca. They also have the property of generating a thermoregulatory effect to crops, depending on the configuration of the channels and platforms. Such agro-ecosystems are being abandoned, however, if properly addressed crop management and some drainage canals are replaced by underground drains for increased crop area could be very useful in enabling marginal soils affected by salts and / or excess water. For these reasons, the objective of this study was to evaluate the subsurface irrigation in the potato crop in suka kollus under a system of surface drainage, and mixed drainage (surface and subsurface). The study was conducted in marginal soils of Kallutaca area, located 30 km from the city of La Paz, Bolivia, at a height of 3892 m.a.s.l. The cultivation of the potato (Solanum tuberosum ssp. Andigena) was used. Four treatments were tested with different widths of the platforms: T1 (Control) with drainage through channels; T2 (replacing a channel by a drain); T3 (replacing two channels by two drains); T4 (replacing three channels by three drains). The flow of water into the soil from the water table was predominantly upward, except during periods of high rainfall. In terms of treatments, the flow in T1 was higher, mainly at weeks 8 to 11 after seedling emergence, coinciding with the phenological phases of flowering and at the beginning of the tuber ripening. It was followed by T3, T2 and T4 treatments, respectively. Tuber yield, if one considers that the channels detract arable land, was higher in the T3 treatment,16.4 Mg / ha, followed by T2 treatment, 15.2 Mg / ha, T1

  12. Fertilization in Brassica campestris ssp.pekinensis and its duration of each stage

    Institute of Scientific and Technical Information of China (English)

    PENG Jie; SHEN Jiaheng

    2007-01-01

    This paper reports the process of fertilization in Brassica campestris ssp.pekinensis and the duration of each stage.The results are as follows:(1)Pollen germinates on stigma 2-3 h after pollination.(2)4-8 h after pollination,pollen tube grows in the style.(3)8-14 h after pollination,pollen tube grows in the ovary and gets into the ovule via the micropyle.(4)16 h after pollination,one sperm nucleus moves to the egg and enters it.(5)The sperm nucleus adheres to the nuclear membrane of the egg 18 h after pollination.(6)20 h after pollination,it enters the egg nucleus and male chromatin gradually disperses and 24 h after pollination,a male nucleolus appears.A large female nucleolus and a small male nucleolus occur in the nucleus of the fertilized egg,and zygote formed.The dispersing of sperm chromatin in the egg nucleus takes about 4 h.(7)32--34 h after pollination,the division of zygote begins.The dormancy stage of the zygote lasts for about 8-10 h.(8)The pair polar nuclei lie in the chalazal end of the egg betbre fertilization,which may fuse into a secondary nucleus or not.(9)16-18 h after pollination,the sperm nucleus moves to the polar nuclei or the secondary nucleus.18 h after pollination,the sperm nucleus adheres to the nuclear membrane of the polar nuclei or that of the secondary nucleus.(10)20 h after pollination,the sperm nucleus enters one of the polar nuclei or the secondary nucleus and a triple fusion takes place.The process of fusion is similar to the karyogamy but faster.The dispersing of the sperm chromatin in the polar nucleus or secondary nucleus takes about 2 h.(11)22 h after pollination,the primary endosperm nucleus formed.The female and male nucleoli cannot fuse with each other betbre mitotic division of the primary endosperm nucleus.(12)24 h after pollination,the division of the primary endosperm nucleus actually takes place.

  13. A SNP and SSR based genetic map of asparagus bean (Vigna. unguiculata ssp. sesquipedialis and comparison with the broader species.

    Directory of Open Access Journals (Sweden)

    Pei Xu

    Full Text Available Asparagus bean (Vigna. unguiculata ssp. sesquipedialis is a distinctive subspecies of cowpea [Vigna. unguiculata (L. Walp.] that apparently originated in East Asia and is characterized by extremely long and thin pods and an aggressive climbing growth habit. The crop is widely cultivated throughout Asia for the production of immature pods known as 'long beans' or 'asparagus beans'. While the genome of cowpea ssp. unguiculata has been characterized recently by high-density genetic mapping and partial sequencing, little is known about the genome of asparagus bean. We report here the first genetic map of asparagus bean based on SNP and SSR markers. The current map consists of 375 loci mapped onto 11 linkage groups (LGs, with 191 loci detected by SNP markers and 184 loci by SSR markers. The overall map length is 745 cM, with an average marker distance of 1.98 cM. There are four high marker-density blocks distributed on three LGs and three regions of segregation distortion (SDRs identified on two other LGs, two of which co-locate in chromosomal regions syntenic to SDRs in soybean. Synteny between asparagus bean and the model legume Lotus. japonica was also established. This work provides the basis for mapping and functional analysis of genes/QTLs of particular interest in asparagus bean, as well as for comparative genomics study of cowpea at the subspecies level.

  14. Application of a Simple In-House PCR-SSP Technique for HLA-B* 27 Typing in Spondyloarthritis Patients

    Directory of Open Access Journals (Sweden)

    Devraj J. Parasannanavar

    2013-01-01

    Full Text Available Background. Microlymphocytotoxicity (MLCT and flowcytometry (FC are the conventional serological methods to detect HLA-B* 27. Due to some disadvantages in these methods, most of the HLA laboratories have now switched over to molecular methods. Molecular techniques based on commercial kits are expensive; as such many laboratories with limited funds in developing countries cannot afford these techniques. Aims. Our main aim was to standardize a simple inexpensive in-house PCR-SSP technique for HLA-B* 27 typing. Materials and Methods. Sequence Specific primers were designed to amplify all the subtypes of B* 27 using IMGT-HLA sequence database. Accuracy was checked by retyping of 90 PCR-SSOP typed controls. Results. The presence of 149 bp specific band with control band on 2% agarose gel showed B* 27 positivity. No discrepancies were found when compared with PCR-SSOP results. The frequency of HLA-B* 27 was found to be significantly increased (68.75% versus 4.40%, O.R 46.909: P value 6.62E-32 among 700 SpA patients as compared to controls. Clinically, 54% of patients had polyarticular arthritis with SI joints involvement (68% and restricted spine flexion (60%. Conclusion. In-house PCR-SSP technique is very simple and inexpensive technique to detect B* 27 allele, which was strongly associated with SpA patients from Western India.

  15. USE OF METHYL JASMONATE TO ENHANCE THE PRODUCTION OF 6-METHOXYPODOPHYLLOTOXIN IN CELL CULTURES OF LINUM THRACICUM SSP. THRACICUM

    Directory of Open Access Journals (Sweden)

    Pavlina Sasheva

    2015-09-01

    Full Text Available Secondary metabolites, such as lignans have important ecological role for plants and at the same time are lead structures for drug design in human medicine. The aryltetralin type of lignans are strong cytotoxic agents and are found in members of the genus Linum (Linaceae.Objective: In vitro cultures of Linum thracicum ssp. thracicum were developed to identify a medium type and an elicitation technique that favor enhanced production of the aryltetralin lignan 6-methoxypodophyllotoxin.Method: Methyl jasmonate and salicylic acid were administered to four cell lines of Linum thracicum ssp. thracicum for 24 and 72 hours. The 6-methoxypodophyllotoxin was identified by HPLS-ESI-MS/MS in positive ion mode, and its production was determined via quantitative HPLC analysis.Results: A cell line, called Li-20, which was developed in reduced sucrose environment proved to be the fastest growing and the highest producing among the tested cell lines. Within 24 hours upon MJ elicitation, the eight-day-old Li-20 increased 2.3-fold in 6-methoxypodophyllotoxin content, reaching 4.3 mg on a dry weight basis. Negative or no effect was registered after salicylic acid application.Conclusion: MJ elicitation is an effective strategy to improve the 6-methoxypodophyllotoxin accumulation within short periods of time, and an optimization of the cultivation medium beforehand is a prerequisite in the pipeline.

  16. Arabidopsis CDS blastp result: AK073532 [KOME

    Lifescience Database Archive (English)

    Full Text Available ical to ARL2 G-protein (Halimasch; HAL; TITAN5) GI:20514265 from [Arabidopsis thaliana]; identical to cDNA A...AK073532 J033046D12 At2g18390.1 ADP-ribosylation factor-like protein 2 (ARL2) ident

  17. Arabidopsis CDS blastp result: AK061294 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061294 006-301-D01 At3g08900.1 reversibly glycosylated polypeptide-3 (RGP3) nearl...y identical to reversibly glycosylated polypeptide-3 [Arabidopsis thaliana] GI:11863238; contains non-consensus GA-donor splice site at intron 2 0.0 ...

  18. Protease gene families in Populus and Arabidopsis

    Directory of Open Access Journals (Sweden)

    Jansson Stefan

    2006-12-01

    Full Text Available Abstract Background Proteases play key roles in plants, maintaining strict protein quality control and degrading specific sets of proteins in response to diverse environmental and developmental stimuli. Similarities and differences between the proteases expressed in different species may give valuable insights into their physiological roles and evolution. Results We have performed a comparative analysis of protease genes in the two sequenced dicot genomes, Arabidopsis thaliana and Populus trichocarpa by using genes coding for proteases in the MEROPS database 1 for Arabidopsis to identify homologous sequences in Populus. A multigene-based phylogenetic analysis was performed. Most protease families were found to be larger in Populus than in Arabidopsis, reflecting recent genome duplication. Detailed studies on e.g. the DegP, Clp, FtsH, Lon, rhomboid and papain-Like protease families showed the pattern of gene family expansion and gene loss was complex. We finally show that different Populus tissues express unique suites of protease genes and that the mRNA levels of different classes of proteases change along a developmental gradient. Conclusion Recent gene family expansion and contractions have made the Arabidopsis and Populus complements of proteases different and this, together with expression patterns, gives indications about the roles of the individual gene products or groups of proteases.

  19. Arabidopsis CDS blastp result: AK066153 [KOME

    Lifescience Database Archive (English)

    Full Text Available pC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino... terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  20. Arabidopsis CDS blastp result: AK287906 [KOME

    Lifescience Database Archive (English)

    Full Text Available subunit / ClpC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF028...61: Clp amino terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  1. Arabidopsis CDS blastp result: AK100126 [KOME

    Lifescience Database Archive (English)

    Full Text Available pC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino... terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  2. Arabidopsis CDS blastp result: AK058510 [KOME

    Lifescience Database Archive (English)

    Full Text Available lpC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amin...o terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  3. Arabidopsis CDS blastp result: AK069552 [KOME

    Lifescience Database Archive (English)

    Full Text Available pC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino... terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  4. Arabidopsis CDS blastp result: AK062711 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062711 001-106-C02 At5g37770.1 touch-responsive protein / calmodulin-related protein 2, touch...-induced (TCH2) identical to calmodulin-related protein 2,touch-induced SP:P25070 from [Arabidopsis thaliana] 9e-34 ...

  5. Arabidopsis CDS blastp result: AK242428 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242428 J080089P09 At5g37770.1 68418.m04547 touch-responsive protein / calmodulin-related protein 2, touch...-induced (TCH2) identical to calmodulin-related protein 2,touch-induced SP:P25070 from [Arabidopsis thaliana] 9e-19 ...

  6. Arabidopsis CDS blastp result: AK242346 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242346 J080012M07 At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 3e-44 ...

  7. Arabidopsis CDS blastp result: AK242346 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242346 J080012M07 At5g37770.1 68418.m04547 touch-responsive protein / calmodulin-related protein 2, touch...-induced (TCH2) identical to calmodulin-related protein 2,touch-induced SP:P25070 from [Arabidopsis thaliana] 2e-11 ...

  8. Arabidopsis CDS blastp result: AK243656 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243656 J100088L22 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 1e-19 ...

  9. Arabidopsis CDS blastp result: AK242428 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242428 J080089P09 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 8e-18 ...

  10. Arabidopsis CDS blastp result: AK243656 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243656 J100088L22 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 2e-17 ...

  11. Arabidopsis CDS blastp result: AK288095 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288095 J075191E21 At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 2e-15 ...

  12. Arabidopsis CDS blastp result: AK108506 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108506 002-143-H11 At5g37770.1 touch-responsive protein / calmodulin-related protein 2, touch...-induced (TCH2) identical to calmodulin-related protein 2,touch-induced SP:P25070 from [Arabidopsis thaliana] 7e-14 ...

  13. Arabidopsis CDS blastp result: AK241786 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241786 J065207F05 At5g37770.1 68418.m04547 touch-responsive protein / calmodulin-related protein 2, touch...-induced (TCH2) identical to calmodulin-related protein 2,touch-induced SP:P25070 from [Arabidopsis thaliana] 1e-19 ...

  14. Arabidopsis CDS blastp result: AK242346 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242346 J080012M07 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 8e-44 ...

  15. Arabidopsis CDS blastp result: AK242346 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242346 J080012M07 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 3e-26 ...

  16. Arabidopsis CDS blastp result: AK242346 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242346 J080012M07 At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 3e-26 ...

  17. Arabidopsis CDS blastp result: AK242428 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242428 J080089P09 At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 3e-16 ...

  18. Arabidopsis CDS blastp result: AK071661 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK071661 J023105D07 At5g37770.1 touch-responsive protein / calmodulin-related protein 2, touch...-induced (TCH2) identical to calmodulin-related protein 2,touch-induced SP:P25070 from [Arabidopsis thaliana] 3e-33 ...

  19. Arabidopsis CDS blastp result: AK242428 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242428 J080089P09 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 2e-14 ...

  20. Arabidopsis CDS blastp result: AK242346 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242346 J080012M07 At5g37770.1 68418.m04547 touch-responsive protein / calmodulin-related protein 2, touch...-induced (TCH2) identical to calmodulin-related protein 2,touch-induced SP:P25070 from [Arabidopsis thaliana] 2e-25 ...

  1. Arabidopsis CDS blastp result: AK242346 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242346 J080012M07 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 4e-41 ...

  2. Arabidopsis CDS blastp result: AK288095 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288095 J075191E21 At2g41100.1 68415.m05076 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 2e-16 ...

  3. Arabidopsis CDS blastp result: AK243656 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243656 J100088L22 At2g41100.2 68415.m05077 touch-responsive protein / calmodulin-related protein 3, touch...-induced (TCH3) identical to calmodulin-related protein 3, touch-induced SP:P25071 from [Arabidopsis thaliana] 5e-20 ...

  4. Arabidopsis CDS blastp result: AK243230 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243230 J100044L04 At1g19850.1 68414.m02490 transcription factor MONOPTEROS (MP) /... auxin-responsive protein (IAA24) / auxin response factor 5 (ARF5) identical to transcription factor MONOPTEROS (MP/IAA24/ARF5) SP:P93024 from [Arabidopsis thaliana] 2e-65 ...

  5. Arabidopsis CDS blastp result: AK103452 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK103452 J033129I11 At1g19850.1 transcription factor MONOPTEROS (MP) / auxin-respon...sive protein (IAA24) / auxin response factor 5 (ARF5) identical to transcription factor MONOPTEROS (MP/IAA24/ARF5) SP:P93024 from [Arabidopsis thaliana] 1e-166 ...

  6. Arabidopsis CDS blastp result: AK318617 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK318617 J100090H20 At1g19850.1 68414.m02490 transcription factor MONOPTEROS (MP) /... auxin-responsive protein (IAA24) / auxin response factor 5 (ARF5) identical to transcription factor MONOPTEROS (MP/IAA24/ARF5) SP:P93024 from [Arabidopsis thaliana] 2e-63 ...

  7. Arabidopsis CDS blastp result: AK289177 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289177 J100024E07 At1g62360.1 68414.m07036 homeobox protein SHOOT MERISTEMLESS (S...TM) identical to homeobox protein SHOOT MERISTEMLESS (STM) SP:Q38874 from [Arabidopsis thaliana] 7e-29 ...

  8. Arabidopsis CDS blastp result: AK241312 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241312 J065141L09 At1g62360.1 68414.m07036 homeobox protein SHOOT MERISTEMLESS (S...TM) identical to homeobox protein SHOOT MERISTEMLESS (STM) SP:Q38874 from [Arabidopsis thaliana] 3e-40 ...

  9. Arabidopsis CDS blastp result: AK243352 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243352 J100060L07 At1g62360.1 68414.m07036 homeobox protein SHOOT MERISTEMLESS (S...TM) identical to homeobox protein SHOOT MERISTEMLESS (STM) SP:Q38874 from [Arabidopsis thaliana] 1e-28 ...

  10. Arabidopsis CDS blastp result: AK241438 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241438 J065162G03 At1g62360.1 68414.m07036 homeobox protein SHOOT MERISTEMLESS (S...TM) identical to homeobox protein SHOOT MERISTEMLESS (STM) SP:Q38874 from [Arabidopsis thaliana] 7e-29 ...

  11. Arabidopsis CDS blastp result: AK058585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058585 001-017-G01 At3g57040.1 two-component responsive regulator / response reactor... 4 (RR4) identical to responce reactor4 GI:3273202 from [Arabidopsis thaliana]; contains Pfam profile: PF00072 response regulator receiver domain 6e-55 ...

  12. Arabidopsis CDS blastp result: AK101721 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK101721 J033061A20 At3g57040.1 two-component responsive regulator / response reactor... 4 (RR4) identical to responce reactor4 GI:3273202 from [Arabidopsis thaliana]; contains Pfam profile: PF00072 response regulator receiver domain 9e-49 ...

  13. Arabidopsis CDS blastp result: AK241055 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241055 J065063N18 At3g58780.1 68416.m06551 agamous-like MADS box protein AGL1 / shatterproof... 1 (AGL1) (SHP1) identical to SP|P29381 Agamous-like MADS box protein AGL1 (Protein Shatterproof 1) {Arabidopsis thaliana} 1e-26 ...

  14. Arabidopsis CDS blastp result: AK241644 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241644 J065189M04 At3g58780.1 68416.m06551 agamous-like MADS box protein AGL1 / shatterproof... 1 (AGL1) (SHP1) identical to SP|P29381 Agamous-like MADS box protein AGL1 (Protein Shatterproof 1) {Arabidopsis thaliana} 3e-37 ...

  15. Arabidopsis CDS blastp result: AK242980 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242980 J090094F15 At3g58780.1 68416.m06551 agamous-like MADS box protein AGL1 / shatterproof... 1 (AGL1) (SHP1) identical to SP|P29381 Agamous-like MADS box protein AGL1 (Protein Shatterproof 1) {Arabidopsis thaliana} 2e-19 ...

  16. Arabidopsis CDS blastp result: AK243669 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243669 J100089N11 At3g58780.1 68416.m06551 agamous-like MADS box protein AGL1 / shatterproof... 1 (AGL1) (SHP1) identical to SP|P29381 Agamous-like MADS box protein AGL1 (Protein Shatterproof 1) {Arabidopsis thaliana} 6e-14 ...

  17. Arabidopsis CDS blastp result: AK242211 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242211 J075171C16 At3g58780.1 68416.m06551 agamous-like MADS box protein AGL1 / shatterproof... 1 (AGL1) (SHP1) identical to SP|P29381 Agamous-like MADS box protein AGL1 (Protein Shatterproof 1) {Arabidopsis thaliana} 5e-21 ...

  18. Arabidopsis CDS blastp result: AK121261 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121261 J023104H13 At1g55350.4 calpain-type cysteine protease family identical to calpain...-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family... cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 0.0 ...

  19. Shotgun Proteomic Analysis of Arabidopsis thaliana Leaves

    Science.gov (United States)

    Two shotgun tandem mass spectrometry proteomics approaches, Multidimensional Protein Identification Technology (MudPIT) and 1D-Gel-LC-MS/MS, were used to identify Arabidopsis thaliana leaf proteins. These methods utilize different protein/peptide separation strategies. Detergents not compatible wit...

  20. Arabidopsis CDS blastp result: AK241281 [KOME

    Lifescience Database Archive (English)

    Full Text Available ctor, putative / enhancer of shoot regeneration (ESR1) similar to gb|D38124 EREBP-3 from Nicotiana tabacum a...nd contains PF|00847 AP2 domain; identical to cDNA enhancer of shoot regeneration ESR1 GI:18028939, enhancer of shoot regeneration ESR1 [Arabidopsis thaliana] GI:18028940 1e-12 ...

  1. Arabidopsis CDS blastp result: AK242986 [KOME

    Lifescience Database Archive (English)

    Full Text Available ctor, putative / enhancer of shoot regeneration (ESR1) similar to gb|D38124 EREBP-3 from Nicotiana tabacum a...nd contains PF|00847 AP2 domain; identical to cDNA enhancer of shoot regeneration ESR1 GI:18028939, enhancer of shoot regeneration ESR1 [Arabidopsis thaliana] GI:18028940 1e-13 ...

  2. Arabidopsis CDS blastp result: AK241762 [KOME

    Lifescience Database Archive (English)

    Full Text Available ctor, putative / enhancer of shoot regeneration (ESR1) similar to gb|D38124 EREBP-3 from Nicotiana tabacum a...nd contains PF|00847 AP2 domain; identical to cDNA enhancer of shoot regeneration ESR1 GI:18028939, enhancer of shoot regeneration ESR1 [Arabidopsis thaliana] GI:18028940 9e-17 ...

  3. Arabidopsis CDS blastp result: AK242393 [KOME

    Lifescience Database Archive (English)

    Full Text Available ctor, putative / enhancer of shoot regeneration (ESR1) similar to gb|D38124 EREBP-3 from Nicotiana tabacum a...nd contains PF|00847 AP2 domain; identical to cDNA enhancer of shoot regeneration ESR1 GI:18028939, enhancer of shoot regeneration ESR1 [Arabidopsis thaliana] GI:18028940 3e-13 ...

  4. Arabidopsis CDS blastp result: AK242807 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242807 J090060H17 At5g37500.1 68418.m04516 guard cell outward rectifying K+ chann...el (GORK) identical to guard cell outward rectifying K+ channel [Arabidopsis thaliana] gi|11414742|emb|CAC17

  5. Arabidopsis CDS blastp result: AK243408 [KOME

    Lifescience Database Archive (English)

    Full Text Available subunit ClpX, putative similar to CLP protease regulatory subunit CLPX GI:2674203 from [Arabidopsis thaliana]; non-consensus... splice donor GC at exon 4; non-consensus splice donor AA at exon 7 1e-151 ...

  6. Arabidopsis CDS blastp result: AK242797 [KOME

    Lifescience Database Archive (English)

    Full Text Available subunit ClpX, putative similar to CLP protease regulatory subunit CLPX GI:2674203 from [Arabidopsis thaliana]; non-consensus... splice donor GC at exon 4; non-consensus splice donor AA at exon 7 2e-23 ...

  7. Arabidopsis CDS blastp result: AK243408 [KOME

    Lifescience Database Archive (English)

    Full Text Available subunit ClpX, putative similar to CLP protease regulatory subunit CLPX GI:2674203 from [Arabidopsis thaliana]; non-consensus... splice donor GC at exon 4; non-consensus splice donor AA at exon 7 2e-12 ...

  8. Arabidopsis CDS blastp result: AK243428 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243428 J100067L15 At5g14750.1 68418.m01731 myb family transcription factor (MYB66) / werewolf...iption factor (MYB66) mRNA, partial cds GI:3941491; identical to GP:9755743 myb transcription factor werewolf (WER)/ MYB66 {Arabidopsis thaliana} 8e-36 ...

  9. Arabidopsis CDS blastp result: AK288699 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288699 J090061C22 At5g14750.1 68418.m01731 myb family transcription factor (MYB66) / werewolf...iption factor (MYB66) mRNA, partial cds GI:3941491; identical to GP:9755743 myb transcription factor werewolf (WER)/ MYB66 {Arabidopsis thaliana} 8e-36 ...

  10. Arabidopsis CDS blastp result: AK243271 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243271 J100049K04 At5g14750.1 68418.m01731 myb family transcription factor (MYB66) / werewolf...iption factor (MYB66) mRNA, partial cds GI:3941491; identical to GP:9755743 myb transcription factor werewolf (WER)/ MYB66 {Arabidopsis thaliana} 4e-35 ...

  11. Arabidopsis CDS blastp result: AK241812 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241812 J065210K15 At5g14750.1 68418.m01731 myb family transcription factor (MYB66) / werewolf...iption factor (MYB66) mRNA, partial cds GI:3941491; identical to GP:9755743 myb transcription factor werewolf (WER)/ MYB66 {Arabidopsis thaliana} 1e-22 ...

  12. Arabidopsis CDS blastp result: AK241549 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241549 J065176M15 At5g14750.1 68418.m01731 myb family transcription factor (MYB66) / werewolf...iption factor (MYB66) mRNA, partial cds GI:3941491; identical to GP:9755743 myb transcription factor werewolf (WER)/ MYB66 {Arabidopsis thaliana} 3e-32 ...

  13. Arabidopsis CDS blastp result: AK241615 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241615 J065186D02 At5g14750.1 68418.m01731 myb family transcription factor (MYB66) / werewolf...iption factor (MYB66) mRNA, partial cds GI:3941491; identical to GP:9755743 myb transcription factor werewolf (WER)/ MYB66 {Arabidopsis thaliana} 8e-35 ...

  14. Arabidopsis CDS blastp result: AK288487 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288487 J090040H24 At5g14750.1 68418.m01731 myb family transcription factor (MYB66) / werewolf...iption factor (MYB66) mRNA, partial cds GI:3941491; identical to GP:9755743 myb transcription factor werewolf (WER)/ MYB66 {Arabidopsis thaliana} 5e-37 ...

  15. Arabidopsis CDS blastp result: AK287469 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287469 J043021L20 At5g14750.1 68418.m01731 myb family transcription factor (MYB66) / werewolf...iption factor (MYB66) mRNA, partial cds GI:3941491; identical to GP:9755743 myb transcription factor werewolf (WER)/ MYB66 {Arabidopsis thaliana} 2e-36 ...

  16. Arabidopsis CDS blastp result: AK241370 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241370 J065154C10 At5g14750.1 68418.m01731 myb family transcription factor (MYB66) / werewolf...iption factor (MYB66) mRNA, partial cds GI:3941491; identical to GP:9755743 myb transcription factor werewolf (WER)/ MYB66 {Arabidopsis thaliana} 2e-31 ...

  17. Arabidopsis CDS blastp result: AK288415 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288415 J090031E07 At5g14750.1 68418.m01731 myb family transcription factor (MYB66) / werewolf...iption factor (MYB66) mRNA, partial cds GI:3941491; identical to GP:9755743 myb transcription factor werewolf (WER)/ MYB66 {Arabidopsis thaliana} 3e-37 ...

  18. Arabidopsis CDS blastp result: AK240830 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240830 J065014C16 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retin...oblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  19. Arabidopsis CDS blastp result: AK121431 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121431 J023138G19 At3g12280.1 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma...-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  20. Arabidopsis CDS blastp result: AK064987 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK064987 J013001D03 At3g12280.1 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma...-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  1. Arabidopsis CDS blastp result: AK241627 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241627 J065187G05 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retin...oblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  2. Arabidopsis CDS blastp result: AK287689 [KOME

    Lifescience Database Archive (English)

    Full Text Available avonol 3-O-methyltransferase 1 / caffeic acid/5-hydroxyferulic acid O-methyltransferase (OMT1) identical to ...1.1.76) (AtOMT1) (Flavonol 3- O-methyltransferase 1) (Caffeic acid/5-hydroxyferulic acid O- methyltransferase) {Arabidopsis thaliana} 5e-23 ...

  3. Arabidopsis CDS blastp result: AK240736 [KOME

    Lifescience Database Archive (English)

    Full Text Available avonol 3-O-methyltransferase 1 / caffeic acid/5-hydroxyferulic acid O-methyltransferase (OMT1) identical to ...1.1.76) (AtOMT1) (Flavonol 3- O-methyltransferase 1) (Caffeic acid/5-hydroxyferulic acid O- methyltransferase) {Arabidopsis thaliana} 1e-22 ...

  4. Arabidopsis CDS blastp result: AK241705 [KOME

    Lifescience Database Archive (English)

    Full Text Available avonol 3-O-methyltransferase 1 / caffeic acid/5-hydroxyferulic acid O-methyltransferase (OMT1) identical to ...1.1.76) (AtOMT1) (Flavonol 3- O-methyltransferase 1) (Caffeic acid/5-hydroxyferulic acid O- methyltransferase) {Arabidopsis thaliana} 1e-11 ...

  5. Arabidopsis CDS blastp result: AK287483 [KOME

    Lifescience Database Archive (English)

    Full Text Available avonol 3-O-methyltransferase 1 / caffeic acid/5-hydroxyferulic acid O-methyltransferase (OMT1) identical to ...1.1.76) (AtOMT1) (Flavonol 3- O-methyltransferase 1) (Caffeic acid/5-hydroxyferulic acid O- methyltransferase) {Arabidopsis thaliana} 1e-37 ...

  6. Arabidopsis CDS blastp result: AK242290 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242290 J075191E07 At4g13870.2 68417.m02149 Werner Syndrome-like exonuclease (WEX)... contains Pfam profile PF01612: 3'-5' exonuclease; identical to Werner Syndrome-like exonuclease [Arabidopsis thaliana] GP:28195109 gb:AAO33765 1e-20 ...

  7. Arabidopsis CDS blastp result: AK063585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK063585 001-118-A04 At4g13870.2 Werner Syndrome-like exonuclease (WEX) contains Pf...am profile PF01612: 3'-5' exonuclease; identical to Werner Syndrome-like exonuclease [Arabidopsis thaliana] GP:28195109 gb:AAO33765 6e-16 ...

  8. Arabidopsis CDS blastp result: AK242290 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242290 J075191E07 At4g13870.1 68417.m02148 Werner Syndrome-like exonuclease (WEX)... contains Pfam profile PF01612: 3'-5' exonuclease; identical to Werner Syndrome-like exonuclease [Arabidopsis thaliana] GP:28195109 gb:AAO33765 1e-20 ...

  9. Arabidopsis CDS blastp result: AK072218 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072218 J013167O21 At1g55350.4 calpain-type cysteine protease family identical to calpain...-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family... cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 1e-150 ...

  10. Arabidopsis CDS blastp result: AK287576 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287576 J065037D19 At1g28300.1 68414.m03473 transcriptional factor B3 family protein / leaf...y cotyledon 2 (LEC2) nearly identical to LEAFY COTYLEDON 2 [Arabidopsis thaliana] GI:15987516; contains Pfam profile PF02362: B3 DNA binding domain 5e-13 ...

  11. Arabidopsis CDS blastp result: AK243493 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243493 J100074A10 At2g23380.1 68415.m02792 curly leaf protein (CURLY LEAF) / poly...comb-group protein identical to polycomb group [Arabidopsis thaliana] GI:1903019 (curly leaf); contains Pfam profile PF00856: SET domain 0.0 ...

  12. Arabidopsis CDS blastp result: AK111743 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111743 J023052J10 At2g23380.1 curly leaf protein (CURLY LEAF) / polycomb-group pr...otein identical to polycomb group [Arabidopsis thaliana] GI:1903019 (curly leaf); contains Pfam profile PF00856: SET domain 3e-22 ...

  13. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-130 ...

  14. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 2e-65 ...

  15. Arabidopsis CDS blastp result: AK110534 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK110534 002-168-A07 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-114 ...

  16. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 1e-24 ...

  17. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  18. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 2e-45 ...

  19. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 3e-66 ...

  20. Arabidopsis CDS blastp result: AK069071 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK069071 J023010H01 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-167 ...

  1. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-124 ...

  2. Arabidopsis CDS blastp result: AK060286 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060286 001-006-C08 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 6e-78 ...

  3. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 0.0 ...

  4. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 2e-29 ...

  5. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 5e-25 ...

  6. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-28 ...

  7. Arabidopsis CDS blastp result: AK105393 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105393 001-123-B04 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  8. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 8e-25 ...

  9. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 1e-126 ...

  10. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 8e-63 ...

  11. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 1e-125 ...

  12. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 0.0 ...

  13. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 2e-26 ...

  14. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 4e-47 ...

  15. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 4e-98 ...

  16. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 8e-98 ...

  17. Arabidopsis CDS blastp result: AK109812 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK109812 002-147-H02 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 5e-90 ...

  18. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 3e-31 ...

  19. Arabidopsis CDS blastp result: AK121003 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121003 J023045B21 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-167 ...

  20. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 5e-48 ...

  1. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-45 ...

  2. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 4e-27 ...

  3. Arabidopsis CDS blastp result: AK061162 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061162 006-209-A01 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 3e-35 ...

  4. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 4e-50 ...

  5. Arabidopsis CDS blastp result: AK119521 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119521 001-202-D09 At3g57050.2 cystathionine beta-lyase, chloroplast / beta-cystathionase...thionase) (Cysteine lyase) {Arabidopsis thaliana} 1e-173 ... ... / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cysta

  6. Arabidopsis CDS blastp result: AK108403 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108403 002-142-G06 At3g57050.2 cystathionine beta-lyase, chloroplast / beta-cystathionase...thionase) (Cysteine lyase) {Arabidopsis thaliana} 5e-36 ... ... / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cysta

  7. Arabidopsis CDS blastp result: AK241330 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241330 J065144B19 At3g29410.1 68416.m03695 terpene synthase/cyclase family protein similar to terpene... synthase GB:CAA72074 from [Arabidopsis thaliana], contains Pfam profile: PF01397 terpene synthase family 5e-64 ...

  8. Arabidopsis CDS blastp result: AK242212 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242212 J075171E13 At3g29410.1 68416.m03695 terpene synthase/cyclase family protein similar to terpene... synthase GB:CAA72074 from [Arabidopsis thaliana], contains Pfam profile: PF01397 terpene synthase family 1e-21 ...

  9. Arabidopsis CDS blastp result: AK241679 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241679 J065193F24 At3g29410.1 68416.m03695 terpene synthase/cyclase family protein similar to terpene... synthase GB:CAA72074 from [Arabidopsis thaliana], contains Pfam profile: PF01397 terpene synthase family 5e-65 ...

  10. Arabidopsis CDS blastp result: AK105299 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105299 001-116-H10 At1g72660.1 developmentally regulated GTP-binding protein, put...ative very strong similarity to developmentally regulated GTP binding protein (DRG1) [Arabidopsis thaliana] GI:2345150 0.0 ...

  11. Arabidopsis CDS blastp result: AK111540 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111540 J013037H01 At1g72660.1 developmentally regulated GTP-binding protein, puta...tive very strong similarity to developmentally regulated GTP binding protein (DRG1) [Arabidopsis thaliana] GI:2345150 0.0 ...

  12. Arabidopsis CDS blastp result: AK240892 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240892 J065030K10 At4g36920.1 68417.m05233 floral homeotic protein APETALA2 (AP2)... Identical to (SP:P47927) Floral homeotic protein APETALA2. [Mouse-ear cress] {Arabidopsis thaliana} 2e-41 ...

  13. Arabidopsis CDS blastp result: AK287726 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287726 J065138E17 At4g36920.1 68417.m05233 floral homeotic protein APETALA2 (AP2)... Identical to (SP:P47927) Floral homeotic protein APETALA2. [Mouse-ear cress] {Arabidopsis thaliana} 1e-41 ...

  14. Arabidopsis CDS blastp result: AK242211 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242211 J075171C16 At1g69120.1 68414.m07909 floral homeotic protein APETALA1 (AP1)... / agamous-like MADS box protein (AGL7) identical to SP|P35631 Floral homeotic protein APETALA1 (AGL7 protein) {Arabidopsis thaliana} 8e-22 ...

  15. Arabidopsis CDS blastp result: AK242387 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242387 J080051E14 At4g36920.1 68417.m05233 floral homeotic protein APETALA2 (AP2)... Identical to (SP:P47927) Floral homeotic protein APETALA2. [Mouse-ear cress] {Arabidopsis thaliana} 3e-27 ...

  16. Arabidopsis CDS blastp result: AK121171 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121171 J023081C04 At1g69120.1 floral homeotic protein APETALA1 (AP1) / agamous-li...ke MADS box protein (AGL7) identical to SP|P35631 Floral homeotic protein APETALA1 (AGL7 protein) {Arabidopsis thaliana} 3e-37 ...

  17. Arabidopsis CDS blastp result: AK242957 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242957 J090089I15 At4g36920.1 68417.m05233 floral homeotic protein APETALA2 (AP2)... Identical to (SP:P47927) Floral homeotic protein APETALA2. [Mouse-ear cress] {Arabidopsis thaliana} 3e-56 ...

  18. Arabidopsis CDS blastp result: AK241644 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241644 J065189M04 At1g69120.1 68414.m07909 floral homeotic protein APETALA1 (AP1)... / agamous-like MADS box protein (AGL7) identical to SP|P35631 Floral homeotic protein APETALA1 (AGL7 protein) {Arabidopsis thaliana} 3e-32 ...

  19. Arabidopsis CDS blastp result: AK241055 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241055 J065063N18 At1g69120.1 68414.m07909 floral homeotic protein APETALA1 (AP1)... / agamous-like MADS box protein (AGL7) identical to SP|P35631 Floral homeotic protein APETALA1 (AGL7 protein) {Arabidopsis thaliana} 3e-28 ...

  20. Arabidopsis CDS blastp result: AK069331 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK069331 J023019N01 At1g69120.1 floral homeotic protein APETALA1 (AP1) / agamous-li...ke MADS box protein (AGL7) identical to SP|P35631 Floral homeotic protein APETALA1 (AGL7 protein) {Arabidopsis thaliana} 2e-58 ...

  1. Arabidopsis CDS blastp result: AK241272 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241272 J065132I19 At4g36920.1 68417.m05233 floral homeotic protein APETALA2 (AP2)... Identical to (SP:P47927) Floral homeotic protein APETALA2. [Mouse-ear cress] {Arabidopsis thaliana} 2e-41 ...

  2. Arabidopsis CDS blastp result: AK242980 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242980 J090094F15 At1g69120.1 68414.m07909 floral homeotic protein APETALA1 (AP1)... / agamous-like MADS box protein (AGL7) identical to SP|P35631 Floral homeotic protein APETALA1 (AGL7 protein) {Arabidopsis thaliana} 2e-18 ...

  3. Arabidopsis CDS blastp result: AK243669 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243669 J100089N11 At1g69120.1 68414.m07909 floral homeotic protein APETALA1 (AP1)... / agamous-like MADS box protein (AGL7) identical to SP|P35631 Floral homeotic protein APETALA1 (AGL7 protein) {Arabidopsis thaliana} 3e-15 ...

  4. Arabidopsis CDS blastp result: AK287621 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287621 J065066I09 At4g36920.1 68417.m05233 floral homeotic protein APETALA2 (AP2)... Identical to (SP:P47927) Floral homeotic protein APETALA2. [Mouse-ear cress] {Arabidopsis thaliana} 6e-43 ...

  5. Arabidopsis CDS blastp result: AK105724 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105724 001-201-G07 At1g07110.1 fructose-6-phosphate 2-kinase / fructose-2,6-bisph...osphatase (F2KP) identical to fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase (F2KP) [Arabidopsis thaliana] GI:13096098 0.0 ...

  6. Arabidopsis CDS blastp result: AK072243 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072243 J023003N10 At1g07110.1 fructose-6-phosphate 2-kinase / fructose-2,6-bispho...sphatase (F2KP) identical to fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase (F2KP) [Arabidopsis thaliana] GI:13096098 0.0 ...

  7. Arabidopsis CDS blastp result: AK287911 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287911 J065213B08 At1g12110.1 68414.m01402 nitrate/chlorate transporter (NRT1.1) ...(CHL1) identical to nitrate/chlorate transporter SP:Q05085 from [Arabidopsis thaliana]; contains Pfam profile: PF00854 POT family 3e-85 ...

  8. Arabidopsis CDS blastp result: AK318551 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK318551 J075138M12 At1g12110.1 68414.m01402 nitrate/chlorate transporter (NRT1.1) ...(CHL1) identical to nitrate/chlorate transporter SP:Q05085 from [Arabidopsis thaliana]; contains Pfam profile: PF00854 POT family 4e-27 ...

  9. Arabidopsis CDS blastp result: AK241823 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241823 J065212G21 At1g12110.1 68414.m01402 nitrate/chlorate transporter (NRT1.1) ...(CHL1) identical to nitrate/chlorate transporter SP:Q05085 from [Arabidopsis thaliana]; contains Pfam profile: PF00854 POT family 1e-150 ...

  10. Arabidopsis CDS blastp result: AK243378 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243378 J100063A13 At1g12110.1 68414.m01402 nitrate/chlorate transporter (NRT1.1) ...(CHL1) identical to nitrate/chlorate transporter SP:Q05085 from [Arabidopsis thaliana]; contains Pfam profile: PF00854 POT family 5e-18 ...

  11. Arabidopsis CDS blastp result: AK288351 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288351 J090024C17 At1g12110.1 68414.m01402 nitrate/chlorate transporter (NRT1.1) ...(CHL1) identical to nitrate/chlorate transporter SP:Q05085 from [Arabidopsis thaliana]; contains Pfam profile: PF00854 POT family 2e-24 ...

  12. Arabidopsis CDS blastp result: AK242252 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242252 J075182G16 At1g12110.1 68414.m01402 nitrate/chlorate transporter (NRT1.1) ...(CHL1) identical to nitrate/chlorate transporter SP:Q05085 from [Arabidopsis thaliana]; contains Pfam profile: PF00854 POT family 6e-88 ...

  13. Arabidopsis CDS blastp result: AK243008 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243008 J090097H12 At5g48030.1 68418.m05935 DNAJ heat shock protein, mitochondrially targeted... (GFA2) 99.8% identical to mitochondrially targeted DnaJ protein GFA2 [Arabidopsis thaliana] GI:2

  14. Arabidopsis CDS blastp result: AK242849 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242849 J090072M15 At5g48030.1 68418.m05935 DNAJ heat shock protein, mitochondrially targeted... (GFA2) 99.8% identical to mitochondrially targeted DnaJ protein GFA2 [Arabidopsis thaliana] GI:2

  15. Arabidopsis CDS blastp result: AK243505 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243505 J100074N19 At5g48030.1 68418.m05935 DNAJ heat shock protein, mitochondrially targeted... (GFA2) 99.8% identical to mitochondrially targeted DnaJ protein GFA2 [Arabidopsis thaliana] GI:2

  16. Arabidopsis CDS blastp result: AK288959 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288959 J090084E19 At5g48030.1 68418.m05935 DNAJ heat shock protein, mitochondrially targeted... (GFA2) 99.8% identical to mitochondrially targeted DnaJ protein GFA2 [Arabidopsis thaliana] GI:2

  17. Arabidopsis CDS blastp result: AK287577 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287577 J065037N08 At5g48030.1 68418.m05935 DNAJ heat shock protein, mitochondrially targeted... (GFA2) 99.8% identical to mitochondrially targeted DnaJ protein GFA2 [Arabidopsis thaliana] GI:2

  18. Arabidopsis CDS blastp result: AK288072 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288072 J075161I05 At5g48030.1 68418.m05935 DNAJ heat shock protein, mitochondrially targeted... (GFA2) 99.8% identical to mitochondrially targeted DnaJ protein GFA2 [Arabidopsis thaliana] GI:2

  19. Arabidopsis CDS blastp result: AK065706 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065706 J013038P03 At5g48030.1 DNAJ heat shock protein, mitochondrially targeted (...GFA2) 99.8% identical to mitochondrially targeted DnaJ protein GFA2 [Arabidopsis thaliana] GI:21429604; cont

  20. Arabidopsis CDS blastp result: AK120746 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK120746 J023004K12 At5g48030.1 DNAJ heat shock protein, mitochondrially targeted (...GFA2) 99.8% identical to mitochondrially targeted DnaJ protein GFA2 [Arabidopsis thaliana] GI:21429604; cont

  1. Arabidopsis CDS blastp result: AK243178 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243178 J100036P15 At5g48030.1 68418.m05935 DNAJ heat shock protein, mitochondrially targeted... (GFA2) 99.8% identical to mitochondrially targeted DnaJ protein GFA2 [Arabidopsis thaliana] GI:2

  2. Arabidopsis CDS blastp result: AK058985 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058985 001-020-E06 At5g48030.1 DNAJ heat shock protein, mitochondrially targeted ...(GFA2) 99.8% identical to mitochondrially targeted DnaJ protein GFA2 [Arabidopsis thaliana] GI:21429604; con

  3. Arabidopsis CDS blastp result: AK103126 [KOME

    Lifescience Database Archive (English)

    Full Text Available 0S proteasome beta subunit PBB1 (PBB1) GB:AAC32066 [Arabidopsis thaliana] (Genetics 149 (2), 677-692 (1998)); contains Pfam profile: PF00227 proteasome A-type and B-type; 1e-129 ...

  4. Arabidopsis CDS blastp result: AK288349 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288349 J090023P19 At2g46590.1 68415.m05811 Dof zinc finger protein DAG2 / Dof affecting... germination 2 (DAG2) identical to SP|Q9ZPY0 DOF zinc finger protein DAG2 (Dof affecting germination 2) {Arabidopsis thaliana} 1e-23 ...

  5. Arabidopsis CDS blastp result: AK068893 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068893 J023001G24 At4g15090.1 far-red impaired response protein (FAR1) / far-red impaired... responsive protein (FAR1) identical to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282; contains Pfam:PF03101 domain: FAR1 family 1e-39 ...

  6. Arabidopsis CDS blastp result: AK241728 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241728 J065199H08 At1g50310.1 68414.m05640 monosaccharide transporter (STP9) iden...tical to monosaccharide transporter STP9 protein [Arabidopsis thaliana] GI:15487254; contains Pfam profile PF00083: major facilitator superfamily protein 3e-36 ...

  7. Arabidopsis CDS blastp result: AK240645 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240645 J023003B03 At1g50310.1 68414.m05640 monosaccharide transporter (STP9) iden...tical to monosaccharide transporter STP9 protein [Arabidopsis thaliana] GI:15487254; contains Pfam profile PF00083: major facilitator superfamily protein 1e-17 ...

  8. Arabidopsis CDS blastp result: AK243302 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243302 J100054J17 At1g50310.1 68414.m05640 monosaccharide transporter (STP9) iden...tical to monosaccharide transporter STP9 protein [Arabidopsis thaliana] GI:15487254; contains Pfam profile PF00083: major facilitator superfamily protein 4e-82 ...

  9. Arabidopsis CDS blastp result: AK241015 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241015 J065054A13 At1g50310.1 68414.m05640 monosaccharide transporter (STP9) iden...tical to monosaccharide transporter STP9 protein [Arabidopsis thaliana] GI:15487254; contains Pfam profile PF00083: major facilitator superfamily protein 8e-37 ...

  10. Arabidopsis CDS blastp result: AK288091 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288091 J075184D14 At1g50310.1 68414.m05640 monosaccharide transporter (STP9) iden...tical to monosaccharide transporter STP9 protein [Arabidopsis thaliana] GI:15487254; contains Pfam profile PF00083: major facilitator superfamily protein 4e-29 ...

  11. Arabidopsis CDS blastp result: AK241402 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241402 J065159A02 At4g19070.1 68417.m02810 cadmium-responsive protein / cadmium i...nduced protein (AS8) identical to cadmium induced protein AS8 SP:P42735 from [Arabidopsis thaliana] 3e-11 ...

  12. Arabidopsis CDS blastp result: AK110694 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK110694 002-170-A08 At5g59560.2 sensitivity to red light reduced protein (SRR1) id...entical to sensitivity to red light reduced protein [Arabidopsis thaliana] GI:25527089; supporting cDNA gi|25527088|gb|AY127047.1| 1e-18 ...

  13. Arabidopsis CDS blastp result: AK243061 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243061 J100014C18 At5g24520.2 68418.m02892 transparent testa glabra 1 protein (TTG1) identical to transpar...ent testa glabra 1 (Ttg1) protein (GI:10177852) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies,1 weak); 1e-102 ...

  14. Arabidopsis CDS blastp result: AK288081 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288081 J075172F18 At5g24520.3 68418.m02893 transparent testa glabra 1 protein (TTG1) identical to transpar...ent testa glabra 1 (Ttg1) protein (GI:10177852) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies,1 weak); 4e-13 ...

  15. Arabidopsis CDS blastp result: AK287566 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287566 J065027L04 At1g34790.1 68414.m04337 transparent testa 1 protein (TT1) / zi...nc finger (C2H2 type) protein TT1 identical to transparent testa 1 GI:18253279 from [Arabidopsis thaliana]; contains Pfam profile PF00096: Zinc finger, C2H2 type 2e-77 ...

  16. Arabidopsis CDS blastp result: AK288081 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288081 J075172F18 At5g24520.1 68418.m02891 transparent testa glabra 1 protein (TTG1) identical to transpar...ent testa glabra 1 (Ttg1) protein (GI:10177852) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies,1 weak); 4e-13 ...

  17. Arabidopsis CDS blastp result: AK289209 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289209 J100058I16 At1g34790.1 68414.m04337 transparent testa 1 protein (TT1) / zi...nc finger (C2H2 type) protein TT1 identical to transparent testa 1 GI:18253279 from [Arabidopsis thaliana]; contains Pfam profile PF00096: Zinc finger, C2H2 type 1e-12 ...

  18. Arabidopsis CDS blastp result: AK243061 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243061 J100014C18 At5g24520.1 68418.m02891 transparent testa glabra 1 protein (TTG1) identical to transpar...ent testa glabra 1 (Ttg1) protein (GI:10177852) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies,1 weak); 1e-102 ...

  19. Arabidopsis CDS blastp result: AK243061 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243061 J100014C18 At5g24520.3 68418.m02893 transparent testa glabra 1 protein (TTG1) identical to transpar...ent testa glabra 1 (Ttg1) protein (GI:10177852) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies,1 weak); 1e-102 ...

  20. Arabidopsis CDS blastp result: AK243285 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243285 J100051N01 At1g34790.1 68414.m04337 transparent testa 1 protein (TT1) / zi...nc finger (C2H2 type) protein TT1 identical to transparent testa 1 GI:18253279 from [Arabidopsis thaliana]; contains Pfam profile PF00096: Zinc finger, C2H2 type 1e-24 ...

  1. Arabidopsis CDS blastp result: AK288081 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288081 J075172F18 At5g24520.2 68418.m02892 transparent testa glabra 1 protein (TTG1) identical to transpar...ent testa glabra 1 (Ttg1) protein (GI:10177852) {Arabidopsis thaliana}; contains Pfam PF00400: WD domain, G-beta repeat (4 copies,1 weak); 4e-13 ...

  2. Arabidopsis CDS blastp result: AK100613 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100613 J023107M18 At4g10180.1 light-mediated development protein 1 / deetiolated1... (DET1) identical to Light-mediated development protein DET1 (Deetiolated1) (Swiss-Prot:P48732) [Arabidopsis thaliana] 0.0 ...

  3. Arabidopsis CDS blastp result: AK058683 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058683 001-019-A06 At4g10180.1 light-mediated development protein 1 / deetiolated...1 (DET1) identical to Light-mediated development protein DET1 (Deetiolated1) (Swiss-Prot:P48732) [Arabidopsis thaliana] 0.0 ...

  4. HYDROPONIC METHOD FOR CULTURING POPULATIONS OF ARABIDOPSIS

    Science.gov (United States)

    A plant life-cycle bioassay using Arabidopsis thaliana (L.) Heynh. was developed to detect potential chemical phytotoxicity. The bioassay requires large numbers of plants to maximize the probability of detecting deleterious effect and to avoid any bias that could occur if only a ...

  5. Arabidopsis CDS blastp result: AK240809 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240809 J065006K12 At4g17030.1 68417.m02569 expansin-related identical to SWISS-PROT:O23547 expansi...n-related protein 1 precursor (At-EXPR1)[Arabidopsis thaliana]; related to expansins, http://www.bio.psu.edu/expansins/ 2e-21 ...

  6. Arabidopsis CDS blastp result: AK107208 [KOME

    Lifescience Database Archive (English)

    Full Text Available Ala hydrolase, putative virtually identical to gr1-protein from [Arabidopsis thaliana] GI:3559811; similar t...AK107208 002-125-B11 At1g44350.1 IAA-amino acid hydrolase 6, putative (ILL6) / IAA-

  7. Arabidopsis CDS blastp result: AK059353 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059353 001-026-D01 At1g01170.1 ozone-responsive stress-related protein, putative ...similar to stress-related ozone-induced protein AtOZI1 (GI:790583) [Arabidopsis thaliana]; contains 1 predicted transmembrane domain; 2e-29 ...

  8. Arabidopsis CDS blastp result: AK066771 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066771 J013083K07 At1g01170.1 ozone-responsive stress-related protein, putative s...imilar to stress-related ozone-induced protein AtOZI1 (GI:790583) [Arabidopsis thaliana]; contains 1 predicted transmembrane domain; 2e-29 ...

  9. Arabidopsis CDS blastp result: AK059160 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059160 001-023-D05 At1g01170.1 ozone-responsive stress-related protein, putative ...similar to stress-related ozone-induced protein AtOZI1 (GI:790583) [Arabidopsis thaliana]; contains 1 predicted transmembrane domain; 3e-28 ...

  10. Arabidopsis CDS blastp result: AK242200 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242200 J075166M12 At3g20740.1 68416.m02624 fertilization-independent endosperm pr...otein (FIE) contains 6 WD-40 repeats (PF00400); identical to fertilization-independent endosperm protein (GI:4567095) [Arabidopsis thaliana] 1e-142 ...

  11. Arabidopsis CDS blastp result: AK111761 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111761 J023058F21 At3g20740.1 fertilization-independent endosperm protein (FIE) c...ontains 6 WD-40 repeats (PF00400); identical to fertilization-independent endosperm protein (GI:4567095) [Arabidopsis thaliana] 1e-158 ...

  12. Arabidopsis CDS blastp result: AK243221 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243221 J100043L21 At5g15410.2 68418.m01803 cyclic nucleotide-regulated ion channel / cyclic... nucleotide-gated channel (CNGC2) identical to cyclic nucleotide-gated cation channel GI:3894399 from [Arabidopsis thaliana] 5e-40 ...

  13. Arabidopsis CDS blastp result: AK288592 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288592 J090051B06 At5g15410.2 68418.m01803 cyclic nucleotide-regulated ion channel / cyclic... nucleotide-gated channel (CNGC2) identical to cyclic nucleotide-gated cation channel GI:3894399 from [Arabidopsis thaliana] 1e-145 ...

  14. Arabidopsis CDS blastp result: AK243602 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243602 J100084P18 At5g15410.2 68418.m01803 cyclic nucleotide-regulated ion channel / cyclic... nucleotide-gated channel (CNGC2) identical to cyclic nucleotide-gated cation channel GI:3894399 from [Arabidopsis thaliana] 2e-98 ...

  15. Arabidopsis CDS blastp result: AK241942 [KOME

    Lifescience Database Archive (English)

    Full Text Available protein similar to fasciclin-like arabinogalactan-protein 1 [Arabidopsis thaliana] gi|13377776|gb|AAK20857 9e-20 ... ...AK241942 J075088H12 At2g24450.1 68415.m02922 fasciclin-like arabinogalactan family

  16. Arabidopsis CDS blastp result: AK121828 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121828 J033099G20 At3g46550.1 fasciclin-like arabinogalactan family protein similar to fasciclin-like arab...inogalactan protein FLA8 [Arabidopsis thaliana] gi|10880493|gb|AAG24276 4e-87 ...

  17. Arabidopsis CDS blastp result: AK241942 [KOME

    Lifescience Database Archive (English)

    Full Text Available protein similar to fasciclin-like arabinogalactan-protein 1 [Arabidopsis thaliana] gi|13377776|gb|AAK20857; 3e-21 ... ...AK241942 J075088H12 At3g12660.1 68416.m01578 fasciclin-like arabinogalactan family

  18. Arabidopsis CDS blastp result: AK108772 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108772 002-150-H07 At3g12660.1 fasciclin-like arabinogalactan family protein similar to fasciclin-like ara...binogalactan-protein 1 [Arabidopsis thaliana] gi|13377776|gb|AAK20857; 1e-35 ...

  19. Arabidopsis CDS blastp result: AK241942 [KOME

    Lifescience Database Archive (English)

    Full Text Available protein similar to fasciclin-like arabinogalactan-protein 1 [Arabidopsis thaliana] gi|13377776|gb|AAK20857 2e-15 ... ...AK241942 J075088H12 At4g31370.1 68417.m04448 fasciclin-like arabinogalactan family

  20. Arabidopsis CDS blastp result: AK241942 [KOME

    Lifescience Database Archive (English)

    Full Text Available protein similar to fasciclin-like arabinogalactan protein FLA8 [Arabidopsis thaliana] gi|10880493|gb|AAG24276 1e-21 ... ...AK241942 J075088H12 At3g46550.1 68416.m05053 fasciclin-like arabinogalactan family

  1. Arabidopsis CDS blastp result: AK109762 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK109762 002-146-G11 At3g12660.1 fasciclin-like arabinogalactan family protein similar to fasciclin-like ara...binogalactan-protein 1 [Arabidopsis thaliana] gi|13377776|gb|AAK20857; 3e-24 ...

  2. Arabidopsis CDS blastp result: AK289211 [KOME

    Lifescience Database Archive (English)

    Full Text Available protein similar to fasciclin-like arabinogalactan protein FLA8 [Arabidopsis thaliana] gi|10880493|gb|AAG24276 4e-90 ... ...AK289211 J100060N06 At3g46550.1 68416.m05053 fasciclin-like arabinogalactan family

  3. Arabidopsis CDS blastp result: AK119375 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119375 001-132-A06 At3g46550.1 fasciclin-like arabinogalactan family protein similar to fasciclin-like ara...binogalactan protein FLA8 [Arabidopsis thaliana] gi|10880493|gb|AAG24276 2e-85 ...

  4. Arabidopsis CDS blastp result: AK241364 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241364 J065152E11 At2g46590.1 68415.m05811 Dof zinc finger protein DAG2 / Dof affecting germination... 2 (DAG2) identical to SP|Q9ZPY0 DOF zinc finger protein DAG2 (Dof affecting germination 2) {Arabidopsis thaliana} 2e-20 ...

  5. Arabidopsis CDS blastp result: AK287447 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287447 J043016O04 At2g46590.1 68415.m05811 Dof zinc finger protein DAG2 / Dof affecting germination... 2 (DAG2) identical to SP|Q9ZPY0 DOF zinc finger protein DAG2 (Dof affecting germination 2) {Arabidopsis thaliana} 2e-30 ...

  6. Arabidopsis CDS blastp result: AK241519 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241519 J065170E12 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 3e-23 ...

  7. Arabidopsis CDS blastp result: AK242651 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242651 J090026B08 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 1e-16 ...

  8. Arabidopsis CDS blastp result: AK243050 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243050 J100011E04 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 2e-24 ...

  9. Arabidopsis CDS blastp result: AK242271 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242271 J075187A19 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 4e-17 ...

  10. Arabidopsis CDS blastp result: AK240655 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240655 J023135E11 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 1e-40 ...

  11. Arabidopsis CDS blastp result: AK242638 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242638 J090023J02 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 1e-29 ...

  12. Arabidopsis CDS blastp result: AK242681 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242681 J090032N04 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 8e-38 ...

  13. Arabidopsis CDS blastp result: AK288923 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288923 J090081P06 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 1e-59 ...

  14. Arabidopsis CDS blastp result: AK243187 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243187 J100039E11 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 4e-24 ...

  15. Arabidopsis CDS blastp result: AK111785 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111785 J023089N11 At5g62310.1 incomplete root hair elongation (IRE) / protein kin...ase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 0.0 ...

  16. Arabidopsis CDS blastp result: AK288095 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288095 J075191E21 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 9e-31 ...

  17. Arabidopsis CDS blastp result: AK242859 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242859 J090073L24 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 2e-21 ...

  18. Arabidopsis CDS blastp result: AK242717 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242717 J090043H19 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 1e-23 ...

  19. Arabidopsis CDS blastp result: AK287631 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287631 J065073J24 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 2e-35 ...

  20. Arabidopsis CDS blastp result: AK242733 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242733 J090047O22 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 2e-24 ...

  1. Arabidopsis CDS blastp result: AK242758 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242758 J090051H03 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 1e-59 ...

  2. Arabidopsis CDS blastp result: AK243656 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243656 J100088L22 At5g62310.1 68418.m07822 incomplete root hair elongation (IRE) .../ protein kinase, putative nearly identical to IRE (incomplete root hair elongation) [Arabidopsis thaliana] gi|6729346|dbj|BAA89783 6e-29 ...

  3. Arabidopsis CDS blastp result: AK100867 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100867 J023124E13 At2g29640.1 josephin family protein contains Pfam domain PF02099: Jose...phin; similar to Josephin-like protein (Swiss-Prot:O82391) [Arabidopsis thaliana] 7e-59 ...

  4. Over-expression of an Arabidopsis δ-OAT gene enhances salt and drought tolerance in transgenic rice

    Institute of Scientific and Technical Information of China (English)

    WU Liangqi; FAN Zhanmin; GUO Lei; LI Yongqing; ZHANG Wenjing; QU Li-Jia; CHEN Zhangliang

    2003-01-01

    δ-OAT, ornithine-δ-aminotransferase, is the key enzyme involved in proline biosynthesis. In this study the Arabidopsisδ-OAT gene was transferred into rice (Oryza sativa L. ssp japonica cv. Zhongzuo 321), whose successful integration was demonstrated by PCR and Southern blot analysis. The over-expression of the gene in transgenic rice was also confirmed. Biochemical analysis showed that, under salt or drought stress conditions, proline contents in the leaves and roots in transgenic rice plants were 5- to 15-fold of those in non-transgenic controls. Under stress conditions, germinating rate of transgenic lines is higher than that of controls. Although the growth of rice plants tested were more and more retarded with the increasing of NaCl concentration, the transgenic plants grow faster compared to the controls under the same stress condition. Meanwhile, the resistance to KCl and MgSO4 stresses was also found enhanced in transgenic rice. Furthermore, the over-expression ofδ-OAT also improved the yield of transgenic plants under stress conditions. The average yield per plant of transgenic lines increases about 12%-41% more than that of control lines under 0.1 mol/L NaCl stress. These data indicated that the over-expression of δ-OAT, with the accumulation of proline, resulted in the enhancement of salt and drought tolerance and an increase of rice yield, which is of significance in agriculture.

  5. Identification of Yellow Pigmentation Genes in Brassica rapa ssp. pekinensis Using Br300 Microarray

    Directory of Open Access Journals (Sweden)

    Hee-Jeong Jung

    2014-01-01

    Full Text Available The yellow color of inner leaves in Chinese cabbage depends on its lutein and carotene content. To identify responsible genes for yellow pigmentation in leaves, the transcriptome profiles of white (Kenshin and yellow leaves (Wheessen were examined using the Br300K oligomeric chip in Chinese cabbage. In yellow leaves, genes involved in carotene synthesis (BrPSY, BrPDS, BrCRTISO, and BrLCYE, lutein, and zeaxanthin synthesis (BrCYP97A3 and BrHYDB were upregulated, while those associated with carotene degradation (BrNCED3, BrNCED4, and BrNCED6 were downregulated. These expression patterns might support that the content of both lutein and total carotenoid was much higher in the yellow leaves than that in the white leaves. These results indicate that the yellow leaves accumulate high levels of both lutein and β-carotene due to stimulation of synthesis and that the degradation rate is inhibited. A large number of responsible genes as novel genes were specifically expressed in yellow inner leaves, suggesting the possible involvement in pigment synthesis. Finally, we identified three transcription factors (BrA20/AN1-like, BrBIM1, and BrZFP8 that are specifically expressed and confirmed their relatedness in carotenoid synthesis from Arabidopsis plants.

  6. Different myrosinase and idioblast distribution in Arabidopsis and Brassica napus

    DEFF Research Database (Denmark)

    Andreasson, Erik; Jørgensen, Lise Bolt; Höglund, Anna-Stina;

    2001-01-01

    Arabidopsis, Brassica napus, Myrosinase, Myrosinase Binding Protein, Glucosinolates, Myrosin Cell, Immunocytochemistry......Arabidopsis, Brassica napus, Myrosinase, Myrosinase Binding Protein, Glucosinolates, Myrosin Cell, Immunocytochemistry...

  7. Within-population variability in morphology and life history of Plantago major L. ssp. pleiosperma Pilger in relation to environmental heterogeneity

    NARCIS (Netherlands)

    Lotz, L.A.P.; Olff, H.; Tienderen, P.H. van

    1990-01-01

    An attempt was made to relate variation in life-history characteristics within a population of Plantago major ssp. pleiosperma to small-scale environmental variability. At a beach plain, embanked in 1966, a mosaic environment was distinguished with spatial variability in vegetation structure as well

  8. CITOGENETICS EFFECTS INDUCED BY THE ADMINISTRATION OF SUBSTANCES WITH REDUCTION POTENTIAL AT LARIX DECIDUA MILL. SSP. CARPATICA, PICEA ABIES (L. KARST. AND THUJA ORIENTALIS L

    Directory of Open Access Journals (Sweden)

    Ioana Anca Ieremia

    2007-08-01

    Full Text Available The paper present the influence of ascorbic acid, riboflavin, citric acid and sodium bisulphit upon the mitotic division of Larix decidua Mill ssp. carpatica, Picea abies (L. Karst and Thuja orientalis L. The treatment was applied in one variant, germinated seeds in ascorbic acid, riboflavin, citric acid and sodium bisulphit in 3 concentrations.

  9. The possible involvement of Mycobacterium avium ssp. paratuberculosis in the aetiology of Crohn's disease: a case control study in the Netherlands

    NARCIS (Netherlands)

    Herrewegh AAPM; Overduin P; Roholl PJM; Gielis FK; Robinson JE; Mahmmod N; Lieverse RJ; Robijn RJ; Zanden AGM van der; Soolingen D van; Dept of Medical Microbiology; Biomedics Scientific Consultancy; LIS; LPI

    2005-01-01

    A case control study was performed to investigate the possible role of Mycobacterium avium ssp. paratuberculosis (Map) in the aetiology of Crohn's disease (CD). Biopsy samples were collected from the ileum and colon of CD patients, Ulcerative Colitis (UC) patients and control persons. The biopsy sam

  10. Is there evidence for a link between Crohn's disease and exposure to Mycobacterium avium ssp. paratuberculosis? A review of current literature

    NARCIS (Netherlands)

    Herrewegh A; Roholl P; Overduin P; van der Giessen J; van Soolingen D; LIS; TOX; MGB

    2005-01-01

    Mycobacterium avium ssp. paratuberculosis (Map) wordt door veel onderzoekers beschouwd als mogelijke verwekker van de ziekte van Crohn (morbus Crohn, MC) bij de mens. Dit is vooral gebaseerd op klinische en pathologische overeenkomsten tussen MC en de ziekte Paratuberculose bij runderen (herkauwer

  11. The possible involvement of Mycobacterium avium ssp. paratuberculosis in the aetiology of Crohn's disease: a case control study in the Netherlands

    NARCIS (Netherlands)

    Herrewegh AAPM; Overduin P; Roholl PJM; Gielis FK; Robinson JE; Mahmmod N; Lieverse RJ; Robijn RJ; van der Zanden AGM; van Soolingen D; LIS; LPI

    2005-01-01

    De bacterie Mycobacterium avium ssp. paratuberculosis (Map) wordt beschouwd als een mogelijke oorzaak van de ziekte van Crohn (morbus Crohn, MC). In samenwerking met Gelre ziekenhuizen heeft het RIVM een onderzoek uitgevoerd naar het voorkomen van Map in darmbiopten van patienten met MC, patienten

  12. Progeny of Eucalyptus globulus Labill ssp. Globulus%蓝桉子代测定

    Institute of Scientific and Technical Information of China (English)

    臧道群; 张川红; 罗军民; 黄永祥; 朱仁刚

    2003-01-01

    本文对云南省一平浪蓝桉实生种子园的子代测定林进行初期评价.该子代测定采用α-循环设计,21个重复,每个重复有18个不完全区组,每个区组分为15个小区,每小区2株树.全部270个家系均为自由授粉的半同胞家系,按来源分为3个类型(原产地天然林、云南地方品种和种子园),11个地区.调查和分析的数据包括造林后2年时的树高、胸径、冠幅、干形、抗寒性和存活率等性状.分析结果如下:1. 不同的类型在生长表现上存在显著差异,来自种子园的类型为最好.2. 自不同地区的蓝桉在各性状上都表现出显著差异.在生长表现上,来自维克多利亚东部、西部和各种子园的子代比其它地区的好.云南当地蓝桉子代的耐寒性和两年时的保存率为最好,在生长、干形和抗病方面与塔斯马尼亚东部和南部的蓝桉子代表现相似.采用两株小区,明显比单株小区降低小区缺失率,提高分析的可靠性.表3参7.%The preliminary assessment of progeny test in a seed orchard of Eucalyptus globulus Labill. ssp. globulus at Yipinglang State Farm of Yunnan Province in China was conducted. The trial was composed of 21 replications, with 2 trees on each plot, 15 plots in each incomplete block, and 18 incomplete blocks in each replication, laid out in a α- design of 270 open-pollinated families . The families were of three categories (natural populations, local land race and seed orchard). They were further subdivided into 11 regions. The data from an assessment of growth, stem form and other characteristics of the young trees after being planted 2 years were analyzed. Results are as follows: the different categories differed significantly in their growth, with the families from seed orchards being the best. Regions also differed significantly in their growth. The families from the regions of Western Victoria, Eastern Victoria and all three seed orchards were better than others. The

  13. Arabidopsis: an adequate model for dicot root systems?

    OpenAIRE

    Zobel, Richard W.

    2016-01-01

    The Arabidopsis root system is frequently considered to have only three classes of root: primary, lateral, and adventitious. Research with other plant species has suggested up to 8 different developmental/functional classes of root for a given plant root system. If Arabidopsis has only three classes of root, it may not be an adequate model for eudicot plant root systems. Recent research, however, can be interpreted to suggest that pre-flowering Arabidopsis does have at least five (5) of th...

  14. Arabidopsis: An Adequate Model for Dicot Root Systems?

    OpenAIRE

    Zobel, Richard W.

    2016-01-01

    The Arabidopsis root system is frequently considered to have only three classes of root: primary, lateral, and adventitious. Research with other plant species has suggested up to eight different developmental/functional classes of root for a given plant root system. If Arabidopsis has only three classes of root, it may not be an adequate model for eudicot plant root systems. Recent research, however, can be interpreted to suggest that pre-flowering Arabidopsis does have at least five (5) of t...

  15. Enhanced natural killer cell activation by exopolysaccharides derived from yogurt fermented with Lactobacillus delbrueckii ssp. bulgaricus OLL1073R-1.

    Science.gov (United States)

    Makino, Seiya; Sato, Asako; Goto, Ayako; Nakamura, Marie; Ogawa, Miho; Chiba, Yoshika; Hemmi, Jun; Kano, Hiroshi; Takeda, Kazuyoshi; Okumura, Ko; Asami, Yukio

    2016-02-01

    Yogurt is generally recognized as a beneficial food for our health, but research into its physiological effects has focused mainly on intestinal dysfunctions such as constipation and diarrhea. We previously found yogurt fermented with Lactobacillus delbrueckii ssp. bulgaricus OLL1073R-1 (hereafter OLL1073R-1) could reduce risks of catching the common cold and flu in human trials. It was assumed that immunostimulatory exopolysaccharide (EPS) produced from OLL1073R-1 play an important role in this context. However, few studies have examined the immunostimulatory effects of traditional Bulgarian yogurts fermented with different strains of lactobacilli and their metabolites. Therefore, we screened 139 L. delbrueckii ssp. bulgaricus strains and identified OLL1073R-1 as the most robust producer of EPS. This strain was also the only strain that induced the production of IFN-γ in vitro. Oral administration of the EPS or yogurt fermented with OLL1073R-1 and Streptococcus thermophilus OLS3059 (OLL1073R-1 yogurt) augmented natural killer (NK) cell activity and induced IFN-γ production in spleen cells in mice, whereas 2 other yogurts fermented with other strains had no effect on NK cell activity. Cellular preparations of the OLL1073R-1 strain also slightly augmented NK cell activity, but were less effective than EPS itself. The EPS-dependent stimulation of NK cell activity was abrogated in IFN-γ knockout mice and in myeloid differentiation factor 88 knockout mice. Furthermore, IFN-γ production from spleen cells stimulated with EPS was completely blocked with both anti-IL-12 and anti-IL-18 antibodies in vitro. These findings suggest that NK cell activation by OLL1073R-1 yogurt is EPS-dependent, occurs via IL-12- and IL-18-mediated IFN-γ production, and requires myeloid differentiation factor 88. We showed that traditional Bulgarian yogurt could exert immunostimulatory effects by selecting starter strains and part of the mechanisms depend on IFN-γ inducible EPS produced

  16. Primula munroi 的产自东喜马拉雅的一个新亚种 --P. munroi ssp. schizocalyx%A new subspecies of Primula munroi Lindl. from the Eastern Himalaya--P. munroi ssp. schizocalyx

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ In the course of revising the genus Primula Linn.(Primulaceae) in the Himalayas of Indian region, the authors came across a set of collections identified as P. involucrata Wall. gathered by the pioneer Himalayan travellers, merely written on determinavit slips as P. involucrata Wall. forma schizocalyx by I. B. Balfour without any date. Critical studies revealed that these specimens are quite distinct from the species proper so far described. The new taxon is described as a subspecies and illustrated. As P. involucrata Wall. ex Duby (1844) is a later homonym of P. involucrata Sweet (1839) and illegitimate, and its correct name is P. munroi Lindl. (1847), we name our new subspecies as P. munroi ssp. schizocalyx Balf. f. ex Basak et Maiti. 

  17. Pólen 2n e mecanismos meióticos de formação em Solanum commersonii ssp 2n pollen and meiotic mechanisms of Formation in Solanum commersonii ssp

    Directory of Open Access Journals (Sweden)

    Lívia Gracielle Oliveira Tomé

    2009-04-01

    Full Text Available Solanum commersonii subsp. commersonii Dun. e Solanum commersonii subsp. malmeanum Bitt. (2n=2x=24 - 1EBN não podem ser diretamente cruzadas com a batata cultivada de S. tuberosum subsp. tuberosum L. (2n=4x=48 -4 EBN em razão da barreira da ploidia e do número de equilíbrio do endosperma (EBN. No entanto, a produção de pólen não reduzido por S. commersonii ssp. (2x=2n=24 - 1EBN, permite o cruzamento desta com dihaplóides de batata e com as espécies diplóides S. phureja Juz. & Bukasov. e S. chacoense Bitt., que possuem 2 EBN. Conduziu-se este trabalho, com o objetivo de determinar o mecanismo meiótico e a freqüência dos grãos de pólen não reduzidos em cinco clones de Solanum commersonii ssp. Foram avaliados três clones de S. commersonii subsp. commersonii (SCC e dois de S. commersonii subsp. malmeanum (SCM. Nas avaliações, duzentos grãos de pólen viáveis foram corados (carmim acético 2% e mensurados, sendo considerados não reduzidos aqueles com o diâmetro igual ou superior a 25 µm. O clone Solanum commersonii subsp. commersonii Dun. (SCC 100 produz 26.1% de polen não reduzido, por fusos fundidos e fusos paralelos, o qual pode ser utilizado em programas de melhoramento.Solanum commersonii subsp. commersonii Dun. and Solanum commersonii subsp. malmeanum Bitt. (2n=2x=24 -1EBN cannot be directly crossed with the cultivated Solanum tuberosum subsp. Tuberosum L. (2n=4x=48 - 4EBN species due to ploidy barriers and endosperm balance number (EBN. However, non-reduced pollen production by the wild species S. commersonii ssp. (2x=2n=24 -1EBN, allows the crossing of these species with dihaploids of potato and with the diploids species, S. phureja Juz. & Bukasov. and S. chacoense Bitt., all with 2EBN. The aim of this work was to determine the meiotic mechanism and frequency of non-reduced pollen production of five clones of S. commersonii ssp. Three different clones of S. commersonii subsp. commersonii Dun. (SCC and two of S

  18. EVALUACIÓN DE UNA COLECCIÓN DEL GÉNERO Triticum: TRIGO HARINERO (Triticum aestivum ssp aestivum, TRIGO DURO (Triticum turgidum ssp. durum Y TRITICALE (X Triticum secale Wittmack EN LAS CONDICIONES DEL OCCIDENTE DE CUBA

    Directory of Open Access Journals (Sweden)

    R. Plana

    2006-01-01

    Full Text Available En el Instituto Nacional de Ciencias Agrícolas (INCA se evaluó una colección del género Triticum, con el objetivo de conocer el comportamiento de diferentes especies en las condiciones del occidente de Cuba. Las especies estudiadas fueron: Triticum aestivum ssp. aestivum, Triticum turgidum ssp. durum y X Triticum secale Wittmack. Se utilizó un diseño experimental de bloques al azar con cuatro repeticiones. Los caracteres analizados fueron altura de la planta (cm, longitud de las espigas (cm, masa de mil granos (g y rendimiento agrícola (t.ha-1. Se utilizó la estadística descriptiva para cada una de las variables estudiadas, estimándose la media y desviación típica por especie. La variedad cubana de trigo harinero CC-204 fue utilizada como control. La matriz de datos obtenida (genotipo x variable fue procesada mediante la técnica multivariada de Componentes Principales. Los datos para todos los análisis estadísticos se ejecutaron por el paquete estadístico SPSS 11. 0 para Windows. La mayoría de los genotipos tuvieron un comportamiento medio general, aunque se separaron del resto algunos genotipos de trigo harinero y triticale. Los valores de la media y desviación estándar para las variables analizadas muestran que no fue posible distinguir diferencias por especie, aunque las plantas de trigo duro fueron las de menor altura, siendo los mejores genotipos: 12 y 54 de la especie T. aestivum (trigo harinero; 17, 18 y 25 de T. durum (trigo duro; 29 y 37 del X Triticum secale (tritic

  19. Morphologlcal and anatomical structure of generative organs of Salsola kali ssp. ruthenica (lljin Soó at the SEM level

    Directory of Open Access Journals (Sweden)

    Krystyna Idzikowska

    2011-04-01

    Full Text Available The morphology and anatomy of generative organs of Salsola kali ssp. ruthenica was examined in detail using the light (LM and scanning electron microscopy (SEM. The whole flowers, fruits and their parts (pistil, stamens, sepals, embryo, seed were observed in different developmental stages. In the first stage (June, flower buds were closed. In the second stage (August, flowers were ready for pollination/fertilization. In the third stage (September, fruits were mature. Additionally, the anatomical and morphological structure of sepals was observed by means of LM and SEM. Thanks to the transverse and longitudinal semi-sections through sepals, the first phase of wing formation was recorded by SEM. The appearance of stomata in the epidermal cells of sepals above the forming wings was very interesting, too. The stomata were observed also in mature fruits.

  20. Kinetics of Batch Fermentation in the Cultivation of a Probiotic Strain Lactobacillus Delbrueckii Ssp. Bulgaricus B1

    Directory of Open Access Journals (Sweden)

    Goranov Bogdan

    2015-07-01

    Full Text Available A comparative study of kinetic models to describe the dynamics of the fermentation process of culturing of a probiotic strain Lactobacillus delbrueckii ssp. bulgaricus B1 was performed. The models of Monod, Aiba, Tiessier, Hinshelwood and the equation of the logistic curve combined with the model of Ludeking-Piret were used. It has been found that the different models described the observed fermentation dynamics differently. The conducted comparative study demonstrated that the models of Monod and the equation of the logistic curve combined with the model of Ludeking-Piret were suitable for the description of the fermentation dynamics. The mathematical models showed no significant product and/or substrate inhibition. The culture developed with a low specific growth rate, but nevertheless it accumulated 1012-1013 viable cells. The substrate was absorbed primarily from cells in the stationary growth phase rather than cells in the exponential growth phase