WorldWideScience

Sample records for arabidopsis lyrata ssp

  1. Comparative cDNA-AFLP analysis of Cd-tolerant and -sensitive genotypes derived from crosses between the Cd hyperaccumulator Arabidopsis halleri and Arabidopsis lyrata ssp. petraea.

    Science.gov (United States)

    Craciun, Adrian Radu; Courbot, Mikael; Bourgis, Fabienne; Salis, Pietrino; Saumitou-Laprade, Pierre; Verbruggen, Nathalie

    2006-01-01

    Cadmium (Cd) tolerance seems to be a constitutive species-level trait in Arabidopsis halleri. In order to identify genes potentially implicated in Cd tolerance, a backcross (BC1) segregating population was produced from crosses between A. halleri ssp. halleri and its closest non-tolerant relative A. lyrata ssp. petraea. The most sensitive and tolerant genotypes of the BC1 were analysed on a transcriptome-wide scale by cDNA-amplified fragment length polymorphism (AFLP). A hundred and thirty-four genes expressed more in the root of tolerant genotypes than in sensitive genotypes were identified. Most of the identified genes showed no regulation in their expression when exposed to Cd in a hydroponic culture medium and belonged to diverse functional classes, including reactive oxygen species (ROS) detoxification, cellular repair, metal sequestration, water transport, signal transduction, transcription regulation, and protein degradation, which are discussed. PMID:16916885

  2. Linkage disequilibrium between incompatibility locus region genes in the plant Arabidopsis lyrata

    DEFF Research Database (Denmark)

    Hagenblad, Jenny; Bechsgaard, Jesper Smærup; Charlesworth, Deborah

    2006-01-01

    We have studied diversity in Arabidopsis lyrata of sequences orthologous to the ARK3 gene of A. thaliana. Our main goal was to test for recombination in the S-locus region. In A. thaliana, the single-copy ARK3 gene is closely linked to the non-functional copies of the self-incompatibility loci, and...... the ortholog in A. lyrata (a self-incompatible species) is in the homologous genome region and is known as Aly8. It is thus of interest to test whether Aly8 sequence diversity is elevated due to close linkage to the highly polymorphic incompatibility locus, as is theoretically predicted. However, Aly8...... linked to the incompatibility locus, one being a pseudogene. We determined the phase of multiple haplotypes in families of plants from Icelandic and other populations. Different Aly8 sequence types are associated with different SRK alleles, while haplotypes with the same SRK sequences tend to have the...

  3. Transmission ratio distortion in Arabidopsis lyrata: effects of population divergence and the S-locus

    DEFF Research Database (Denmark)

    Leppälä, J; Bechsgaard, J S; Schierup, M H;

    2007-01-01

    We investigated transmission ratio distortion within an Icelandic population of Arabidopsis lyrata using 16 molecular markers unlinked to the S-locus. Transmission ratio distortion was found more often than expected by chance at the gametic level, but not at the genotypic or zygotic level. The...... distortion in the interpopulation cross is due to population divergence. It is also substantially lower than previously observed in intrapopulation crosses at the self-incompatibility locus, suggesting inherent fitness differences of the self-incompatibility alleles. We discuss the possible role of...

  4. Using Chloroplast trnF Pseudogenes for Phylogeography in Arabidopsis Lyrata

    Directory of Open Access Journals (Sweden)

    Andrew Tedder

    2010-04-01

    Full Text Available The chloroplast trnL-F region has been extensively utilized for evolutionary analysis in plants. In the Brassicaceae this fragment contains 1–12 tandemly repeated trnF pseudogene copies in addition to the functional trnF gene. Here we assessed the potential of these highly variable, but complexly evolving duplications, to resolve the population history of the model plant Arabidopsis lyrata. While the region 5’ of the duplications had negligible sequence diversity, extensive variation in pseudogene copy number and nucleotide composition revealed otherwise cryptic population structure in eastern North America. Thus structural changes can be phylogeographically informative when pseudogene evolutionary relationships can be resolved.

  5. Genomic analysis of differentiation between soil types reveals candidate genes for local adaptation in Arabidopsis lyrata.

    Directory of Open Access Journals (Sweden)

    Thomas L Turner

    Full Text Available Serpentine soil, which is naturally high in heavy metal content and has low calcium to magnesium ratios, comprises a difficult environment for most plants. An impressive number of species are endemic to serpentine, and a wide range of non-endemic plant taxa have been shown to be locally adapted to these soils. Locating genomic polymorphisms which are differentiated between serpentine and non-serpentine populations would provide candidate loci for serpentine adaptation. We have used the Arabidopsis thaliana tiling array, which has 2.85 million probes throughout the genome, to measure genetic differentiation between populations of Arabidopsis lyrata growing on granitic soils and those growing on serpentinic soils. The significant overrepresentation of genes involved in ion transport and other functions provides a starting point for investigating the molecular basis of adaptation to soil ion content, water retention, and other ecologically and economically important variables. One gene in particular, calcium-exchanger 7, appears to be an excellent candidate gene for adaptation to low CaratioMg ratio in A. lyrata.

  6. The Arabidopsis lyrata genome sequence and the basis of rapid genome size change

    Energy Technology Data Exchange (ETDEWEB)

    Hu, Tina T.; Pattyn, Pedro; Bakker, Erica G.; Cao, Jun; Cheng, Jan-Fang; Clark, Richard M.; Fahlgren, Noah; Fawcett, Jeffrey A.; Grimwood, Jane; Gundlach, Heidrun; Haberer, Georg; Hollister, Jesse D.; Ossowski, Stephan; Ottilar, Robert P.; Salamov, Asaf A.; Schneeberger, Korbinian; Spannagl, Manuel; Wang, Xi; Yang, Liang; Nasrallah, Mikhail E.; Bergelson, Joy; Carrington, James C.; Gaut, Brandon S.; Schmutz, Jeremy; Mayer, Klaus F. X.; Van de Peer, Yves; Grigoriev, Igor V.; Nordborg, Magnus; Weigel, Detlef; Guo, Ya-Long

    2011-04-29

    In our manuscript, we present a high-quality genome sequence of the Arabidopsis thaliana relative, Arabidopsis lyrata, produced by dideoxy sequencing. We have performed the usual types of genome analysis (gene annotation, dN/dS studies etc. etc.), but this is relegated to the Supporting Information. Instead, we focus on what was a major motivation for sequencing this genome, namely to understand how A. thaliana lost half its genome in a few million years and lived to tell the tale. The rather surprising conclusion is that there is not a single genomic feature that accounts for the reduced genome, but that every aspect centromeres, intergenic regions, transposable elements, gene family number is affected through hundreds of thousands of cuts. This strongly suggests that overall genome size in itself is what has been under selection, a suggestion that is strongly supported by our demonstration (using population genetics data from A. thaliana) that new deletions seem to be driven to fixation.

  7. Molecular evolutionary analysis of the Alfin-like protein family in Arabidopsis lyrata, Arabidopsis thaliana, and Thellungiella halophila.

    Directory of Open Access Journals (Sweden)

    Yu Song

    Full Text Available In previous studies, the Alfin1 gene, a transcription factor, enhanced salt tolerance in alfalfa, primarily through altering gene expression levels in the root. Here, we examined the molecular evolution of the Alfin-like (AL proteins in two Arabidopsis species (A. lyrata and A. thaliana and a salt-tolerant close relative Thellungiella halophila. These AL-like proteins could be divided into four groups and the two known DUF3594 and PHD-finger domains had co-evolved within each group of genes, irrespective of species, due to gene duplication events in the common ancestor of all three species while gene loss was observed only in T. halophila. To detect whether natural selection acted in the evolution of AL genes, we calculated synonymous substitution ratios (dn/ds and codon usage statistics, finding positive selection operated on four branches and significant differences in biased codon usage in the AL family between T. halophila and A. lyrata or A. thaliana. Distinctively, only the AL7 branch was under positive selection on the PHD-finger domain and the three members on the branch showed the smallest difference when codon bias was evaluated among the seven clusters. Functional analysis based on transgenic overexpression lines and T-DNA insertion mutants indicated that salt-stress-induced AtAL7 could play a negative role in salt tolerance of A. thaliana, suggesting that adaptive evolution occurred in the members of AL gene family.

  8. Validation of Pooled Whole-Genome Re-Sequencing in Arabidopsis lyrata.

    Directory of Open Access Journals (Sweden)

    Marco Fracassetti

    Full Text Available Sequencing pooled DNA of multiple individuals from a population instead of sequencing individuals separately has become popular due to its cost-effectiveness and simple wet-lab protocol, although some criticism of this approach remains. Here we validated a protocol for pooled whole-genome re-sequencing (Pool-seq of Arabidopsis lyrata libraries prepared with low amounts of DNA (1.6 ng per individual. The validation was based on comparing single nucleotide polymorphism (SNP frequencies obtained by pooling with those obtained by individual-based Genotyping By Sequencing (GBS. Furthermore, we investigated the effect of sample number, sequencing depth per individual and variant caller on population SNP frequency estimates. For Pool-seq data, we compared frequency estimates from two SNP callers, VarScan and Snape; the former employs a frequentist SNP calling approach while the latter uses a Bayesian approach. Results revealed concordance correlation coefficients well above 0.8, confirming that Pool-seq is a valid method for acquiring population-level SNP frequency data. Higher accuracy was achieved by pooling more samples (25 compared to 14 and working with higher sequencing depth (4.1× per individual compared to 1.4× per individual, which increased the concordance correlation coefficient to 0.955. The Bayesian-based SNP caller produced somewhat higher concordance correlation coefficients, particularly at low sequencing depth. We recommend pooling at least 25 individuals combined with sequencing at a depth of 100× to produce satisfactory frequency estimates for common SNPs (minor allele frequency above 0.05.

  9. Evidence of various mechanisms of Cd sequestration in the hyperaccumulator Arabidopsis halleri, the non-accumulator Arabidopsis lyrata, and their progenies by combined synchrotron-based techniques.

    Science.gov (United States)

    Isaure, Marie-Pierre; Huguet, Stéphanie; Meyer, Claire-Lise; Castillo-Michel, Hiram; Testemale, Denis; Vantelon, Delphine; Saumitou-Laprade, Pierre; Verbruggen, Nathalie; Sarret, Géraldine

    2015-06-01

    Arabidopsis halleri is a model plant for Zn and Cd hyperaccumulation. The objective of this study was to determine the relationship between the chemical forms of Cd, its distribution in leaves, and Cd accumulation and tolerance. An interspecific cross was carried out between A. halleri and the non-tolerant and non-hyperaccumulating relative A. lyrata providing progenies segregating for Cd tolerance and accumulation. Cd speciation and distribution were investigated using X-ray absorption spectroscopy and microfocused X-ray fluorescence. In A. lyrata and non-tolerant progenies, Cd was coordinated by S atoms only or with a small contribution of O groups. Interestingly, the proportion of O ligands increased in A. halleri and tolerant progenies, and they were predominant in most of them, while S ligands were still present. Therefore, the binding of Cd with O ligands was associated with Cd tolerance. In A. halleri, Cd was mainly located in the xylem, phloem, and mesophyll tissue, suggesting a reallocation process for Cd within the plant. The distribution of the metal at the cell level was further discussed. In A. lyrata, the vascular bundles were also Cd enriched, but the epidermis was richer in Cd as compared with the mesophyll. Cd was identified in trichomes of both species. This work demonstrated that both Cd speciation and localization were related to the tolerance character of the plant. PMID:25873676

  10. The evolutionary history of the Arabidopsis lyrata complex: a hybrid in the amphi-Beringian area closes a large distribution gap and builds up a genetic barrier

    Directory of Open Access Journals (Sweden)

    Koch Marcus A

    2010-04-01

    Full Text Available Abstract Background The genomes of higher plants are, on the majority, polyploid, and hybridisation is more frequent in plants than in animals. Both polyploidisation and hybridisation contribute to increased variability within species, and may transfer adaptations between species in a changing environment. Studying these aspects of evolution within a diversified species complex could help to clarify overall spatial and temporal patterns of plant speciation. The Arabidopsis lyrata complex, which is closely related to the model plant Arabidopsis thaliana, is a perennial, outcrossing, herbaceous species complex with a circumpolar distribution in the Northern Hemisphere as well as a disjunct Central European distribution in relictual habitats. This species complex comprises three species and four subspecies, mainly diploids but also several tetraploids, including one natural hybrid. The complex is ecologically, but not fully geographically, separated from members of the closely related species complex of Arabidopsis halleri, and the evolutionary histories of both species compexes have largely been influenced by Pleistocene climate oscillations. Results Using DNA sequence data from the nuclear encoded cytosolic phosphoglucoisomerase and Internal Transcribed Spacers 1 and 2 of the ribosomal DNA, as well as the trnL/F region from the chloroplast genome, we unravelled the phylogeography of the various taxonomic units of the A. lyrata complex. We demonstrate the existence of two major gene pools in Central Europe and Northern America. These two major gene pools are constructed from different taxonomic units. We also confirmed that A. kamchatica is the allotetraploid hybrid between A. lyrata and A. halleri, occupying the amphi-Beringian area in Eastern Asia and Northern America. This species closes the large distribution gap of the various other A. lyrata segregates. Furthermore, we revealed a threefold independent allopolyploid origin of this hybrid

  11. Zinc distribution and speciation in Arabidopsis halleri x Arabidops is lyrata progenies presenting various zinc accumulation capacities

    Energy Technology Data Exchange (ETDEWEB)

    Sarret, Geraldine; Willems, Glenda; Isaure, Marie-Pierre; Marcus, Matthew A.; Fakra, Sirine C.; Frerot, Helene; Pairis, Sebastien; Geoffroy, Nicolas; Manceau, Alain; Saumitou-Laprade, Pierre

    2010-04-08

    - The purpose of this study was to investigate the relationship between the chemical form and localization of zinc (Zn) in plant leaves and their Zn accumulationcapacity. - An interspecific cross between Arabidopsis halleri sp. halleri and Arabidopsis lyrata sp. petrea segregating for Zn accumulation was used. Zinc (Zn) speciation and Zn distribution in the leaves of the parent plants and of selected F1 and F2 progenies were investigated by spectroscopic and microscopic techniques and chemical analyses. - A correlation was observed between the proportion of Zn being in octahedral coordination complexed to organic acids and free in solution (Zn?OAs + Znaq) and Zn content in the leaves. This pool varied between 40percent and 80percent of total leaf Zn depending on the plant studied. Elemental mapping of the leaves revealed different Zn partitioning between the veins and the leaf tissue. The vein : tissue fluorescence ratio was negatively correlated with Zn accumulation. - The higher proportion of Zn?OAs + Znaq and the depletion of the veins in the stronger accumulators are attributed to a higher xylem unloading and vacuolar sequestration in the leaf cells. Elemental distributions in the trichomes were also investigated, and results support the role of carboxyl and⁄ or hydroxyl groups as major Zn ligands in these cells.

  12. Applicability of Phytoextraction with Arabidopsis halleri ssp. gemmifera to Remediate Cd-contaminated Andisols

    Science.gov (United States)

    Kameyama, Koji; Tani, Shigeru; Sugawara, Reiko; Ishikawa, Yuichi

    The objective of this study was to investigate the applicability of phytoextraction with a Cd-hyperaccumulator plant (Arabidopsis halleri ssp. gemmifera) to remediate Cd-contaminated Andisols. Cd absorption potentials of this plant for Andisols were examined in pot experiments. Sequentially, phytoextraction durations for remediation of Cd-contaminated Andisols were calculated from the experimental data. The results were as follows: (1) Cd concentrations in the plant shoots ranged from 170-750 mgṡkg-1. (2) Cd absorption of the plant for Andisols with ALC (Autoclaved Lightweight aerated Concrete) was less than for Andisols without ALC. However, the plants absorbed the same amount of soil Cd extracted by 0.01 M HCl with or without ALC. (3) Calculations suggest that the applicability of phytoextraction with this plant is high for slightly contaminated Andisols. Therefore, phytoextraction with Arabidopsis halleri ssp. gemmifera may be a viable option for the remediation of Cd-contaminated Andisols.

  13. Forms of zinc accumulated in the hyperaccumulator Arabidopsis halleri

    OpenAIRE

    Sarret, Geraldine; Saumitou-Laprade, Pierre; Bert, Valerie; Proux, Olivier; Hazemann, Jean-Louis; Traverse, Agnes; Marcus, Matthew,; Manceau, Alain

    2002-01-01

    The chemical forms of zinc (Zn) in the Zn-tolerant and hyperaccumulator Arabidopsis halleri and in the non-tolerant and nonaccumulator Arabidopsis lyrata subsp. petraea were determined at the molecular level by combining chemical analyses, extended x-ray absorption spectroscopy (EXAFS), synchrotron-based x-ray microfluorescence, and micro--EXAFS. Plants weree grown in hydroponics with various Zn concentrations, and A. halleri specimens growing naturally in a contaminated site were also collec...

  14. Reproductive Cycle of Hard Clam, Meretrix lyrata Sowerby, 1851 (Bivalvia: Veneridae) from Sarawak, Malaysia

    OpenAIRE

    Hamli, Hadi; Idris, Mohd Hanafi; Rajaee, Amy Halimah; Kamal, Abu Hena Mustafa

    2015-01-01

    A study of the reproductive cycle of the hard clam, Meretrix lyrata, was documented based on histological observation and Gonad Index (GI). Samples were taken from estuarine waters of the Buntal River in Sarawak, Malaysia. The gonad of M. lyrata started to develop in September 2013. Gametogenesis continued to develop until the maturation and spawning stage from February to April 2014. The GI pattern for a one-year cycle showed a significant correlation with chlorophyll a. The corresponding GI...

  15. Protein (Viridiplantae): 297792861 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 81972:4104 hypothetical protein ARALYDRAFT_918544 Arabidopsis lyrata subsp. lyrata MGSFKLLVAFTLVVMMTISYDLFSGIGISARTVPPTCYESCNATFQNPECNKMCVGLAYKDGSCIYPPPEVDGLPPKRPYFPRCCCNPIILSPPSP ...

  16. Protein (Viridiplantae): 297819616 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 53 81972:1953 predicted protein Arabidopsis lyrata subsp. lyrata MMIMEEEDQNECNSVGSFYVKVNMEGVPIGRKIDLLSLNGYHDLITTLDYMFNASILYQNLLYYVSLRPKLMAIKNCENRAEEEEMCSEKSHVLTYADKEGDWMMVGDVPWE ...

  17. The Five AhMTP1 Zinc Transporters Undergo Different Evolutionary Fates towards Adaptive Evolution to Zinc Tolerance in Arabidopsis halleri

    OpenAIRE

    Shahzad, Zaigham; Gosti, Françoise; Frérot, Hélène; Lacombe, Eric; Roosens, Nancy; Saumitou-Laprade, Pierre; Berthomieu, Pierre

    2010-01-01

    Gene duplication is a major mechanism facilitating adaptation to changing environments. From recent genomic analyses, the acquisition of zinc hypertolerance and hyperaccumulation characters discriminating Arabidopsis halleri from its zinc sensitive/non-accumulator closest relatives Arabidopsis lyrata and Arabidopsis thaliana was proposed to rely on duplication of genes controlling zinc transport or zinc tolerance. Metal Tolerance Protein 1 (MTP1) is one of these genes. It encodes a Zn2+/H+ an...

  18. Centromere-targeted de novo integrations of an LTR retrotransposon of Arabidopsis lyrata

    OpenAIRE

    Tsukahara, Sayuri; Kawabe, Akira; Kobayashi, Akie; Ito, Tasuku; Aizu, Tomoyuki; Shin-I, Tadasu; Toyoda, Atsushi; Fujiyama, Asao; Tarutani, Yoshiaki; Kakutani, Tetsuji

    2012-01-01

    Transposons contribute to heterochromatin formation, cohesion, and chromosomal segregation. Centromeres in many eukaryotes—including vertebrates, insects, and plants—contain a high proportion of repeats and transposons, suggesting targeted integration of these transposons to centromeres. However, no transposons targeted to centromeres have been identified. In this study, Kakutani and colleagues demonstrate that a mobile LTR retrotransposon, Tal1, integrates almost exclusively into centromeres...

  19. Interspecific and interploidal gene flow in Central European Arabidopsis (Brassicaceae

    Directory of Open Access Journals (Sweden)

    Jørgensen Marte H

    2011-11-01

    Full Text Available Abstract Background Effects of polyploidisation on gene flow between natural populations are little known. Central European diploid and tetraploid populations of Arabidopsis arenosa and A. lyrata are here used to study interspecific and interploidal gene flow, using a combination of nuclear and plastid markers. Results Ploidal levels were confirmed by flow cytometry. Network analyses clearly separated diploids according to species. Tetraploids and diploids were highly intermingled within species, and some tetraploids intermingled with the other species, as well. Isolation with migration analyses suggested interspecific introgression from tetraploid A. arenosa to tetraploid A. lyrata and vice versa, and some interploidal gene flow, which was unidirectional from diploid to tetraploid in A. arenosa and bidirectional in A. lyrata. Conclusions Interspecific genetic isolation at diploid level combined with introgression at tetraploid level indicates that polyploidy may buffer against negative consequences of interspecific hybridisation. The role of introgression in polyploid systems may, however, differ between plant species, and even within the small genus Arabidopsis, we find very different evolutionary fates when it comes to introgression.

  20. Transposed genes in Arabidopsis are often associated with flanking repeats.

    Directory of Open Access Journals (Sweden)

    Margaret R Woodhouse

    2010-05-01

    Full Text Available Much of the eukaryotic genome is known to be mobile, largely due to the movement of transposons and other parasitic elements. Recent work in plants and Drosophila suggests that mobility is also a feature of many nontransposon genes and gene families. Indeed, analysis of the Arabidopsis genome suggested that as many as half of all genes had moved to unlinked positions since Arabidopsis diverged from papaya roughly 72 million years ago, and that these mobile genes tend to fall into distinct gene families. However, the mechanism by which single gene transposition occurred was not deduced. By comparing two closely related species, Arabidopsis thaliana and Arabidopsis lyrata, we sought to determine the nature of gene transposition in Arabidopsis. We found that certain categories of genes are much more likely to have transposed than others, and that many of these transposed genes are flanked by direct repeat sequence that was homologous to sequence within the orthologous target site in A. lyrata and which was predominantly genic in identity. We suggest that intrachromosomal recombination between tandemly duplicated sequences, and subsequent insertion of the circular product, is the predominant mechanism of gene transposition.

  1. Protein (Viridiplantae): 297825487 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 273 81972:1273 hypothetical protein ARALYDRAFT_901062 Arabidopsis lyrata subsp. lyrata MAKPAKGKNKSLLDCSPLLEELPQSPDC...RNRGNPEANPRKCNMAKPAKDKNKSLLDCSPLLEELPQSPDCRNRGNPEANPRKCNMAKPAKDKNKSLLDCSPLLEELPQSPDC

  2. Protein (Viridiplantae): 297835204 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 21 predicted protein Arabidopsis lyrata subsp. lyrata MSSEKEEKESSKNPTTPPIAVPPTATPPIAKPPVATPPTTKPPVATPPVATPPIATPPITKPPVTTPPVATPP...IAKPPVATPPTATPPVATPPIAKPPVATPPIATPPIAKPPVVTPPIATPPIATPPIAIPPIATPPVSKPPVATPPVATPP...TAMPPVATPPIAKPPVVTPPVATPPIAKPPVATPPIATPPVSKPPVATPPVATPPTTMPPVATPPIAKPPVATPPVATPPIAKPPVATPPIATPPVSKPPVATPPVATPP...TIMPPVATPPIAKPPVATPPVATPPIAKPPIATPPVATPPIAKPPIATPPIAKPPIATPPVATPPIAKPPIATPPIAKPPTATPPTSIPPVATPPITTPPVATPPIATPP...VAKPPVATPPVASPPVAKPPIATPPIAKPPVATPPIAKPPVATPPVATPPVATPPISTPP

  3. Protein (Viridiplantae): 297796879 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available PVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLIHPQPESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIA...972:1201 UDP-glucuronic acid decarboxylase Arabidopsis lyrata subsp. lyrata MAATSEKQNSTKPPPSPSPLRNSKFCQSNMRILI...SGGAGFIGSHLVDKLMENEKNEVIVADNYFTGSKENLKKWIGHPRFELIRHDVTEPLLIEVDRIYHLACPASPIFYKYN...QALRGEALTVQKPGTQTRSFCYVSDMVDGLIRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPDISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNVPKN ...

  4. Protein (Viridiplantae): 297822109 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available GTKDWRVEKTNARLSGQLNEIVSKRAKEAETDSKDFLSLILKARESDPFAKKIFTPDYISAVTYEHLLAGSATTAFTLSSVLYLVSGHLEVEKRLLQEIDGFGGRNLIPTA...AKYGPDVFSVLAKQYGPIFRFQMGRQPLIIIAEAELCREVGIKKFKDLPNRSIPSPISASPLHKKGLFFTRDKRWSKMRNTILSLYQPSHLTSLIPT...:689 CYP711A1 Arabidopsis lyrata subsp. lyrata MKTQHLWWEVLDPLLIQHEALVAFLIFAVVVIVVYLYRPSWSVRNVPGPTAMPLVGHLPLM...MHNFITSATHNLDSKPRDIVFSNLFLKLTTDIIGQAAFGVNFGLSGKKPVKDVEVADFINQHVYSTTQLKMDLSGSLSIILGLLIPILQEPFRQVLKRIP...HDLQYKFPYLDQVIKEAMRFYMVSPLVARETAKEVEIGGYLLPKGTWVWLALGVLAKDPKNFPEPEKFRPERFDPNGEEEKLRHPYAFIP

  5. A Microarray Based Genomic Hybridization Method for Identification of New Genes in Plants: Case Analyses of Arabidopsis and Oryza

    Institute of Scientific and Technical Information of China (English)

    Chuanzhu Fan; Maria D. Vibranovski; Ying Chen; Manyuan Long

    2007-01-01

    To systematically estimate the gene duplication events in closely related species, we have to use comparative genomic approaches, either through genomic sequence comparison or comparative genomic hybridization (CGH). Given the scarcity of complete genomic sequences of plant species, in the present study we adopted an array based CGH to investigate gene duplications in the genus Arabidopsis. Fragment genomic DNA from four species, namely Arabidopsis thaliana, A. lyrata subsp. lyrata, A. lyrata subsp. petraea, and A. halleri, was hybridized to Affymetrix (Santa Clara, CA, USA) tiling arrays that are designed from the genomic sequences of A. thaliana. Pairwise comparisons of signal intensity were made to infer the potential duplicated candidates along each phylo-genetic branch. Ninety-four potential candidates of gene duplication along the genus were identified. Among them, the majority (69 of 94) were A. thaliana lineage specific. This result indicates that the array based CGH approach may be used to identify candidates of duplication in other plant genera containing closely related species, such as Oryza, particularly for the AA genome species. We compared the degree of gene duplication through retrotransposon between O. sativa and A. thaliana and found a strikingly higher number of chimera retroposed genes in rice. The higher rate of gene duplication through retroposition and other mechanisms may indicate that the grass species is able to adapt to more diverse environments.

  6. CATION EXCHANGER1 Cosegregates with Cadmium Tolerance in the Metal Hyperaccumulator Arabidopsis halleri and Plays a Role in Limiting Oxidative Stress in Arabidopsis Spp.

    Science.gov (United States)

    Baliardini, Cecilia; Meyer, Claire-Lise; Salis, Pietrino; Saumitou-Laprade, Pierre; Verbruggen, Nathalie

    2015-09-01

    Arabidopsis halleri is a model species for the study of plant adaptation to extreme metallic conditions. In this species, cadmium (Cd) tolerance seems to be constitutive, and the mechanisms underlying the trait are still poorly understood. A previous quantitative trait loci (QTL) analysis performed on A. halleri × Arabidopsis lyrata backcross population1 identified the metal-pump gene Heavy Metal ATPase4 as the major genetic determinant for Cd tolerance. However, although necessary, Heavy Metal ATPase4 alone is not sufficient for determining this trait. After fine mapping, a gene encoding a calcium(2+)/hydrogen(+) antiporter, cation/hydrogen(+) exchanger1 (CAX1), was identified as a candidate gene for the second QTL of Cd tolerance in A. halleri. Backcross population1 individuals displaying the A. halleri allele for the CAX1 locus exhibited significantly higher CAX1 expression levels compared with the ones with the A. lyrata allele, and a positive correlation between CAX1 expression and Cd tolerance was observed. Here, we show that this QTL is conditional and that it is only detectable at low external Ca concentration. CAX1 expression in both roots and shoots was higher in A. halleri than in the close Cd-sensitive relative species A. lyrata and Arabidopsis thaliana. Moreover, CAX1 loss of function in A. thaliana led to higher Cd sensitivity at low concentration of Ca, higher sensitivity to methylviologen, and stronger accumulation of reactive oxygen species after Cd treatment. Overall, this study identifies a unique genetic determinant of Cd tolerance in the metal hyperaccumulator A. halleri and offers a new twist for the function of CAX1 in plants. PMID:26162428

  7. CATION EXCHANGER1 Cosegregates with Cadmium Tolerance in the Metal Hyperaccumulator Arabidopsis halleri and Plays a Role in Limiting Oxidative Stress in Arabidopsis Spp.1[OPEN

    Science.gov (United States)

    Baliardini, Cecilia; Meyer, Claire-Lise; Salis, Pietrino; Saumitou-Laprade, Pierre; Verbruggen, Nathalie

    2015-01-01

    Arabidopsis halleri is a model species for the study of plant adaptation to extreme metallic conditions. In this species, cadmium (Cd) tolerance seems to be constitutive, and the mechanisms underlying the trait are still poorly understood. A previous quantitative trait loci (QTL) analysis performed on A. halleri × Arabidopsis lyrata backcross population1 identified the metal-pump gene Heavy Metal ATPase4 as the major genetic determinant for Cd tolerance. However, although necessary, Heavy Metal ATPase4 alone is not sufficient for determining this trait. After fine mapping, a gene encoding a calcium2+/hydrogen+ antiporter, cation/hydrogen+ exchanger1 (CAX1), was identified as a candidate gene for the second QTL of Cd tolerance in A. halleri. Backcross population1 individuals displaying the A. halleri allele for the CAX1 locus exhibited significantly higher CAX1 expression levels compared with the ones with the A. lyrata allele, and a positive correlation between CAX1 expression and Cd tolerance was observed. Here, we show that this QTL is conditional and that it is only detectable at low external Ca concentration. CAX1 expression in both roots and shoots was higher in A. halleri than in the close Cd-sensitive relative species A. lyrata and Arabidopsis thaliana. Moreover, CAX1 loss of function in A. thaliana led to higher Cd sensitivity at low concentration of Ca, higher sensitivity to methylviologen, and stronger accumulation of reactive oxygen species after Cd treatment. Overall, this study identifies a unique genetic determinant of Cd tolerance in the metal hyperaccumulator A. halleri and offers a new twist for the function of CAX1 in plants. PMID:26162428

  8. Comparison of in vitro antioxidant properties of extracts from three plants used for medical purpose in Cameroon:Acalypha racemosa, Garcinia lucida and Hymenocardia lyrata

    Institute of Scientific and Technical Information of China (English)

    Djacbou D Sylvie; Pieme Constant Anatole; Biapa Prosper Cabral; Penlap Beng Veronique

    2014-01-01

    Objective:To investigate the in vitro antiradical and antioxidant properties of methanol extracts of Garcinia lucida, Hymenocardia lyrata (H. lyrata) and Acalypha racemosa. Methods: We determined the in vitro antioxidant activity and the total phenolic content, and performed the phytochemical screening of the extracts from fruits, barks, leaves, roots and stems of these plants using standard procedures. Results:The results of the antioxidant properties showed that more than 60%of DPPH., NO. and HO. radicals were inhibited by the extracts. The radical scavenging activity, the total antioxidant capacity as well as the reducing power increased with the concentration of the extracts. The 50%inhibitory concentration (IC50) varied from 1.46 to 21.65 µg/mL depending of the type of extract and the antioxidant tests. The results indicated that all the extracts exhibited antioxidant properties and the roots of H. lyrata showed the best antioxidant activity [(217.17±9.45) mg Equivalent catechin/g of extract] while the highest total phenol content was found in its barks [(169.782±3.025) mg Eq cat/g of extract]. Conclusions:The methanol extract of H. lyrata possess the most antioxidant property among the three extracts.

  9. Forms of zinc accumulated in the hyperaccumulator Arabidopsis halleri.

    Science.gov (United States)

    Sarret, Géraldine; Saumitou-Laprade, Pierre; Bert, Valérie; Proux, Olivier; Hazemann, Jean-Louis; Traverse, Agnès; Marcus, Matthew A; Manceau, Alain

    2002-12-01

    The chemical forms of zinc (Zn) in the Zn-tolerant and hyperaccumulator Arabidopsis halleri and in the non-tolerant and nonaccumulator Arabidopsis lyrata subsp. petraea were determined at the molecular level by combining chemical analyses, extended x-ray absorption spectroscopy (EXAFS), synchrotron-based x-ray microfluorescence, and muEXAFS. Plants were grown in hydroponics with various Zn concentrations, and A. halleri specimens growing naturally in a contaminated site were also collected. Zn speciation in A. halleri was independent of the origin of the plants (contaminated or non-contaminated) and Zn exposure. In aerial parts, Zn was predominantly octahedrally coordinated and complexed to malate. A secondary organic species was identified in the bases of the trichomes, which contained elevated Zn concentrations, and in which Zn was tetrahedrally coordinated and complexed to carboxyl and/or hydroxyl functional groups. This species was detected thanks to the good resolution and sensitivity of synchrotron-based x-ray microfluorescence and muEXAFS. In the roots of A. halleri grown in hydroponics, Zn phosphate was the only species detected, and is believed to result from chemical precipitation on the root surface. In the roots of A. halleri grown on the contaminated soil, Zn was distributed in Zn malate, Zn citrate, and Zn phosphate. Zn phosphate was present in both the roots and aerial part of A. lyrata subsp. petraea. This study illustrates the complementarity of bulk and spatially resolved techniques, allowing the identification of: (a) the predominant chemical forms of the metal, and (b) the minor forms present in particular cells, both types of information being essential for a better understanding of the bioaccumulation processes. PMID:12481065

  10. Expression of GFP-mTalin reveals an actin-related role for the Arabidopsis Class II formin AtFH12

    OpenAIRE

    Cvrčková, F.; Grunt, M.; Žárský, V.

    2012-01-01

    Formins (FH2 proteins) are implicated in F-actin nucleation and other aspects of cytoskeletal organization. Plants possess two formin clades, relatively well-described Class I formins and so far poorly characterized Class II formins. Comparison of Class II formin genes of two Arabidopsis species, A. thaliana and A. lyrata, indicates dynamic evolution within the Class II formin clade. Disruption of an outlier A. thaliana Class II formin gene, AtFH12 (At1g42980), whose expression is induced by ...

  11. Protein (Viridiplantae): 297848026 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 01:9525 59689:9736 81972:9736 predicted protein Arabidopsis lyrata subsp. lyrata MVEKAKECWTMLQNWKSIHVLQRYQKQ...HFSSTSNKELSWATSNKEHKKADHFPVLHRRSFHHLRLSPPYNCVTRNLCKSCGPASISVIAFPSTVFMAYFTEASSSPFD

  12. Protein (Viridiplantae): 297845652 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available RSSLGPKGMDKMLQGPDGDITITNDGATILEQMDVDNQIAKLMVELSRSQDYEIGDGTTGVVVMAGALLEQAERQLDRGIHPIRIA...EGYEMASRVAVDHLERIAQKFEFDVNNFEPLVQTCMTTLSSKIVNRCKRSLAEIAVKAVLAVADLERRDVNLDLIKVEGKVGGKLEDTELIYGILI...DKDMSHPQMPKQIEDAHIAILTCPFEPPKPKTKHKVDIDTVEKFETLRKQEQQYFDEMVQKCKDVGATLVICQWGFDDEANHLLMHRNLPAVRWVGGVELELIAIATGGRI...VPRFQELTPEKLGKAGVVREKSFGTTKERMLYIEHCANSKAVTVFIRGGNKMMIEETKRSIHDALCVARNLIRNKSIVYGGGAAEIA...81972:883 hypothetical protein ARALYDRAFT_472896 Arabidopsis lyrata subsp. lyrata MALAFDEFGRPFIILREQDQKTRLRGIDAQKANIAAGKAVARIL

  13. Identification, duplication, evolution and expression analyses of caleosins in Brassica plants and Arabidopsis subspecies.

    Science.gov (United States)

    Shen, Yue; Liu, Mingzhe; Wang, Lili; Li, Zhuowei; Taylor, David C; Li, Zhixi; Zhang, Meng

    2016-04-01

    Caleosins are a class of Ca(2+) binding proteins that appear to be ubiquitous in plants. Some of the main proteins embedded in the lipid monolayer of lipid droplets, caleosins, play critical roles in the degradation of storage lipids during germination and in lipid trafficking. Some of them have been shown to have histidine-dependent peroxygenase activity, which is believed to participate in stress responses in Arabidopsis. In the model plant Arabidopsis thaliana, caleosins have been examined extensively. However, little is known on a genome-wide scale about these proteins in other members of the Brassicaceae. In this study, 51 caleosins in Brassica plants and Arabidopsis lyrata were investigated and analyzed in silico. Among them, 31 caleosins, including 7 in A. lyrata, 11 in Brassica oleracea and 13 in Brassica napus, are herein identified for the first time. Segmental duplication was the main form of gene expansion. Alignment, motif and phylogenetic analyses showed that Brassica caleosins belong to either the H-family or the L-family with different motif structures and physicochemical properties. Our findings strongly suggest that L-caleosins are evolved from H-caleosins. Predicted phosphorylation sites were differentially conserved in H-caleosin and L-caleosins, respectively. 'RY-repeat' elements and phytohormone-related cis-elements were identified in different caleosins, which suggest diverse physiological functions. Gene structure analysis indicated that most caleosins (38 out of 44) contained six exons and five introns and their intron phases were highly conserved. Structurally integrated caleosins, such as BrCLO3-3 and BrCLO4-2, showed high expression levels and may have important roles. Some caleosins, such as BrCLO2 and BoCLO8-2, lost motifs of the calcium binding domain, proline knot, potential phosphorylation sites and haem-binding sites. Combined with their low expression, it is suggested that these caleosins may have lost function. PMID:26786939

  14. Abietatrienes diterpenoids from Sagittaria montevidensis SSP Montevidensis

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Clara M.A.; Radke, Vanessa S.C.O.; Silva, Cleuza C. da [Universidade Estadual de Maringa (UEM), PR (Brazil). Dept. de Quimica; Nakamura, Celso V. [Universidade Estadual de Maringa (UEM), PR (Brazil). Dept. de Analises Clinicas; Oliveira, Pollyanna L. de; Kato, Lucilia; Oliveira, Cecilia M.A. de [Universidade Federal de Goias (UFG), Goiania, GO (Brazil). Inst. de Quimica

    2010-07-01

    The antimicrobial properties of the hexane, hexane/EtOAc and methanol fractions of the fresh petioles of Sagittaria montevidensis ssp montevidensis (Alismataceae) were evaluated against fungi and Gram-negative and Gram-positive bacteria. A new abietatriene-type diterpenoid, 3beta,7alpha-dihydroxi-abieta-8,11,13-triene and the known 3beta-hydroxy-abieta-8,11,13-trien-7-one were isolated from the most active fraction tested and the structures of these compounds were elucidated by data including IR, EIMS, and 1D and 2D NMR spectra. (author)

  15. The Huygens Surface Science Package (SSP)

    Science.gov (United States)

    Zarnecki, John C.; Leese, Mark; Hathi, Brijen; SSP Consortium, The

    2015-04-01

    The Huygens Surface Science Package (SSP), one of the six instruments selected by ESA, was the only one whose prime purpose was to study the surface of Titan in-situ. Designed at a time when even the basic nature of the surface (i.e. solid ice or liquid hydrocarbons) was unknown, it consisted of 9 separate compact and relatively simple sensors designed to span all likely surface scenarios. The Huygens landing on a "dry lake bed" allowed some of the sensors to be fully exercised. The results and their subsequent interpretations will be presented as well as perspectives from nearly 25 years since the original instrument selection.

  16. Evolutionary Fates and Dynamic Functionalization of Young Duplicate Genes in Arabidopsis Genomes.

    Science.gov (United States)

    Wang, Jun; Tao, Feng; Marowsky, Nicholas C; Fan, Chuanzhu

    2016-09-01

    Gene duplication is a primary means to generate genomic novelties, playing an essential role in speciation and adaptation. Particularly in plants, a high abundance of duplicate genes has been maintained for significantly long periods of evolutionary time. To address the manner in which young duplicate genes were derived primarily from small-scale gene duplication and preserved in plant genomes and to determine the underlying driving mechanisms, we generated transcriptomes to produce the expression profiles of five tissues in Arabidopsis thaliana and the closely related species Arabidopsis lyrata and Capsella rubella Based on the quantitative analysis metrics, we investigated the evolutionary processes of young duplicate genes in Arabidopsis. We determined that conservation, neofunctionalization, and specialization are three main evolutionary processes for Arabidopsis young duplicate genes. We explicitly demonstrated the dynamic functionalization of duplicate genes along the evolutionary time scale. Upon origination, duplicates tend to maintain their ancestral functions; but as they survive longer, they might be likely to develop distinct and novel functions. The temporal evolutionary processes and functionalization of plant duplicate genes are associated with their ancestral functions, dynamic DNA methylation levels, and histone modification abundances. Furthermore, duplicate genes tend to be initially expressed in pollen and then to gain more interaction partners over time. Altogether, our study provides novel insights into the dynamic retention processes of young duplicate genes in plant genomes. PMID:27485883

  17. School Teams up for SSP Functional Models

    Science.gov (United States)

    Pignolet, G.; Lallemand, R.; Celeste, A.; von Muldau, H.

    2002-01-01

    Space Solar Power systems appear increasingly as one of the major solutions to the upcoming global energy crisis, by collecting solar energy in space where this is most easy, and sending it by microwave beam to the surface of the planet, where the need for controlled energy is located. While fully operational systems are still decades away, the need for major development efforts is with us now. Yet, for many decision-makers and for most of the public, SSP often still sounds like science fiction. Six functional demonstration systems, based on the Japanese SPS-2000 concept, have been built as a result of a cooperation between France and Japan, and they are currently used extensively, in Japan, in Europe and in North America, for executive presentations as well as for public exhibitions. There is demand for more models, both for science museums and for use by energy dedicated groups, and a senior high school in La Reunion, France, has picked up the challenge to make the production of such models an integrated practical school project for pre-college students. In December 2001, the administration and the teachers of the school have evaluated the feasibility of the project and eventually taken the go decision for the school year 2002- 2003, when for education purposes a temporary "school business company" will be incorporated with the goal to study and manufacture a limited series of professional quality SSP demonstration models, and to sell them world- wide to institutions and advocacy groups concerned with energy problems and with the environment. The different sections of the school will act as the different services of an integrated business : based on the current existing models, the electronic section will redesign the energy management system and the microwave projector module, while the mechanical section of the school will adapt and re-conceive the whole packaging of the demonstrator. The French and foreign language sections will write up a technical manual for

  18. Etude chimique et biologique des huiles essentielles de Juniperus phoenicea ssp. lycia et Juniperus phoenicea ssp. turbinata du Maroc

    Directory of Open Access Journals (Sweden)

    Mansouri, N.

    2011-01-01

    Full Text Available Chemical and biological study of essential oils of Moroccan Juniperus phoenicea ssp. lycia and Juniperus phoenicea ssp. turbinata. The composition of the essential oils of the branches and berries of Juniperus phoenicea (Cupressaceae, J. phoenicea ssp. lycia (plain and J. phoenicea ssp. turbinata (mountain, obtained by hydrodistillation, collected from Morocco, was analyzed by GC and GC/MS. The yields of essential oils were varying in function of the subspecies and of the part of the plant studied. The essential oils of these tree species are largely dominated by α-pinene and may be an important source of this component of a great interest on the international market. The effectiveness of essential oils from branches of the subspecies lycia against fungi decay wood has also been emphasized.

  19. Chemical and Antibacterial Polymorphism of Juniperus oxycedrus ssp. oxycedrus and Juniperus oxycedrus ssp. macrocarpa (Cupressaceae) Leaf Essential Oils from Tunisia

    OpenAIRE

    Hnène Medini; Bruno Manongiu; Neffati Aicha; Leila Chekir-Ghedira; Fethia Harzalla - Skhiri; Med Larbi Khouja

    2013-01-01

    Essential oils from Juniperus oxycedrus L. have been used since antiquity for fragrance, flavoring, medicinal, antimicrobial, insecticidal, and cosmetic purposes. Several works studied the chemical composition of the essential oils of Juniperus oxycedrus leaves. The aim of this study is to investigate the chemotaxonomic relationships and antibacterial activity of two Tunisian subspecies: Juniperus oxycedrus ssp. oxycedrus (L. K.) Deb. and Juniperus oxycedrus ssp. macrocarpa (S. & m.) Ball. In...

  20. Helianthus annuus ssp. texanus has chloroplast DNA and nuclear ribosomal RNA genes of Helianthus debilis ssp. cucumerifolius.

    OpenAIRE

    Rieseberg, L H; Beckstrom-Sternberg, S.; Doan, K

    1990-01-01

    Heiser [Heiser, C. B. (1951) Evolution 5, 42-51] hypothesized that Helianthus annuus ssp. texanus was derived by the introduction of H. annuus into Texas and subsequent introgression of genes from Helianthus debilis ssp. cucumerifolius into H. annuus. Although often considered to be one of the best cases of introgression in plants, alternative hypotheses to introgression, such as convergence or the joint retention of the ancestral condition, could not be ruled out in the original study. To te...

  1. Identification of Independent Streptococcus gordonii SspA and SspB Functions in Coaggregation with Actinomyces naeslundii

    OpenAIRE

    Egland, Paul G.; Dû, Laurence D.; Kolenbrander, Paul E.

    2001-01-01

    The initial stages of dental plaque formation involve the adherence of early colonizing organisms such as Streptococcus gordonii and Actinomyces naeslundii to the saliva-coated tooth surface and to each other. The S. gordonii surface proteins SspA and SspB are known to play a role in adherence to salivary proteins and mediate coaggregation with other bacteria. Coaggregation is the adhesin receptor-mediated interaction between genetically distinct cell types and appears to be ubiquitous among ...

  2. Comparison of Staphopain A (ScpA) and B (SspB) precursor activation mechanisms reveals unique secretion kinetics of proSspB (Staphopain B), and a different interaction with its cognate Staphostatin, SspC.

    Science.gov (United States)

    Nickerson, Nicholas; Ip, Jessica; Passos, Daniel T; McGavin, Martin J

    2010-01-01

    The scpAB and sspABC operons of Staphylococcus aureus encode Staphopain cysteine proteases ScpA and SspB, and their respective Staphostatins ScpB and SspC, which are thought to protect against premature activation of Staphopain precursors during protein export. However, we found that the proSspB precursor was secreted and activated without detriment to S. aureus in the absence of SspC function. Our data indicate that this is feasible due to a restricted substrate specificity of mature SspB, a stable precursor structure and slow secretion kinetics. In contrast, mature ScpA had a broad substrate specificity, such that it was prone to autolytic degradation, but also was uniquely able to degrade elastin fibres. Modelling of proScpA relative to the proSspB structure identified several differences, which appear to optimize proScpA for autocatalytic activation, whereas proSspB is optimized for stability, and cannot initiate autocatalytic activation. Consequently, recombinant proSspB remained stable and unprocessed when retained in the cytoplasm of Escherichia coli, whereas proScpA initiated rapid autocatalytic activation, leading to capture of an activation intermediate by ScpB. We conclude that the status of sspBC in S. aureus, as paralogues of the ancestral scpAB genes, facilitated a different activation mechanism, a stable proSspB isoform and modified Staphostatin function. PMID:19943908

  3. Progeny of Eucalyptus globulus Labill ssp. Globulus

    Institute of Scientific and Technical Information of China (English)

    ZANGDao-qun; ZHANGChuan-hong; LUOJun-min; HUANGYong-xiang; ZHURen-gang

    2003-01-01

    The preliminary assessment of progeny test in a seed orchard of Eucalyptus globulus Labill.ssp.globulus at Yipinglang State Farm of Yunnan Province in China was conducted.The trial was composed of 21 replications,with 2 trees on each plot,15 plots in each incomplete block,and 18 incomplete blocks in each replication,laid out in a α-design of 270 open-pollinated families.The families were of three categories (natural populations,local land race and seed orchard).They were further subdivided into 11 regions.The data from an assessment of growth,stem form and other characteristics of the young trees after being planted 2 years were analyzed.Results are as follows:the different categories differed significantly in their growth,with the families from seed orchards being the best.Regions also differed significantly in their growth.The families from the regions of Westem Victoria,Eastern Victoria and all three seed orchards were better than others.The tamilies from Yunnan had the best frost tolerant and its survival was the highest.For growth,stem form and fungal tolerance,the families from Yunnan were similar to that from Southern Tasmania and Eastem Tasmania.Two-tree plots were strongly recommended over singletree plot designs for large-scale progeny trials.

  4. The maize (Zea mays ssp. mays var. B73 genome encodes 33 members of the purple acid phosphatase gene family

    Directory of Open Access Journals (Sweden)

    Eliécer eGonzález Muñoz

    2015-05-01

    Full Text Available Purple acid phosphatases (PAPs play an important role in plant phosphorus nutrition, both by liberating phosphorus from organic sources in the soil and by modulating distribution within the plant throughout growth and development. Furthermore, members of the PAP protein family have been implicated in a broader role in plant mineral homeostasis, stress responses and development. We have identified 33 candidate PAP encoding gene models in the maize (Zea mays ssp. mays var. B73 reference genome. The maize Pap family includes a clear single-copy ortholog of the Arabidopsis gene AtPAP26, shown previously to encode both major intracellular and secreted acid phosphatase activities. Certain groups of PAPs present in Arabidopsis, however, are absent in maize, while the maize family contains a number of expansions, including a distinct radiation not present in Arabidopsis. Analysis of RNA-sequencing based transcriptome data revealed accumulation of maize Pap transcripts in multiple plant tissues at multiple stages of development, and increased accumulation of specific transcripts under low phosphorus availability. These data suggest the maize PAP family as a whole to have broad significance throughout the plant life cycle, while highlighting potential functional specialization of individual family members.

  5. Risk analysis of Safety Service Patrol (SSP) systems in Virginia.

    Science.gov (United States)

    Dickey, Brett D; Santos, Joost R

    2011-12-01

    The transportation infrastructure is a vital backbone of any regional economy as it supports workforce mobility, tourism, and a host of socioeconomic activities. In this article, we specifically examine the incident management function of the transportation infrastructure. In many metropolitan regions, incident management is handled primarily by safety service patrols (SSPs), which monitor and resolve roadway incidents. In Virginia, SSP allocation across highway networks is based typically on average vehicle speeds and incident volumes. This article implements a probabilistic network model that partitions "business as usual" traffic flow with extreme-event scenarios. Results of simulated network scenarios reveal that flexible SSP configurations can improve incident resolution times relative to predetermined SSP assignments. PMID:21605149

  6. Unique nucleotide polymorphism of ankyrin gene cluster in Arabidopsis

    Indian Academy of Sciences (India)

    Jianchang Du; Xingna Wang; Mingsheng Zhang; Dacheng Tian; Yong-Hua Yang

    2007-01-01

    The ankyrin (ANK) gene cluster is a part of a multigene family encoding ANK transmembrane proteins in Arabidopsis thaliana, and plays an important role in protein–protein interactions and in signal pathways. In contrast to other regions of a genome, the ANK gene cluster exhibits an extremely high level of DNA polymorphism in an ∼5-kb region, without apparent decay. Phylogenetic analysis detects two clear, deeply differentiated haplotypes (dimorphism). The divergence between haplotypes of accession Col-0 and Ler-0 (Hap-C and Hap-L) is estimated to be 10.7%, approximately equal to the 10.5% average divergence between A. thaliana and A. lyrata. Sequence comparisons for the ANK gene cluster homologues in Col-0 indicate that the members evolve independently, and that the similarity among paralogues is lower than between alleles. Very little intralocus recombination or gene conversion is detected in ANK regions. All these characteristics of the ANK gene cluster are consistent with a tandem gene duplication and birth-and-death process. The possible mechanisms for and implications of this elevated nucleotide variation are also discussed, including the suggestion of balancing selection.

  7. [Flavonoids of Artemisia campestris, ssp. glutinosa].

    Science.gov (United States)

    Hurabielle, M; Eberle, J; Paris, M

    1982-10-01

    Four flavanones (pinostrobin, pinocembrin, sakuranetin and naringenin), one dihydroflavonol (7-methyl aromadendrin) and one flavone (hispidulin) have been isolated from Artemisia campestris L. ssp. glutinosa Gay and identified by spectroscopic methods. Artemisia campestris L. sous-espèce glutinosa Gay est une Composée Anthémidée largement répandue sur les sables du littoral méditerranéean et abondante dans certaines régions d'Espagne et d'Italie. Dans le cadre d'une étude chimiotaxonomique du genre Artemisia Tourn., nous nous sommes intéressés à l'analyse des flavonoïdes, composés jamais décrits, à notre connaissance, dans cette espèce d' Artemisia. Les sommités fleuries d' Artemisia campestris sous-espèce glutinosa, séchées et pulvérisées, sont dégraissées à l'ether de pétrole et épuisées par le chloroforme. Le fractionnement de l'extrait chloroformique, par chromatographie sur colonne de silice, et la purification de certaines fractions conduisent à l'isolement de six génines flavoniques, à l'etat pur. L' étude des spectres UV, des spectres de masse et des spectres de RMN [1,2] et la comparaison avec des échantillons authentiques permettent de proposer, pour ces flavonoïdes, les structures de la pinostrobine [3], de la pinocembrine [4], de la sakuranétine, de la naringénine [5] (flavanones), de la méthyl-7-aromadendrine, [6, 7] (dihydroflavonol) et de l'hispiduline [8, 9] (flavone); quatre de ces génines sont méthylées. Parmi ces flavonoïdes, la pinostrobine n'a jamais été décrite, à notre connaissance, dans la famille des Composées; la pinocembrine, la sakuranétine et la naringénine ont déjà été signalées chez quelques Astéracées et Eupatoriées [10], et l'hispiduline dans la tribu des Anthémidées ( Santolina chamaecyparissus L.) [8]. Seule, la méthyl-7-aromadendrine semble décrite, à ce jour, dans le genre Artemisia Tourn. [7]. PMID:17396957

  8. Estudio etnobotánico, arquitectura foliar y anatomía vegetativa de Agastache mexicana ssp. mexicana y A. mexicana ssp. xolocotziana Etnobotany, leaf architecture, and vegetative anatomy of Agastache mexicana ssp. mexicana and A. mexicana ssp. xolocotziana

    OpenAIRE

    Magali A. Santillán-Ramírez; Ma. Edith López-Villafranco; Silvia Aguilar-Rodríguez; Abigail Aguilar-Contreras

    2008-01-01

    El presente trabajo incluye información etnobotánica, así como la arquitectura foliar y anatomía vegetativa de Agastache mexicana ssp. mexicana (toronjil morado) y A. mexicana ssp. xolocotziana (toronjil blanco), con la finalidad de que sean incluidas en la Farmacopea Herbolaria de los Estados Unidos Mexicanos (FHEUM) y que sus caracteres anatómicos se utilicen para validar la identidad del material vegetal en el control de calidad. El registro de la información etnobotánica se efectuó por me...

  9. Evolutionary origins of Brassicaceae specific genes in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Keshavaiah Channa

    2011-02-01

    Full Text Available Abstract Background All sequenced genomes contain a proportion of lineage-specific genes, which exhibit no sequence similarity to any genes outside the lineage. Despite their prevalence, the origins and functions of most lineage-specific genes remain largely unknown. As more genomes are sequenced opportunities for understanding evolutionary origins and functions of lineage-specific genes are increasing. Results This study provides a comprehensive analysis of the origins of lineage-specific genes (LSGs in Arabidopsis thaliana that are restricted to the Brassicaceae family. In this study, lineage-specific genes within the nuclear (1761 genes and mitochondrial (28 genes genomes are identified. The evolutionary origins of two thirds of the lineage-specific genes within the Arabidopsis thaliana genome are also identified. Almost a quarter of lineage-specific genes originate from non-lineage-specific paralogs, while the origins of ~10% of lineage-specific genes are partly derived from DNA exapted from transposable elements (twice the proportion observed for non-lineage-specific genes. Lineage-specific genes are also enriched in genes that have overlapping CDS, which is consistent with such novel genes arising from overprinting. Over half of the subset of the 958 lineage-specific genes found only in Arabidopsis thaliana have alignments to intergenic regions in Arabidopsis lyrata, consistent with either de novo origination or differential gene loss and retention, with both evolutionary scenarios explaining the lineage-specific status of these genes. A smaller number of lineage-specific genes with an incomplete open reading frame across different Arabidopsis thaliana accessions are further identified as accession-specific genes, most likely of recent origin in Arabidopsis thaliana. Putative de novo origination for two of the Arabidopsis thaliana-only genes is identified via additional sequencing across accessions of Arabidopsis thaliana and closely

  10. Chemical and Antibacterial Polymorphism of Juniperus oxycedrus ssp. oxycedrus and Juniperus oxycedrus ssp. macrocarpa (Cupressaceae Leaf Essential Oils from Tunisia

    Directory of Open Access Journals (Sweden)

    Hnène Medini

    2013-01-01

    Full Text Available Essential oils from Juniperus oxycedrus L. have been used since antiquity for fragrance, flavoring, medicinal, antimicrobial, insecticidal, and cosmetic purposes. Several works studied the chemical composition of the essential oils of Juniperus oxycedrus leaves. The aim of this study is to investigate the chemotaxonomic relationships and antibacterial activity of two Tunisian subspecies: Juniperus oxycedrus ssp. oxycedrus (L. K. Deb. and Juniperus oxycedrus ssp. macrocarpa (S. & m. Ball. In addition, and for the first time, we reported the antibacterial activities of Tunisian J. oxycedrus ssp. macrocarpa and J. oxycedrus ssp. oxycedrus against four bacteria. Essential oils obtained by hydrodistillation were analysed by GC and GC/MS. Fifty-five constituents were identified. Thirty four major compounds were retained for the study of the chemical variability, and α-pinene, sylvestrene, p-cymene, and 13-epi-manoyl oxide were the main ones. The chemical principal components analysis (PCA identified three chemotypes. The study of the antibacterial activity showed that Escherichia coli was found to be extremely resistant (zone diameter 0 mm to all the oils tested, while Staphylococcus aureus was the most sensitive strain (zone diameter 13.5 mm and MIC ranged from 600 to 650 μg/mL.

  11. Estudio etnobotánico, arquitectura foliar y anatomía vegetativa de Agastache mexicana ssp. mexicana y A. mexicana ssp. xolocotziana Etnobotany, leaf architecture, and vegetative anatomy of Agastache mexicana ssp. mexicana and A. mexicana ssp. xolocotziana

    Directory of Open Access Journals (Sweden)

    Magali A. Santillán-Ramírez

    2008-12-01

    Full Text Available El presente trabajo incluye información etnobotánica, así como la arquitectura foliar y anatomía vegetativa de Agastache mexicana ssp. mexicana (toronjil morado y A. mexicana ssp. xolocotziana (toronjil blanco, con la finalidad de que sean incluidas en la Farmacopea Herbolaria de los Estados Unidos Mexicanos (FHEUM y que sus caracteres anatómicos se utilicen para validar la identidad del material vegetal en el control de calidad. El registro de la información etnobotánica se efectuó por medio de entrevistas semiestructuradas a pobladores del municipio de Temoaya, Estado de México, México. Para el estudio anatómico y arquitectura foliar, se elaboraron preparaciones semipermanentes y permanentes de tallos y hojas. Ambos toronjiles son utilizados por los habitantes de la zona de estudio como recurso terapéutico y de ornato; los distinguen por la forma de las hojas, el color de la flor y el aroma, pero no existen preferencias de uso entre ambos. La arquitectura foliar sigue el patrón acródromo de posición basal con un desarrollo imperfecto; las areolas muestran un desarrollo imperfecto con disposición al azar, con vénulas simples o ramificadas una vez y el margen con dientes cunonioides en ambas especies. Diferencias anatómicas se observan en el tallo y son los tricomas no glandulares uniseriados en mayor abundancia y las bandas de esclerénquima más desarrolladas los caracteres que distinguen a A. mexicana ssp. xolocotziana de A. mexicana ssp. mexicana.This work provides information on ethnobotany, leaf architecture and anatomy of Agastache mexicana ssp. mexicana (toronjil morado and A. mexicana ssp. xolocotziana (toronjil blanco, with the purpose that they will be included in the Pharmacopeia Herbolaria of the Estados Unidos Mexicanos (FHEUM and that their anatomical characters could be used to validate the identity of the botanical material in quality control. We gathered ethnobotanical information using semi

  12. Optimal second order diagonally implicit SSP Runge--Kutta methods

    OpenAIRE

    Kocsis, Tihamér A.; Németh, Adrián

    2014-01-01

    Optimal Strong Stability Preserving (SSP) Runge--Kutta methods has been widely investegated in the last decade and many open conjectures have been formulated. The iterated implicit midpoint rule has been observed numerically optimal in large classes of second order methods, and was proven to be optimal for some small cases, but no general proof was known so far to show its optimality. In this paper we show a new approach to analytically investigate this problem and determine the unique optima...

  13. Flavonoids from Ulex airensis and Ulex europaeus ssp. europaeus.

    Science.gov (United States)

    Máximo, Patrícia; Lourenço, Ana; Feio, Sónia Savluchinske; Roseiro, José Carlos

    2002-02-01

    From the dichloromethane extract of Ulex airensis three new isoflavonoids, ulexin C (1), ulexin D (2), and 7-O-methylisolupalbigenin (3), were isolated and characterized by spectroscopic methods. Ulexin D (2) was also identified from the dichloromethane extract of Ulex europaeus ssp. europaeus. Together with these new metabolites, 18 compounds of previously known structures were isolated and identified from both species. The antifungal activity of these compounds was tested against Cladosporium cucumerinum by a bioautographic TLC assay. PMID:11858751

  14. Genome-wide identification, classification, and expression analysis of sHSP genes in Chinese cabbage (Brassica rapa ssp pekinensis).

    Science.gov (United States)

    Tao, P; Guo, W L; Li, B Y; Wang, W H; Yue, Z C; Lei, J L; Zhong, X M

    2015-01-01

    Small heat shock proteins (sHSPs) are essential for the plant's normal development and stress responses, especially the heat stress response. The information regarding sHSP genes in Chinese cabbage (Brassica rapa ssp pekinensis) is sparse, hence we performed a genome-wide analysis to identify sHSP genes in this species. We identified 26 non-redundant sHSP genes distributed on all chromosomes, except chromosome A7, with one additional sHSP gene identified from an expressed sequence tag library. Chinese cabbage was found to contain more sHSP genes than Arabidopsis. The 27 sHSP genes were classified into 11 subfamilies. We identified 22 groups of sHSP syntenic orthologous genes between Chinese cabbage and Arabidopsis. In addition, eight groups of paralogous genes were uncovered in Chinese cabbage. Protein structures of the 27 Chinese cabbage sHSPs were modeled using Phyre2, which revealed that all of them contain several conserved β strands across different subfamilies. In general, gene structure was conserved within each subfamily between Chinese cabbage and Arabidopsis, except for peroxisome sHSP. Analysis of promoter motifs showed that most sHSP genes contain heat shock elements or variants. We also found that biased gene loss has occurred during the evolution of the sHSP subfamily in Chinese cabbage. Expression analysis indicated that the greatest transcript abundance of most Chinese cabbage sHSP genes was found in siliques and early cotyledon embryos. Thus, genome-wide identification and characterization of sHSP genes is a first and important step in the investigation of sHSPs in Chinese cabbage. PMID:26505345

  15. Some aspects of cultivation and utilization of waxy maize (Zea mays L. ssp. ceratina)

    OpenAIRE

    Agnieszka Klimek-Kopyra; Aleksander Szmigiel; Tadeusz Zając; Agnieszka Kidacka

    2012-01-01

    This paper is a review of available literature on Zea mays L.ssp.ceratina. It contains information on the origin, cul- tivation and utilization of waxy maize in the world and can be a contribution to the development of new research on maize cultivation and starch processing technology. Maize, as an old and economically important cereal, played an enormous role in the ancient civilisations of the New World. Among the maize subspecies compared, Z. mays ssp. indurata and Z. mays ssp. indenta...

  16. Identification of Functional Candidates amongst Hypothetical Proteins of Treponema pallidum ssp. pallidum

    OpenAIRE

    Naqvi, Ahmad Abu Turab; Shahbaaz, Mohd; Ahmad, Faizan; Hassan, Md. Imtaiyaz

    2015-01-01

    Syphilis is a globally occurring venereal disease, and its infection is propagated through sexual contact. The causative agent of syphilis, Treponema pallidum ssp. pallidum, a Gram-negative sphirochaete, is an obligate human parasite. Genome of T. pallidum ssp. pallidum SS14 strain (RefSeq NC_010741.1) encodes 1,027 proteins, of which 444 proteins are known as hypothetical proteins (HPs), i.e., proteins of unknown functions. Here, we performed functional annotation of HPs of T. pallidum ssp. ...

  17. PENGEMBANGAN SSP TEMATIK INTEGRATIF UNTUK MEMBANGUN KARAKTER KEJUJURAN DAN KEPEDULIAN SISWA SD KELAS II

    Directory of Open Access Journals (Sweden)

    Sri Hariyati Qodriyah

    2015-07-01

    Full Text Available Penelitian ini bertujuan untuk menghasilkan perangkat pembelajaran berupa SSP Tematik yang dapat mengembangkan karakter siswa kelas 2 sekolah dasar, meliputi karakter kejujuran dan kepedulian. Penelitian ini merupakan penelitian dan pengembangan yang terdiri dari tujuh tahap, yaitu studi pendahuluan, perencanaan, mengembangkan produk awal, uji coba awal, revisi produk utama, uji coba lapangan, dan revisi terhadap produk operasional. SSP yang dikembangkan dievaluasi oleh seorang ahli materi dan media untuk mengetahui validitasnya. Subjek uji coba berjumlah 90 siswa terdiri dari 23 siswa SD Sonosewu, Kasihan, Bantul, DIY sebagai subjek uji coba terbatas dan 33 siswa untuk kelas control dan 34 siswa untuk kelas eksperimen SD 1 Kadipiro, Kasihan, Bantul, DIY. Hasil penelitian ini berupa SSP yang meliputi: silabus, RPP, LKS, dan lembar penilaian. Hasil evaluasi dari ahli materi dan ahli media untuk menguji tingkat kevalidan SSP menyatakan bahwa SSP yang dikembangkan adalah valid dan berkategori “baik”. Hasil uji coba menunjukkan bahwa SSP yang dikembangkan dinyatakan layak serta memenuhi kriteria praktis dan efektif dalam mengembangkan karakter siswa. Pembelajaran dengan SSP yang dikembangkan mampu mengembangkan karakter kejujuran dan kepedulian. Kata Kunci: SSP, karakter jujur dan peduli   DEVELOPING THEMATIC INTEGRATIVE SSP FOR BUILDING THE CHARACTERS OF HONESTY AND CARE GRADE II STUDENT OF ELEMENTARY SCHOOL Abstract This study aims to produce integrated learning sets in the form of thematic SSP that can develop the characters of honesty and care of grade II students of elementary school. This was a research and development study consisting of seven steps, i.e. preliminary study, planning, preliminary product development, preliminary tryout, main product revision, field tryout, revision of operational product, operational product revision, and revision of the final product. The developed SSP was evaluated by a science subject expert to assess

  18. 温度、盐度、pH和饵料密度对皱肋文蛤清滤率的影响%Effects of temperature, salinity, pH, and microalgae density on clearance rates of Meretrix lyrata

    Institute of Scientific and Technical Information of China (English)

    栗志民; 刘志刚; 徐法军; 李明昊

    2011-01-01

    The farming of the clam Meretrix lyrata has been successfully developed since 1987 and brought high economic and social benefits to the coastal communities. As a highly valued fishery resource especially in Vietnam, recently M. Lyrata has become another new aqua-culture species with a potential for large-scale farming in the South China Sea and a good market prospects. In this study, by adopting the ecology experimental methods, the effects of seawater temperatures, salinities, pH, and microalgae densities on the clearance rates of M. Lyrata were investigated, which are expected to provide insight on culturing capacity, feeding behavior and energy of M. Lyrata and references for healthy culturing and extension of M. Lyrata. The results showed that the clearance rates of M. Lyrata (P<0. 01) at three sizes were significantly affected by varied temperature (13~33℃), salinity (13~33), pH (7~9), and diet density (2. 5×104~10×104 cell/ml). The maximum clearance rates of the large, medium, and small sized M. Lyrata were 1. 06, 1. 78 and 2. 42 L/g ? H at 28℃ respectively, 0. 35, 0. 65 and 1. 05 L/g ? H at salinity 23, 1. 26, 1. 67 and 2. 02 L/g ? H at pH 8,1. 29, 2. 07 and 2. 29 L/g ? H at microalgae density of 10 × 104 cell/ml. These results indicate that the optimum feeding environ mental conditions were: temperature 28℃, salinity 23, pH 8 and microalgae density 10 × 104 cell/ml. These results indicate that the sensitivity of the large, medium and small sized M. Lyrata to temperature, salinity, pH or microalgae density appeared in the following order: large size<[medium size

  19. A validity study of the SSP-School Inclusion Questionnaire

    Directory of Open Access Journals (Sweden)

    DIANA DĂMEAN

    2012-12-01

    Full Text Available The paper is based on the results of a research that aimed to identify the factors influencing school inclusion among disadvantagedstudents. The main outcome of the research was the development of the SSP-School Inclusion Questionnaire, intended to: (1measure school inclusion levels among students; (2 identify students with significantly lower levels of school inclusion, whoneed to be included in intervention programs; and (3 measure the impact of intervention programs using subjective indicators(beneficiaries’ perception of school and teachers, feelings of safety in school, school performance. The questionnaire was completedby 480 vocational school students aged 15-19 from a large developed urban area (Cluj-Napoca in Romania. The purpose of theresearch was to test the validity and reliability of the instrument and to propose it to professionals working in education (schoolpsychologists, school counsellors etc. for efficient data collection and for measuring the impact of educational intervention.

  20. Preliminary phytochemical studies of the leaf extracts of Rhododendron arboreum Sm. ssp. nilagiricum (Zenker) Tagg

    Institute of Scientific and Technical Information of China (English)

    Solomon Kiruba; Mony Mahesh; Zachariah Miller Paul; Solomon Jeeva

    2012-01-01

    Objective: To examine the secondary metabolites present in the leaf extracts of Rhododendron arboreum Sm. ssp. nilagiricum (Zenker) Tagg. Methods: Phytochemical screening of the leaf extract was done to determine the phytochemical constituents in the various solvents studied.Results:nilagiricum (Zenker) Tagg. confirm the existence of secondary metabolites such as phenols, saponins and tannins. Conclusions: The study suggests that the leaf extracts of R. arboreum Sm. ssp. nilagiricum (Zenker) Tagg. can be best utilized in developing bioactive compounds against pathogenic infection. The phytochemical study carried out on the leaf extracts of R. arboreum Sm. ssp.

  1. Phytochemical analysis of the flower extracts of Rhododendron arboreum Sm. ssp. nilagiricum (Zenker) Tagg

    Institute of Scientific and Technical Information of China (English)

    Kiruba S; Mahesh M; Nisha SR; Miller Paul Z; Jeeva S

    2011-01-01

    Objective: To evaluate the preliminary phytochemical screening of the flower extracts of Rhododendron arboreum (R. arboreum) Sm. ssp. nilagiricum (Zenker) Tagg. Methods: The preliminary phytochemical screening was performed by the standard methods as described by Harborne. Results: The phytochemical analysis carried out on the flowers of R. arboreum Sm. ssp. nilagiricum (Zenker) Tagg showed the presence of phenols, saponins, steroids, tannin, xanthoprotein and coumarin. Conclusions:The present study suggested that the flower extracts of R. arboreum Sm. ssp. nilagiricum (Zenker) Tagg possess significant phytochemical constituents and it can be used as antimicrobial agents against clinically isolated pathogens.

  2. Bosom Buddies: The Symbiotic Relationship Between Infants and Bifidobacterium longum ssp. longum and ssp. infantis. Genetic and Probiotic Features.

    Science.gov (United States)

    Arboleya, Silvia; Stanton, Catherine; Ryan, C Anthony; Dempsey, Eugene; Ross, Paul R

    2016-01-01

    The intestinal microbiota is a complex community that plays an important role in human health from the initial steps of its establishment. Its microbial composition has been suggested to result from selective pressures imposed by the host and is modulated by competition among its members. Bifidobacterium longum is one of the most abundant species of the Bifidobacterium genus in the gut microbiota of healthy breast-fed infants and adults. The recent advancements of 'omics techniques have facilitated the genetic and functional studies of different gut microbiota members. They have revealed the complex genetic pathways used to metabolize different compounds that likely contribute to the competitiveness and persistence of B. longum in the colon. The discovery of a genomic island in B. longum ssp. infantis that encodes specific enzymes for the metabolism of human milk oligosaccharides suggests a specific ecological adaptation. Moreover, B. longum is widely used as probiotic, and beneficial effects in infant health have been reported in several studies. PMID:26934170

  3. An abstract class loader for the SSP and its implementation in TL.

    Energy Technology Data Exchange (ETDEWEB)

    Wickstrom, Gregory Lloyd; Winter, Victor Lono (University of Nebraska at Omaha, Omaha, NE); Fraij, Fares (University of Texas at El Paso, El Paso, TX); Roach, Steve (University of Texas at El Paso, El Paso, TX); Beranek, Jason (University of Nebraska at Omaha, Omaha, NE)

    2004-08-01

    The SSP is a hardware implementation of a subset of the JVM for use in high consequence embedded applications. In this context, a majority of the activities belonging to class loading, as it is defined in the specification of the JVM, can be performed statically. Static class loading has the net result of dramatically simplifying the design of the SSP as well as increasing its performance. Due to the high consequence nature of its applications, strong evidence must be provided that all aspects of the SSP have been implemented correctly. This includes the class loader. This article explores the possibility of formally verifying a class loader for the SSP implemented in the strategic programming language TL. Specifically, an implementation of the core activities of an abstract class loader is presented and its verification in ACL2 is considered.

  4. Mogućnost primjene bakterije Lactococcus lactis ssp. lactis kao funkcionalne starter kulture

    OpenAIRE

    Frece, Jadranka; Cvrtila, Jelena; Topić, Ivana; Delaš, Frane; Markov, Ksenija

    2014-01-01

    Svrha je ovoga istraživanja bila identificirati i okarakterizirati potencijalne autohtone funkcionalne starter kulture izolirane iz domaće kobasice proizvedene od konjskog mesa. Dominantnu su mikrofloru u uzorcima kobasica činile bakterije mliječne kiseline (BMK), a zatim mikrokoki. Od bakterija mliječne kiseline prevladavale su vrste Lactococcus lactis ssp. lactis i Lactobacillus plantarum. Vrsta Lactococcus lactis ssp. lactis nije uobičajena u fermentiranim kobasicama, pa smo ju okarakteriz...

  5. Reproductive Ecology of Wyoming Big Sagebrush (Artemisia Tridentata SSP. Wyomingensis) : Effects of Herbivory and Competition

    OpenAIRE

    Decker, Richard T.

    1990-01-01

    Herbivory and plant competition affect sexual reproduction of plants in various ways. Exclusion of mule deer (Odocoileus hemionus) and cattle, removal of plant competition (both inter- and intraspecific), and all combinations of the above treatments were used to examine the individual and combined affects on Artemisia tridentata ssp. wyomingensis (Wyoming big sagebrush) reproduction. Reproduction of Artemisia tridentata ssp. wyomingensis was divided into hierarchical levels of the number of: ...

  6. A Novel Bluetooth Man-In-The-Middle Attack Based On SSP using OOB Association model

    OpenAIRE

    Saravanan, K.; Vijayanand, L.; Negesh, R. K.

    2012-01-01

    As an interconnection technology, Bluetooth has to address all traditional security problems, well known from the distributed networks. Moreover, as Bluetooth networks are formed by the radio links, there are also additional security aspects whose impact is yet not well understood. In this paper, we propose a novel Man-In-The-Middle (MITM) attack against Bluetooth enabled mobile phone that support Simple Secure Pairing(SSP). From the literature it was proved that the SSP association models su...

  7. Evaluación de la calidad funcional y sensorial en cultivares de Triticum aestivum ssp. vulgare y ssp. spelta en cultivo ecológico

    OpenAIRE

    Vargas Kostiuk, María Eugenia

    2016-01-01

    En esta Tesis Doctoral se ha estudiado la influencia del cultivar sobre el comportamiento reológico y panadero de cinco cultivares de trigo sembrados en el mismo año y en el mismo ambiente, en condiciones de cultivo ecológico. Tres de ellos eran de trigo panadero (Triticum aestivum ssp. vulgare), ‘Bonpain’, ‘Craklin’ y ‘Sensas’ y los otros dos de trigo espelta (Triticum aestivum ssp. spelta), ‘Espelta Álava’ y ‘Espelta Navarra’. Actualmente, el alohexaploide trigo panadero (2n=6x=42 genomio A...

  8. Divergent evolutionary and expression patterns between lineage specific new duplicate genes and their parental paralogs in Arabidopsis thaliana.

    Directory of Open Access Journals (Sweden)

    Jun Wang

    Full Text Available Gene duplication is an important mechanism for the origination of functional novelties in organisms. We performed a comparative genome analysis to systematically estimate recent lineage specific gene duplication events in Arabidopsis thaliana and further investigate whether and how these new duplicate genes (NDGs play a functional role in the evolution and adaption of A. thaliana. We accomplished this using syntenic relationship among four closely related species, A. thaliana, A. lyrata, Capsella rubella and Brassica rapa. We identified 100 NDGs, showing clear origination patterns, whose parental genes are located in syntenic regions and/or have clear orthologs in at least one of three outgroup species. All 100 NDGs were transcribed and under functional constraints, while 24% of the NDGs have differential expression patterns compared to their parental genes. We explored the underlying evolutionary forces of these paralogous pairs through conducting neutrality tests with sequence divergence and polymorphism data. Evolution of about 15% of NDGs appeared to be driven by natural selection. Moreover, we found that 3 NDGs not only altered their expression patterns when compared with parental genes, but also evolved under positive selection. We investigated the underlying mechanisms driving the differential expression of NDGs and their parents, and found a number of NDGs had different cis-elements and methylation patterns from their parental genes. Overall, we demonstrated that NDGs acquired divergent cis-elements and methylation patterns and may experience sub-functionalization or neo-functionalization influencing the evolution and adaption of A. thaliana.

  9. Identification of QTLs Related to Bolting in Brassica rapa ssp. pekinensis(syn. Brassica campestris ssp. pekinensis)

    Institute of Scientific and Technical Information of China (English)

    ZHANG Xiao-wei; XIE Cong-hua; WANG Xiao-wu; WU Jian; ZHAO Jian-jun; SONG Xiao-fei; LI Ying; ZHANG Yan-guo; XU Dong-hui; SUN Ri-fei; YUAN Yu-xiang

    2006-01-01

    A genetic linkage map of Brassica rapa ssp. pekinensis was constructed with 186 AFLP (amplified fragment length polymorphism) markers by using a doubled-haploid (DH) population with 183 individuals. The individuals were derived from F1 which was developed by crossing a bolting resistant DH line Y-177-12 and an easy bolting DH line Y195-93a.AFLPs were generated by the use of restriction enzymes EcoR Ⅰ and Mse Ⅰ. The segregation of each marker and linkage was analyzed by using JoinMap version 3.0. Mapped markers were aligned in ten linkage groups which covered 887.8 cM with an average marker interval of 4.47 cM. Markers showing skewed segregation ratio were clustered in six LGs.Quantitative trait loci (QTL) were mapped for bolting resistance by using MAPQTL 4.0 package. Four QTLs explaining from 7.0 to 9.4% of the total variation were detected, all of them increase bolting resistance. These mapped QTLs could be used to develop a marker assisted selection programme for bolting resistance breeding.

  10. Regulation of bolting and identification of the α-tubulin gene family in Brassica rapa L. ssp pekinensis.

    Science.gov (United States)

    Zhang, Y W; Jin, D; Xu, C; Zhang, L; Guo, M H; Fang, Z Y

    2016-01-01

    Microtubules are important components of eukaryotic cells, and they play vital roles in cell morphogenesis, carrying of signaling molecules, transport of materials, and establishing the cell polarity. During bolting of biennial plants, cell division and elongation are involved, and cell elongation inevitably involves the microtubules arrangement and expression of related genes. So we deduce that it is of great significance to figure out the mechanism of bolting and flowering in which TUA genes are involved. In the present study, bioinformatic methods were used to predict and identify the α-tubulin gene family (BrTUAs) in Brassica rapa L. ssp pekinensis (Chinese cabbage) through the alignment of AtTUA gene sequence from Arabidopsis thaliana with the B. rapa genome database (http://brassicadb.org/brad/) using the basic local alignment search tool. The change in the structure and functions of BrTUAs during the process of evolution, cis-acting elements in the promoter sequences of BrTUAs, and the expression of the identified genes was also analyzed. Twelve members of the α-tubulin gene family were identified from Chinese cabbage. The gene length, intron, exon, and promoter regions were determined to have changed significantly during the genome evolution. Only five of the 12 members were encoded completely and were observed to differ in their spatial and temporal expression. The five BrTUA promoter sequences contained different numbers of cis-elements responsive to light and low-temperature response, cis-elements responsive among which hormonal responses were significantly different. We also report that the BrTUAs were involved in the regulation of the bolting in Chinese cabbage, and propose that this process could be controlled by regulating the expression of BrTUAs. PMID:26909938

  11. Cytogenetic Diversity of Simple Sequences Repeats in Morphotypes of Brassica rapa ssp. chinensis.

    Science.gov (United States)

    Zheng, Jin-Shuang; Sun, Cheng-Zhen; Zhang, Shu-Ning; Hou, Xi-Lin; Bonnema, Guusje

    2016-01-01

    A significant fraction of the nuclear DNA of all eukaryotes is comprised of simple sequence repeats (SSRs). Although these sequences are widely used for studying genetic variation, linkage mapping and evolution, little attention had been paid to the chromosomal distribution and cytogenetic diversity of these sequences. In this paper, we report the distribution characterization of mono-, di-, and tri-nucleotide SSRs in Brassica rapa ssp. chinensis. Fluorescence in situ hybridization was used to characterize the cytogenetic diversity of SSRs among morphotypes of B. rapa ssp. chinensis. The proportion of different SSR motifs varied among morphotypes of B. rapa ssp. chinensis, with tri-nucleotide SSRs being more prevalent in the genome of B. rapa ssp. chinensis. We determined the chromosomal locations of mono-, di-, and tri-nucleotide repeat loci. The results showed that the chromosomal distribution of SSRs in the different morphotypes is non-random and motif-dependent, and allowed us to characterize the relative variability in terms of SSR numbers and similar chromosomal distributions in centromeric/peri-centromeric heterochromatin. The differences between SSR repeats with respect to abundance and distribution indicate that SSRs are a driving force in the genomic evolution of B. rapa species. Our results provide a comprehensive view of the SSR sequence distribution and evolution for comparison among morphotypes B. rapa ssp. chinensis. PMID:27507974

  12. Optimal Control Strategy for Marine Ssp Podded Propulsion Motor Based on Strong Tracking-Epf

    Directory of Open Access Journals (Sweden)

    Yao Wenlong

    2015-09-01

    Full Text Available Aiming at the non-linearity of state equation and observation equation of SSP (Siemen Schottel Propulsor propulsion motor, an improved particle filter algorithm based on strong tracking extent Kalman filter (ST-EKF was presented, and it was imported into the marine SSP propulsion motor control system. The strong tracking filter was used to update particles in the new algorithm and produce importance densities. As a result, the problems of particle degeneracy and sample impoverishment were ameliorated, the propulsion motor states and the rotor resistance were estimated simultaneously using strong track filter (STF, and the tracking ability of marine SSP propulsion motor control system was improved. Simulation result shown that the improved EPF algorithm was not only improving the prediction accuracy of the motor states and the rotor resistance, but also it can satisfy the requirement of navigation in harbor. It had the better accuracy than EPF algorithm.

  13. The transfer RNA genes in Oryza sativa L.ssp.indica

    Institute of Scientific and Technical Information of China (English)

    王希胤; 史晓黎; 郝柏林

    2002-01-01

    The availability of the draft genome sequence of Oryza sativa L. ssp. indica has made it possible to study the rice tRNA genes. A total of 596 tRNA genes, including 3 selenocysteine tRNA genes and one suppressor tRNA gene are identified in 127551 rice contigs. There are 45 species of tRNA genes and the revised wobble hypothesis proposed by Guthrie and Abelson is perfectly obeyed. The relationship between codon usage and the number of corresponding tRNA genes is discussed. Redundancy may exist in the present list of tRNA genes and novel ones may be found in the future. A set of 33 tRNA genes is discovered in the complete chloroplast genome of Oryza sativa L. ssp. indica. These tRNA genes are identical to those in ssp. japonica identified by us independently from the origional annotation.

  14. Some aspects of cultivation and utilization of waxy maize (Zea mays L. ssp. ceratina

    Directory of Open Access Journals (Sweden)

    Agnieszka Klimek-Kopyra

    2012-10-01

    Full Text Available This paper is a review of available literature on Zea mays L.ssp.ceratina. It contains information on the origin, cul- tivation and utilization of waxy maize in the world and can be a contribution to the development of new research on maize cultivation and starch processing technology. Maize, as an old and economically important cereal, played an enormous role in the ancient civilisations of the New World. Among the maize subspecies compared, Z. mays ssp. indurata and Z. mays ssp. indentata are now the most important in Poland. The subspecies Z. mays ssp. saccharata has a marginal role, while Z. mays ssp. ceratina has not been hitherto cultivated. Decisions to introduce the subspecies Z. mays ssp. ceratina into cultivation are based on different grounds, taking into account both agro-climatic conditions and industrial uses of grain processing products. The growing demand for maize grain, stimulated by the increased demand for maize starch and oil in the global market as raw materials that are important in food production, is an impulse for the development of agrobiological research. The development of the starch industry, associated with the demand for industrial starch, will probably contribute to increased interest in this subspecies in Central Europe, also including Poland. Waxy maize grain can be a major ingredient of high-energy feeds for livestock, replacing in this role the type of maize that has been grown for this purpose until now. A great advantage of waxy maize is its specific structure of starch, due to its unique and high amylopectin content (95-98%, which creates unlimited possibilities of industrial use. Currently, waxy maize acreage in Europe does not exceed 2% of the maize crop area in this continent.

  15. INDUSTRIJSKA KONOPLJA (Cannabis sativa L. ssp. sativa) V SLOVENIJI IN PO SVETU

    OpenAIRE

    Medved, Meta

    2012-01-01

    Gojenje industrijske konoplje (Cannabis sativa L. ssp. sativa) ima v Sloveniji in po svetu še vedno negativen prizvok. Razlog za to je sorodnost te rastline z indijsko konopljo (Cannabis sativa L. ssp. indica), ki se vzgaja za pridobivanje droge. To se odraža tudi v zakonodaji, ki nekaterim državam prepoveduje, drugim pa omejuje gojenje konoplje. Namen te raziskave je predstaviti uporabnost in dobičkonosnost pri pridelavi konoplje, ter preveriti vpliv pojavnosti droge, indijske konoplje na ...

  16. The catalase gene differentiates between some strains of Staphylococcus aureus ssp. anaerobius

    OpenAIRE

    Musa, N. O.; Eltom, K.; Gessler, F.; H. Böhnel; Babiker, A.; Sanousi, S. M.

    2010-01-01

    Staphylococcus aureus ssp anaerobius strain S10 was isolated from an outbreak of sheep abscess disease. Sequence of the catalase gene of this strain showed 99 % identity to the catalase gene (katB) sequence of the reference strain (S. aureus ssp. anaerobius strain MVF213) with mismatching of three base pairs. An important substitution located 1036 nucleotides upstream of the initiation codon from “C” in katB to “T” in the catalase gene of strain S10 originated a stop codon. The de...

  17. A Novel Bluetooth Man-In-The-Middle Attack Based On SSP using OOB Association model

    CERN Document Server

    Saravanan, K; Negesh, R K

    2012-01-01

    As an interconnection technology, Bluetooth has to address all traditional security problems, well known from the distributed networks. Moreover, as Bluetooth networks are formed by the radio links, there are also additional security aspects whose impact is yet not well understood. In this paper, we propose a novel Man-In-The-Middle (MITM) attack against Bluetooth enabled mobile phone that support Simple Secure Pairing(SSP). From the literature it was proved that the SSP association models such as Numeric comparison, Just works and passkey Entry are not more secure. Here we propose the Out Of Band (OOB) channeling with enhanced security than the previous methods.

  18. Powdery scab effect on the potato Solanum tuberosum ssp. andigena growth and yield Efeito da sarna pulverulenta no desenvolvimento e produtividade da batata Solanum tuberosum ssp. andigena

    OpenAIRE

    Elizabeth Gilchrist; Juliana Soler; Ueli Merz; Sebastian Reynaldi

    2011-01-01

    Powdery scab affects most potato production zones in the world. The causal organism Spongospora subterranea f. sp. subterranea forms galls in roots and lesions on tubers during its replication. Recent researches suggest that S. subterranea could cause harmful effects on the host plant and potentially on yield.In order to quantify the disease impact on plant growth and yield, potato Solanum tuberosum ssp. andigena, cv. Diacol Capiro was grown in a soil infested with S. subterranea and compared...

  19. Tolerance and safety of Lactobacillus paracasei ssp. paracasei in combination with Bifidobacterium animalis ssp. lactis in a prebiotic-containing infant formula: a randomised controlled trial

    OpenAIRE

    Vlieger, A.M.; Robroch, A.; van Buuren, S; Kiers, J; Rijkers, G.; Benninga, M A; Biesebeke, R. te

    2009-01-01

    The addition of probiotics to infant formula has been shown to be an efficient way to increase the number of beneficial bacteria in the intestine in order to promote a gut flora resembling that of breast-fed infants. The objective of the present study was to evaluate the safety and tolerance of a combination of two probiotic strains in early infancy. A group of 126 newborns were randomised to receive a prebiotic-containing starter formula supplemented with Lactobacillus paracasei ssp. paracas...

  20. Arabidopsis in Wageningen

    OpenAIRE

    Koornneef, M

    2013-01-01

    Arabidopsis thaliana is the plant species that in the past 25 years has developed into the major model species in plant biology research. This was due to its properties such as short generation time, its small genome and its easiness to be transformed. Wageningen University has played an important role in the development of this model, based on interdisciplinary collaborations using genetics as a major tool to investigate aspects of physiology, development, plant-microbe interactions and evol...

  1. Proteomic analysis of bronchoalveolar lavage fluid proteins from mice infected with Francisella tularensis ssp novicida

    Energy Technology Data Exchange (ETDEWEB)

    Varnum, Susan M.; Webb-Robertson, Bobbie-Jo M.; Pounds, Joel G.; Moore, Ronald J.; Smith, Richard D.; Frevert, Charles; Skerret, Shawn J.; Wunschel, David S.

    2012-07-06

    Francisella tularensis causes the zoonosis tularemia in humans and is one of the most virulent bacterial pathogens. We utilized a global proteomic approach to characterize protein changes in bronchoalveolar lavage fluid from mice exposed to one of three organisms, F. tularensis ssp. novicida, an avirulent mutant of F. tularensis ssp. novicida (F.t. novicida-ΔmglA); and Pseudomonas aeruginosa. The composition of BALF proteins was altered following infection, including proteins involved in neutrophil activation, oxidative stress and inflammatory responses. Components of the innate immune response were induced including the acute phase response and the complement system, however the timing of their induction varied. Francisella tularensis ssp. novicida infected mice do not appear to have an effective innate immune response in the first hours of infection, however within 24 hours they show an upregulation of innate immune response proteins. This delayed response is in contrast to P. aeruginosa infected animals which show an early innate immune response. Likewise, F.t. novicida-ΔmglA infection initiates an early innate immune response, however this response is dimished by 24 hours. Finally, this study identifies several candidate biomarkers, including Chitinase 3-like-1 (CHI3L1 or YKL-40) and peroxiredoxin 1, that are associated with F. tularensis ssp. novicida but not P. aeruginosa infection.

  2. PENGEMBANGAN SSP FISIKA BERBASIS PENDEKATAN CTL UNTUK MENINGKATKAN KETERAMPILAN PROSES SAINS DAN MOTIVASI BELAJAR

    Directory of Open Access Journals (Sweden)

    Faiq Makhdum Noor

    2015-04-01

    Full Text Available This research aims to develop a learning device as Subject-Specific Pedagogy (SSP of physics, and to improve science process skills and learning motivation of the students. This research used the 4D model. The subjects of this research were the XI grade students of Muhammadiyah High School 2 Yogyakarta. The data collecting instruments were expert validation sheets, science process skill observation sheets, questionnaire of students’ response to the student books and worksheets, question-naire of students’ response to teaching process, students’ motivation learning sheets, and science process skill paper test. The research data were collected through observation, questionnaire, and paper test, and analyzed quantitatively. The results show as follows. (1 The development of physics SSP is carried out in accordance with the procedures of 4D model product development. (2 The results of expert’s validation show the physics SSP is in the very good criteria. (3 The readability of the student books and worksheets is in the good criteria. (4 The increasing of the score of science process skills and students’ learning motivation in the experimental class is higher than that in the control class. This shows that the physics SSP is fit for use in physics teaching.

  3. Identification of functional candidates amongst hypothetical proteins of Treponema pallidum ssp. pallidum.

    Science.gov (United States)

    Naqvi, Ahmad Abu Turab; Shahbaaz, Mohd; Ahmad, Faizan; Hassan, Md Imtaiyaz

    2015-01-01

    Syphilis is a globally occurring venereal disease, and its infection is propagated through sexual contact. The causative agent of syphilis, Treponema pallidum ssp. pallidum, a Gram-negative sphirochaete, is an obligate human parasite. Genome of T. pallidum ssp. pallidum SS14 strain (RefSeq NC_010741.1) encodes 1,027 proteins, of which 444 proteins are known as hypothetical proteins (HPs), i.e., proteins of unknown functions. Here, we performed functional annotation of HPs of T. pallidum ssp. pallidum using various database, domain architecture predictors, protein function annotators and clustering tools. We have analyzed the sequences of 444 HPs of T. pallidum ssp. pallidum and subsequently predicted the function of 207 HPs with a high level of confidence. However, functions of 237 HPs are predicted with less accuracy. We found various enzymes, transporters, binding proteins in the annotated group of HPs that may be possible molecular targets, facilitating for the survival of pathogen. Our comprehensive analysis helps to understand the mechanism of pathogenesis to provide many novel potential therapeutic interventions. PMID:25894582

  4. Transfer of soft kernel texture from Triticum aestivum to durum wheat, Triticum turgidum ssp. durum

    Science.gov (United States)

    Durum wheat (Triticum turgidum ssp. durum) is a leading cereal grain whose primary use is the production of semolina and then pasta. Its rich culinary relationship to humans is related, in part, to its very hard kernel texture. This very hard texture is due to the loss of the Puroindoline genes whi...

  5. Effect of Mo-Doped Mesoporous Al-SSP Catalysts for the Catalytic Dehydration of Ethanol to Ethylene

    Directory of Open Access Journals (Sweden)

    Titinan Chanchuey

    2016-01-01

    Full Text Available The catalytic dehydration of ethanol to ethylene over the mesoporous Al-SSP and Mo-doped Al-SSP catalysts was investigated. The Al-SSP catalyst was first synthesized by the modified sol-gel method and then doped with Mo by impregnation to obtain 1% Mo/Al-SSP and 5% Mo/Al-SSP catalysts (1 and 5 wt% of Mo. The final catalysts were characterized using various techniques such as XRD, N2 physisorption, SEM/EDX, TEM, and NH3-TPD. The catalytic activity for all catalysts in gas-phase ethanol dehydration reaction was determined at temperature range of 200°C to 400°C. It was found that the most crucial factor influencing the catalytic activities appears to be the acidity. The acid property of catalysts depended on the amount of Mo loading. Increased Mo loading in Al-SSP resulted in increased weak acid sites, which enhanced the catalytic activity. Besides acidity, the high concentration of Al at surface of catalyst is also essential to obtain high activity. Based on the results, the most suitable catalyst in this study is 1% Mo/Al-SSP catalyst, which can produce ethylene yield of ca. 90% at 300°C with slight amounts of diethyl ether (DEE and acetaldehyde.

  6. Identification and Evolution of Functional Alleles of the Previously Described Pollen Specific Myrosinase Pseudogene AtTGG6 in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Lili Fu

    2016-02-01

    Full Text Available Myrosinases are β-thioglucoside glucohydrolases and serve as defense mechanisms against insect pests and pathogens by producing toxic compounds. AtTGG6 in Arabidopsis thaliana was previously reported to be a myrosinase pseudogene but specifically expressed in pollen. However, we found that AlTGG6, an ortholog to AtTGG6 in A. lyrata (an outcrossing relative of A. thaliana was functional, suggesting that functional AtTGG6 alleles may still exist in A. thaliana. AtTGG6 alleles in 29 A. thaliana ecotypes were cloned and sequenced. Results indicate that ten alleles were functional and encoded Myr II type myrosinase of 512 amino acids, and myrosinase activity was confirmed by overexpressing AtTGG6 in Pichia pastoris. However, the 19 other ecotypes had disabled alleles with highly polymorphic frame-shift mutations and diversified sequences. Thirteen frame-shift mutation types were identified, which occurred independently many times in the evolutionary history within a few thousand years. The functional allele was expressed specifically in pollen similar to the disabled alleles but at a higher expression level, suggesting its role in defense of pollen against insect pests such as pollen beetles. However, the defense function may have become less critical after A. thaliana evolved to self-fertilization, and thus resulted in loss of function in most ecotypes.

  7. An Arabidopsis callose synthase

    DEFF Research Database (Denmark)

    Ostergaard, Lars; Petersen, Morten; Mattsson, Ole;

    2002-01-01

    unclear whether callose synthases can also produce cellulose and whether plant cellulose synthases may also produce beta-1,3-glucans. We describe here an Arabidopsis gene, AtGsl5, encoding a plasma membrane-localized protein homologous to yeast beta-1,3-glucan synthase whose expression partially......Beta-1,3-glucan polymers are major structural components of fungal cell walls, while cellulosic beta-1,4-glucan is the predominant polysaccharide in plant cell walls. Plant beta-1,3-glucan, called callose, is produced in pollen and in response to pathogen attack and wounding, but it has been...

  8. Expression of an Antisense BcMF3 Affects Microsporogenesis and Pollen Tube Growth in Arabidopsis

    Institute of Scientific and Technical Information of China (English)

    LIU Le-cheng; CAO Jia-shu; YU Xiao-lin; XIANG Xun; FEI Yong-jun

    2006-01-01

    In an effort to provide some information relevant to the molecular mechanism of genic male sterility in plants, BcMF3 gene that encodes a pectin methylesterase was isolated from the fertile B line of Chinese cabbage-pak-choi (Brassica rapa ssp.chinensis, syn. B. campestris ssp. chinensis). In the present paper, a 455-bp antisense cDNA fragment of BcMF3 was introduced to binary vector pBI121, and then was mobilized into Agrobacterium tumefaciens strain LBA4404. The A.tumefaciens harboring the BcMF3 antisense fragment was transformed to Arabidopsis thaliana by floral dip. Scanning electronic microscopy examination demonstrated that 47.8% of BcMF3 antisense pollen grains exhibited abnormal shape,which might lead to decreased germination of pollens, suggesting that the product of BcMF3 gene plays an important role during microsporogenesis. The evidence on burst of 45.7% of BcMF3 antisense pollen tubes in vitro and a majority of BcMF3 antisense pollens restricted within the stigmatic tissue revealed that BcMF3 is involved in aiding the growth of pollen tubes. The results suggest that BcMF3 acts at both stages of microsporogensis and pollen tube growth.

  9. Photorepair mutants of Arabidopsis

    International Nuclear Information System (INIS)

    UV radiation induces two major DNA damage products, the cyclobutane pyrimidine dimer (CPD) and, at a lower frequency, the pyrimidine (6-4) pyrimidinone dimer (6-4 product). Although Escherichia coli and Saccharomyces cerevisiae produce a CPD-specific photolyase that eliminates only this class of dimer, Arabidopsis thaliana, Drosophila melanogaster, Crotalus atrox, and Xenopus laevis have recently been shown to photoreactivate both CPDs and 6-4 products. We describe the isolation and characterization of two new classes of mutants of Arabidopsis, termed uvr2 and uvr3, that are defective in the photoreactivation of CPDs and 6-4 products, respectively. We demonstrate that the CPD photolyase mutation is genetically linked to a DNA sequence encoding a type II (metazoan) CPD photolyase. In addition, we are able to generate plants in which only CPDs or 6-4 products are photoreactivated in the nuclear genome by exposing these mutants to UV light and then allowing them to repair one or the other class of dimers. This provides us with a unique opportunity to study the biological consequences of each of these two major UV-induced photoproducts in an intact living system

  10. Mycoplasma hominis ssp. associated endocarditis with myocardial necrosis in an alpaca (Vicugna pacos) in Manitoba in 2011

    OpenAIRE

    Tomczyk, Krzysztof M.; Copeland, Shelagh; Postey, Rosemary; Ngeleka, Musangu

    2015-01-01

    Severe endocarditis with myonecrosis, moderate to severe pleural and pericardial effusions, and mild ascites were found on necropsy in 3 alpacas. Mycoplasma hominis ssp. was detected on polymerase chain reaction (PCR) of fresh affected endocardial tissue in 1 alpaca.

  11. Whole Genome Sequence of Treponema pallidum ssp. pallidum, Strain Mexico A, Suggests Recombination between Yaws and Syphilis Strains

    OpenAIRE

    Pětrošová, Helena; Zobaníková, Marie; Čejková, Darina; Mikalová, Lenka; Pospíšilová, Petra; Strouhal, Michal; Chen, Lei; Qin, Xiang; Muzny, Donna M; Weinstock, George M.; Šmajs, David

    2012-01-01

    Background Treponema pallidum ssp. pallidum (TPA), the causative agent of syphilis, and Treponema pallidum ssp. pertenue (TPE), the causative agent of yaws, are closely related spirochetes causing diseases with distinct clinical manifestations. The TPA Mexico A strain was isolated in 1953 from male, with primary syphilis, living in Mexico. Attempts to cultivate TPA Mexico A strain under in vitro conditions have revealed lower growth potential compared to other tested TPA strains. Methodology/...

  12. Susceptibility of wild carrot (Daucus carota ssp. carota) to Sclerotinia sclerotiorum

    DEFF Research Database (Denmark)

    Jensen, Brita Dahl; Finckh, M.R.; Munk, Lisa;

    2008-01-01

    Sclerotinia soft rot, caused by Sclerotinia sclerotiorum, is a severe disease of cultivated carrots (Daucus carota ssp. sativus) in storage. It is not known whether Sclerotinia soft rot also affects wild carrots (D. carota ssp. carota), which hybridise and exchange genes, among them resistance...... genes, with the cultivated carrot. We investigated the susceptibility of wild carrots to S. sclerotiorum isolates from cultivated carrot under controlled and outdoor conditions. Inoculated roots from both wild and cultivated plants produced sclerotia and soft rot in a growth chamber test. Two isolates...... differed significantly in the ability to produce lesions and sclerotia on roots of both wild carrots and cv. Bolero. Flowering stems of wild carrots produced dry, pale lesions after inoculation with the pathogen, and above-ground plant weight was significantly reduced 4 weeks after inoculation...

  13. Chemical Composition and Antimicrobial Activity of Thymus praecox Opiz ssp. polytrichus Essential Oil from Serbia

    Directory of Open Access Journals (Sweden)

    Nada V. Petrović

    2016-03-01

    Full Text Available Chemical composition and antimicrobial activity of the essential oil of wild growing Thymus praecox Opiz ssp. polytrichus were studied. trans-Nerolidol (19.79%, germacrene D (18.48% and thymol (9.62% were the main components in essential oil. This study is the first report of the antimicrobial activity of essential oil obtained from the T. praecox Opiz ssp. polytrichus. Antimicrobial activity of essential oil was investigated on Bacillus cereus, Micrococcus flavus, Staphylococcus aureus, Listeria monocytogenes, Escherichia coli, Pseudomonas aeruginosa, Enterobacter cloacae, Salmonella typhimurium, Aspergillus fumigatus, A. versicolor, A. ochraceus, A. niger, Trichoderma viride, Penicillium funiculosum, P. ochrochloron, and P. verrucosum var. cyclopium strains. In the antimicrobial assays, essential oil showed high antimicrobial potential (MIC 19–150 m g/mL, MBC 39–300 m g/mL for bacteria; and MIC 19.5–39 m g/mL, MFC 39–78 m g/mL for fungi.

  14. Chemical Composition of Different Botanical Origin Honeys Produced by Sicilian Black Honeybees (Apis mellifera ssp. sicula).

    Science.gov (United States)

    Mannina, Luisa; Sobolev, Anatoly P; Di Lorenzo, Arianna; Vista, Silvia; Tenore, Gian Carlo; Daglia, Maria

    2015-07-01

    In 2008 a Slow Food Presidium was launched in Sicily (Italy) for an early warning of the risk of extinction of the Sicilian native breed of black honeybee (Apis mellifera L. ssp sicula). Today, the honey produced by these honeybees is the only Sicilian honey produced entirely by the black honeybees. In view of few available data regarding the chemical composition of A. mellifera ssp. sicula honeys, in the present investigation the chemical compositions of sulla honey (Hedysarum coronarium L.) and dill honey (Anethum graveolens L.) were studied with a multimethodological approach, which consists of HPLC-PDA-ESI-MSn and NMR spectroscopy. Moreover, three unifloral honeys (lemon honey (obtained from Citrus limon (L.) Osbeck), orange honey (Citrus arantium L.), and medlar honey (Eriobotrya japonica (Thunb.) Lindl)), with known phenol and polyphenol compositions, were studied with NMR spectroscopy to deepen the knowledge about sugar and amino acid compositions. PMID:25730368

  15. SSP: a simple software process for small- size software development projects

    OpenAIRE

    Ochoa, Sergio; Pino, José A.; Luis A. Guerrero; Cesar A Collazos

    2006-01-01

    A large number of software development projects in Latin- American countries are small-size, poorly defined and time pressured. These projects usually involve under qualified people. Provided that well-known software development models have shown limited applicability in such scenario, developers usually carry out ad-hoc software processes. Therefore, the obtained results are unpredictable. This article presents a Simple Software Process (SSP) for small-size software projects involving under ...

  16. Stem rust (Puccinia graminis ssp. graminicola Urban) its hosts and harmfulness in grasses grown for seed

    OpenAIRE

    Maria Prończuk

    2013-01-01

    Stem rust development on four species of grasses was studied in field experiments conducted at Radzików in 1997-2001. Population of Puccinia graminis ssp. graminicola from different hosts was characterised and their harmfulness for grass grown for seed was estimated. The materials for study were ecotypes and strains of Lolium perenne, Festuca rubra, Poa pratensis and Deschampsia caespitosa collected in breeding nursery and cultivars and strains of L.perenne, F.rubra, P.pratensis cultivated f...

  17. Stem rust (Puccinia graminis ssp. graminicola Urban its hosts and harmfulness in grasses grown for seed

    Directory of Open Access Journals (Sweden)

    Maria Prończuk

    2013-12-01

    Full Text Available Stem rust development on four species of grasses was studied in field experiments conducted at Radzików in 1997-2001. Population of Puccinia graminis ssp. graminicola from different hosts was characterised and their harmfulness for grass grown for seed was estimated. The materials for study were ecotypes and strains of Lolium perenne, Festuca rubra, Poa pratensis and Deschampsia caespitosa collected in breeding nursery and cultivars and strains of L.perenne, F.rubra, P.pratensis cultivated for seed. It was found that the changes in environmental conditions during last years influenced earlier occurrence of stem rust on grasses in Poland. All examined species were the host of P.graminis ssp. graminicola, however the period of infection of particular hosts were different. L.perenne and D.caespitosa were infected in early summer but F.rubra and P.pratensis in late summer or in the autumn. Morphological analysis of spores of P.graminis ssp. graminicola have shoved significant differences between populations obtained from L.perenne and D.caespitosa. Some differences were found between populations from F.rubra and P.pratensis also, but they need more study. Every year occurrence of stem rust on L.perenne and D.caespitosa and its relation with spring temperature in Radzików indicated that populations of patogen could overwinter in local turf. Incidental appearance of stem rust on F.rubra and P.pratensis in centre of Poland allowed to suppose that spores of these forms might be transfer by wind from other regions. The investigation revealed that stem rust can be dangerous for L.perenne grown for seed when infection occurs at flowering time. It has been established that infection of F.rubra and P.pratensis in autumn should not be disregarded. Damages of leaves by P.graminis ssp. graminicola substantially limited plant heading in the next year.

  18. Khorasan wheat population researching (Triticum turgidum, ssp. Turanicum (McKey) in the minimum tillage conditions

    OpenAIRE

    Ikanović Jela; Popović Vera; Janković Snežana; Živanović Ljubiša; Rakić Sveto; Dončić Dalibor

    2014-01-01

    Khorasan wheat occupies a special place in the group of new-old cereals (Triticum turgidum, ssp. Turanicum McKey). It is an ancient species, native to eastern Persia, that is very close to durum wheat by morphological characteristics. Investigations were carried out in agro ecological conditions of the eastern Srem, with two wheat populations with dark and bright awns as objects of study. The following morphological and productive characteristics were inves...

  19. Failure of PCR to Detect Treponema pallidum ssp. pertenue DNA in Blood in Latent Yaws

    OpenAIRE

    Marks, Michael; Katz, Samantha; Chi, Kai-Hua; Vahi, Ventis; Sun, Yongcheng; Mabey, David C.; Solomon, Anthony W; Chen, Cheng Y.; Pillay, Allan

    2015-01-01

    Yaws, caused by Treponema pallidum ssp. pertenue, is a neglected tropical disease closely related to venereal syphilis and is targeted for eradication by 2020. Latent yaws represents a diagnostic challenge, and current tools cannot adequately distinguish between individuals with true latent infection and individuals who are serofast following successful treatment. PCR on blood has previously been shown to detect T. pallidum DNA in patients with syphilis, suggesting that this approach may be o...

  20. Incorporation of probiotic bacteria (Lactobacillus acidophilus and Bifidobacterium ssp.) in Argentinean ovine cheese

    OpenAIRE

    Perotti, María; Wolf, Irma; Addis, Margherita; Comunian, Roberta; Paba, Antonio; Meinardi, Carlos

    2014-01-01

    The market of cheeses from ewe’s milk has been growing steadily in Argentina. The nutritional benefits of these products can be enhanced by adding probiotic cultures. In the present study, the survival of a mix of probiotic microorganisms (Lactobacillus acidophilus La-5 and Bifidobacterium animalis ssp. lactis Bb12) in a semi-hard ovine cheese, manufactured with a technology previously developed in our institute was evaluated. Besides, the effect of its incorporation on the chemical compositi...

  1. Brain SPECT analysis by 3D-SSP and clinical features of Parkinson's disease

    International Nuclear Information System (INIS)

    The aim of the present study is to investigate the association of symptoms in Parkinson's disease (PD) with cerebral perfusion on single photon emission computed tomography (SPECT). The clinical features of PD were compared with SPECT images of the brain obtained by three-dimensional stereotactic surface projection (3D-SSP) analysis. Thirty-eight patients who had PD without dementia (17 men and 21 women with a mean age of 68.6±4.7 years) were enrolled in this study. Their symptoms were rated using the unified parkinson's disease rating scale (UPDRS). Within a week, all patients were examined by SPECT with I-123, and reconstructed images were analyzed with 3D-SSP using an image-analysis software, iSSP ver. 3.5. Data on brain surface perfusion extracted by 3D-SSP analysis were compared between the PD patients and the normal control group. The same comparisons were made for subgroups of PD patients with severe symptoms, such as tremor, gait disturbance, bradykinesia, and the UPDRS motor score. Cerebral perfusion was decreased at the anterior cingulate cortex and occipital lobe of the PD patients compared with the normal controls. In the subgroups with severe gait disturbance and severe bradykinesia, additional hypoperfusion was seen at the lateral frontal association and lateral temporal association and the medial frontal gyrus, and by the pixel-by-pixel comparison, perfusion was significantly decreased (p<0.05) at the medial frontal gyrus and anterior cingulate cortex compared with the normal control group. In PD patients, severe gait disturbance and bradykinesia may be correlated with hypoperfusion of the medial aspect of the frontal lobe. This suggests that functional disturbance of the supplementary motor area and other parts of the frontal lobe are involved in the development of gait disturbance and bradykinesia in PD. (author)

  2. L. peruvianum as a source for resistance to C michiganensis ssp. michiganensis in tomato

    OpenAIRE

    Heusden, van, E.C.H.; Vrielink, R.; Lindhout, P.

    1995-01-01

    Twenty three accessions of L. peruvianum were screened for resistance to Clavibater michiganensis ssp. michiganensis (bacterial canker). Resistance was detected in five accessions. One of these, L. peruvianum LA2157 was crossed with a susceptible accession of L. peruvainum and with the cultivated tomato. Evaluation of the segragation of the progenies for disease resistance and of RFLP markers identified several regions that are involved bacterial canker resistance. Two resistance loci cross e...

  3. Failure of PCR to Detect Treponema pallidum ssp. pertenue DNA in Blood in Latent Yaws.

    Science.gov (United States)

    Marks, Michael; Katz, Samantha; Chi, Kai-Hua; Vahi, Ventis; Sun, Yongcheng; Mabey, David C; Solomon, Anthony W; Chen, Cheng Y; Pillay, Allan

    2015-01-01

    Yaws, caused by Treponema pallidum ssp. pertenue, is a neglected tropical disease closely related to venereal syphilis and is targeted for eradication by 2020. Latent yaws represents a diagnostic challenge, and current tools cannot adequately distinguish between individuals with true latent infection and individuals who are serofast following successful treatment. PCR on blood has previously been shown to detect T. pallidum DNA in patients with syphilis, suggesting that this approach may be of value in yaws. We performed real-time PCR for Treponema pallidum ssp. pertenue on blood samples from 140 children with positive T. pallidum Particle Agglutination (TPPA) and Rapid Plasma Reagin (RPR) tests and 7 controls (negative serology), all collected as part of a prospective study of yaws in the Solomon Islands. All samples were also tested by a nested PCR for T. pallidum. 12 patients had clinical evidence of active yaws whilst 128 were considered to have latent yaws. 43 children had high titre rapid plasma reagins (RPRs) of ≥1:32. PCR testing with both assays gave negative results in all cases. It is possible that the failure to detect T. pallidum ssp. pertenue in blood reflects lower loads of organism in latent yaws compared to those in latent infection with T. pallidum ssp. pertenue, and/or a lower propensity for haematogenous dissemination in yaws than in syphilis. As the goal of the yaws control programme is eradication, a tool that can differentiate true latent infection from individuals who are serofast would be of value; however, PCR of blood is not that tool. PMID:26125585

  4. Failure of PCR to Detect Treponema pallidum ssp. pertenue DNA in Blood in Latent Yaws.

    Directory of Open Access Journals (Sweden)

    Michael Marks

    Full Text Available Yaws, caused by Treponema pallidum ssp. pertenue, is a neglected tropical disease closely related to venereal syphilis and is targeted for eradication by 2020. Latent yaws represents a diagnostic challenge, and current tools cannot adequately distinguish between individuals with true latent infection and individuals who are serofast following successful treatment. PCR on blood has previously been shown to detect T. pallidum DNA in patients with syphilis, suggesting that this approach may be of value in yaws. We performed real-time PCR for Treponema pallidum ssp. pertenue on blood samples from 140 children with positive T. pallidum Particle Agglutination (TPPA and Rapid Plasma Reagin (RPR tests and 7 controls (negative serology, all collected as part of a prospective study of yaws in the Solomon Islands. All samples were also tested by a nested PCR for T. pallidum. 12 patients had clinical evidence of active yaws whilst 128 were considered to have latent yaws. 43 children had high titre rapid plasma reagins (RPRs of ≥1:32. PCR testing with both assays gave negative results in all cases. It is possible that the failure to detect T. pallidum ssp. pertenue in blood reflects lower loads of organism in latent yaws compared to those in latent infection with T. pallidum ssp. pertenue, and/or a lower propensity for haematogenous dissemination in yaws than in syphilis. As the goal of the yaws control programme is eradication, a tool that can differentiate true latent infection from individuals who are serofast would be of value; however, PCR of blood is not that tool.

  5. Patogenicidad de "Phytophthora spp." causantes de podredumbre radical de "Quercus ilex ssp." "ballota" en viveros forestales

    OpenAIRE

    Andicoberry de los Reyes, Sergio; M. E. Sánchez; Trapero Casas, Antonio

    2004-01-01

    Within a research project on quality of plants for forestation of agricultural lands, we studied the etiology of a root rot affecting holm oak (Quercus ilex ssp. ballota) seedlings in two forest nurseries in southern Spain. Major disease symptoms were foliar wilting and necrosis of feeder roots. Three fungal species, Phytophthora cinnamomi, P. cryptogea and P. drechsleri, were isolated from necrotic roots of holm oak. Isolates of the three species showed similar growth patterns at different t...

  6. Complete genome sequence of Treponema pallidum ssp. pallidum strain SS14 determined with oligonucleotide arrays

    OpenAIRE

    Sodergren Erica; Petrosino Joseph F; Palzkill Timothy; Norris Steven J; Šmajs David; Strouhal Michal; Matějková Petra; Norton Jason E; Singh Jaz; Richmond Todd A; Molla Michael N; Albert Thomas J; Weinstock George M

    2008-01-01

    Abstract Background Syphilis spirochete Treponema pallidum ssp. pallidum remains the enigmatic pathogen, since no virulence factors have been identified and the pathogenesis of the disease is poorly understood. Increasing rates of new syphilis cases per year have been observed recently. Results The genome of the SS14 strain was sequenced to high accuracy by an oligonucleotide array strategy requiring hybridization to only three arrays (Comparative Genome Sequencing, CGS). Gaps in the resultin...

  7. Transgenic Arabidopsis Gene Expression System

    Science.gov (United States)

    Ferl, Robert; Paul, Anna-Lisa

    2009-01-01

    The Transgenic Arabidopsis Gene Expression System (TAGES) investigation is one in a pair of investigations that use the Advanced Biological Research System (ABRS) facility. TAGES uses Arabidopsis thaliana, thale cress, with sensor promoter-reporter gene constructs that render the plants as biomonitors (an organism used to determine the quality of the surrounding environment) of their environment using real-time nondestructive Green Fluorescent Protein (GFP) imagery and traditional postflight analyses.

  8. Environmental Restoration and Waste Management Site-Specific Plan (SSP) for fiscal year 1992 (FY92)

    International Nuclear Information System (INIS)

    The FY-92 Site-Specific Plan (FY-92 SSP) for environmental restoration and waste management at the Idaho National Engineering Laboratory (INEL) is designed to provide the reader with easy access to the status of environmental restoration and waste management activities at INEL. The first chapter provides background on INIEL's physical environment, site history and mission, and general information about the site and its facilities. In addition, this chapter discusses the inter-relationships between the Site Specific Plan, the Environmental Restoration and Waste Management Five-Year Plan, the environmental restoration and waste management prioritization systems, and the Activity Data Sheets (ADSs) for environmental restoration and waste management. This discussion should help readers understand what the SSP is and how it fits into the environmental restoration and waste management process at INEL. This understanding should provide the reader with a better context for understanding the discussions in the SSP as well as a better feel for how and what to comment on during the public comment period that will be held from the first of September through the end of October 1991

  9. The catalase gene differentiates between some strains of Staphylococcus aureus ssp. anaerobius.

    Science.gov (United States)

    Musa, N O; Eltom, K; Gessler, F; Böhnel, H; Babiker, A; El Sanousi, S M

    2010-05-01

    Staphylococcus aureus ssp anaerobius strain S10 was isolated from an outbreak of sheep abscess disease. Sequence of the catalase gene of this strain showed 99% identity to the catalase gene (katB) sequence of the reference strain (S. aureus ssp. anaerobius strain MVF213) with mismatching of three base pairs. An important substitution located 1036 nucleotides upstream of the initiation codon from "C" in katB to "T" in the catalase gene of strain S10 originated a stop codon. The deduced protein (345 amino acids) is 105 amino acids shorter than that of katB. Partial sequence of the catalase gene of other 8 local isolates in addition to another reference strain (DSM 20714/ATCC 35844) revealed the same mutations in all local (African) strains, whereas the sequence of the reference (European) strain was typical to that of katB. Sequence of the catalase gene of S. aureus ssp. anaerobius strain S10 was deposited in GenBank under accession no. EU281993. PMID:20526831

  10. Evaluation of different DNA-based fingerprinting methods for typing Photobacterium damselae ssp. piscicida.

    Science.gov (United States)

    Mancuso, Monique; Avendaño-Herrera, Rubén; Zaccone, R; Toranzo, Alicia E; Magariños, Beatriz

    2007-01-01

    This study evaluates the effectiveness of three different molecular techniques, repetitive extragenic palindromic PCR (REP-PCR), enterobacterial repetitive intergenic consensus sequence PCR (ERIC-PCR) and the random amplified polymorphic DNA (RAPD-PCR) for rapid typing of Photobacterium damselae ssp. piscicida strains isolated from different species of marine fish and geographic areas. The results obtained by the three methods showed that RAPD and ERIC-PCR were more discriminative for suitable rapid typing of Ph. damselae ssp. piscicida than REP-PCR. The analysis of DNA banding patterns generated by both molecular methods (RAPD and ERIC-PCR) clearly separated the strains into two main groups that strongly correlated with their geographic origin. Moreover, the REP-PCR analysis was less reproducible than the RAPD and ERIC-PCR methods and does not allow the establishment of genetic groups. RAPD and ERIC-PCR constitute valuable tools for molecular typing of Ph. damselae ssp. piscicida strains, which can be used in epidemiological studies of photobacteriosis infections. PMID:17657358

  11. Intraspecific variability of cadmium tolerance and accumulation, and cadmium-induced cell wall modifications in the metal hyperaccumulator Arabidopsis halleri.

    Science.gov (United States)

    Meyer, Claire-Lise; Juraniec, Michal; Huguet, Stéphanie; Chaves-Rodriguez, Elena; Salis, Pietro; Isaure, Marie-Pierre; Goormaghtigh, Erik; Verbruggen, Nathalie

    2015-06-01

    Certain molecular mechanisms of Cd tolerance and accumulation have been identified in the model species Arabidopsis halleri, while intraspecific variability of these traits and the mechanisms of shoot detoxification were little addressed. The Cd tolerance and accumulation of metallicolous and non-metallicolous A. halleri populations from different genetic units were tested in controlled conditions. In addition, changes in shoot cell wall composition were investigated using Fourier transform infrared spectroscopy. Indeed, recent works on A. halleri suggest Cd sequestration both inside cells and in the cell wall/apoplast. All A. halleri populations tested were hypertolerant to Cd, and the metallicolous populations were on average the most tolerant. Accumulation was highly variable between and within populations, and populations that were non-accumulators of Cd were identified. The effect of Cd on the cell wall composition was quite similar in the sensitive species A. lyrata and in A. halleri individuals; the pectin/polysaccharide content of cell walls seems to increase after Cd treatment. Nevertheless, the changes induced by Cd were more pronounced in the less tolerant individuals, leading to a correlation between the level of tolerance and the extent of modifications. This work demonstrated that Cd tolerance and accumulation are highly variable traits in A. halleri, suggesting adaptation at the local scale and involvement of various molecular mechanisms. While in non-metallicolous populations drastic modifications of the cell wall occur due to higher Cd toxicity and/or Cd immobilization in this compartment, the increased tolerance of metallicolous populations probably involves other mechanisms such as vacuolar sequestration. PMID:25873677

  12. Ectopic Expression of the Chinese Cabbage Malate Dehydrogenase Gene Promotes Growth and Aluminum Resistance in Arabidopsis.

    Science.gov (United States)

    Li, Qing-Fei; Zhao, Jing; Zhang, Jing; Dai, Zi-Hui; Zhang, Lu-Gang

    2016-01-01

    Malate dehydrogenases (MDHs) are key metabolic enzymes that play important roles in plant growth and development. In the present study, we isolated the full-length and coding sequences of BraMDH from Chinese cabbage [Brassica campestris L. ssp. pekinensis (Lour) Olsson]. We conducted bioinformatics analysis and a subcellular localization assay, which revealed that the BraMDH gene sequence contained no introns and that BraMDH is localized to the chloroplast. In addition, the expression pattern of BraMDH in Chinese cabbage was investigated, which revealed that BraMDH was heavily expressed in inflorescence apical meristems, as well as the effect of BraMDH overexpression in two homozygous transgenic Arabidopsis lines, which resulted in early bolting and taller inflorescence stems. Furthermore, the fresh and dry weights of aerial tissue from the transgenic Arabidopsis plants were significantly higher than those from the corresponding wild-type plants, as were plant height, the number of rosette leaves, and the number of siliques produced, and the transgenic plants also exhibited stronger aluminum resistance when treated with AlCl3. Therefore, our results suggest that BraMDH has a dramatic effect on plant growth and that the gene is involved in both plant growth and aluminum resistance. PMID:27536317

  13. Investigation of biological activity of polar extracts isolated from Phlomis crinita Cav ssp. mauritanica Munby.

    Science.gov (United States)

    Limem-Ben Amor, Ilef; Skandrani, Ines; Boubaker, Jihed; Ben Sghaïer, Mohamed; Neffati, Aicha; Bhouri, Wissem; Bouhlel, Ines; Chouchane, Nabil; Kilani, Soumaya; Guedon, Emmanuel; Ghoul, Mohamed; Ghedira, Kamel; Chekir-Ghedira, Leila

    2009-01-01

    The lyophilized infusion, the methanol, the ethyl acetate, and the total oligomer flavonoid (TOF)-enriched extracts prepared from the dried leaves of Phlomis crinita Cav. ssp. mauritanica Munby were investigated for the contents of flavonoids, tannins, coumarines and steroids. Antibacterial activity was investigated toward five bacterial strains. An inhibitory effect was observed against Staphyllococcus aureus and Enterococcus feacalis, and the minimal inhibitory concentrations ranged from 2.5 to 5 mg/mL of extract. The tested extracts exhibit an important free radical scavenging activity toward the 1,1-diphenyl 2-picrylhydrazyl (DPPH) free radical; with IC(50) values of 30.5, 6, 32, and 31.5 microg/mL, respectively, in the presence of lyophilized infusion, the TOF, the methanol, and the ethyl acetate extracts. Genotoxic and antigenotoxic properties of the different extracts were studied by using the SOS chromotest with Escherichia coli PQ37. The lyophilized infusion and TOF extracts obtained from P. crinita ssp. mauritanica showed no genotoxicity, whereas methanol and ethyl acetate extracts are considered as marginally genotoxic. On the other hand, we showed that each extract inhibited the mutagenicity induced by aflatoxin B1 (AFB1) (10 microg/assay) and nifuroxazide (NF) (10 microg/assay). The ethyl acetate extract showed the strongest level of protection toward the genotoxicity induced by both directly and indirectly genotoxic NF and AFB1. These tests proved that the lyophilized infusion possesses an antiradical activity likewise, it showed no genotoxic effect; that is why we choose this extract to assess its antiulcerogenic activity by using an ethanol-induced ulcerogenesis model in the rat. This test demonstrates that 300 mg/kg of a P. crinita ssp. mauritanica lyophilized infusion was more effective than the reference compound, cimetidine. PMID:19514937

  14. Regional cerebral blood flow in pure dysarthria. A 3D-SSP study

    International Nuclear Information System (INIS)

    Pure dysarthria from brain infarction is a rare condition, and its pathophysiology remains unclear. To clarify the underlying mechanism of pure dysarthria, we investigated the lesion sites and regional cerebral blood flow in patients with pure dysarthria. We examined 18 consecutive patients with pure dysarthria (9 men and 9 women; mean age, 71 years) who underwent MRI and cerebral blood flow studies. To visualize the regional cerebral blood flow, we generated Z score images using the three-dimensional stereotactic surface projection (3D-SSP) method with single-photon emission computed tomography (SPECT) and N-isopropyl-p [123I]iodoamphetamine. Data on the brain surface perfusion extracted by the 3D-SSP analysis were compared between the pure dysarthria (PD) patients and 9 control subjects. MRI revealed multiple lacunar infarctions involving the internal capsule and/or corona radiata in 11 patients, left internal capsule-corona radiata infarction in 4 patients, and pontine infarction in 3 patients. SPECT with 3D-SSP demonstrated bilateral frontal cortical hypoperfusion in all patients, particularly in the anterior opercular region. Based on intergroup comparisons, the PD group exhibited pronounced cortical hypoperfusion in the opercular and medial frontal regions, left more than right. In conclusion, pure dysarthria is considered to originate from frontal cortical hypoperfusion, mainly in the anterior opercular and medial frontal regions, which is probably due to interruption of the corticosubcortical neural networks relevant to speech expression and articulation. In addition, it is suggested that left hemispheric lesions may make a greater contribution to the development of pure dysarthria than do right ones. (author)

  15. Estudo da viabilidade de Bifidobacterium animalis ssp. lactis em suco de Yacon

    OpenAIRE

    Watanabe, Felipe Miguel Farion

    2013-01-01

    Resumo: A maioria dos produtos probióticos são elaborados à base de leite, com desvantagens aos consumidores intolerantes à lactose, tornando assim produtos probióticos não lácteos vantajosos. O yacon é uma planta que acumula em suas raízes compostos prebióticos conhecidos como frutooligossacarídeos. O objetivo deste trabalho foi produzir o suco de yacon e utilizá-lo como matriz não láctea para a bactéria probiótica Bifidobacterium animalis ssp. lactis. O yacon apresentou rápido escurecimento...

  16. Hypoglycemic and Hypolipidemic Effect of Sida rhombifolia ssp. retusa in Diabetic Induced Animals

    OpenAIRE

    Kamlesh Dhalwal; Vaibhav M. Shinde; Bhagat Singh; Kakasaheb R. Mahadik

    2011-01-01

    In the present study, the anti-diabetic effect of aqueous extract of Sida rhombifolia ssp. retusa (Malvaceae) leaves was studied in normal and streptozotocin (STZ)-induced (60 mg/kg, single intraperitoneal injection) diabetic rats. Hypoglycemic activity in normal rats was tested after administration of 200 mg/kg of extract.Aqueous extract showed a 15% reduction in plasma glucose level after 1.5 h of extract administration. When tested in STZ-induced diabetic rats the reduction in pla...

  17. Chemical Composition and Possible in Vitro Phytotoxic Activity of Helichrsyum italicum (Roth Don ssp. italicum

    Directory of Open Access Journals (Sweden)

    Vincenzo De Feo

    2011-09-01

    Full Text Available The chemical composition of the essential oil of Helichrysum italicum (Roth Don ssp. italicum, collected in the National Park of Cilento and Diano Valley, Southern Italy, was studied by means of GC and GC/MS. Forty four compounds of 45 constituents were identified in the oil, mainly oxygenated sesquiterpenes. The essential oil was evaluated for its potential in vitro phytotoxic activity against germination and early radicle elongation of radish and garden cress. The radicle elongation of radish was significantly inhibited at the highest doses tested, while germination of both seeds was not affected.

  18. Chemical composition and possible in vitro phytotoxic activity of Helichrsyum italicum (Roth) Don ssp. italicum.

    Science.gov (United States)

    Mancini, Emilia; De Martino, Laura; Marandino, Aurelio; Scognamiglio, Maria Rosa; De Feo, Vincenzo

    2011-01-01

    The chemical composition of the essential oil of Helichrysum italicum (Roth) Don ssp. italicum, collected in the National Park of Cilento and Diano Valley, Southern Italy, was studied by means of GC and GC/MS. Forty four compounds of 45 constituents were identified in the oil, mainly oxygenated sesquiterpenes. The essential oil was evaluated for its potential in vitro phytotoxic activity against germination and early radicle elongation of radish and garden cress. The radicle elongation of radish was significantly inhibited at the highest doses tested, while germination of both seeds was not affected. PMID:21904272

  19. PENGEMBANGAN SUBJECT SPECIFIC PEDAGOGY (SSP IPA TERPADU UNTUK MENINGKATKAN HASIL BELAJAR SISWA

    Directory of Open Access Journals (Sweden)

    Fitri Yuliawati

    2016-05-01

    Full Text Available Background of this research is the analysis of the results of interviews some junior secondary schools in Yogyakarta and the conclusion that teachers do not use an integrated science teaching and teachers still find difficulties in the application of learning science in an integrated manner. It can be influenced by several factors, such as the lack of reference used by teachers in presenting the material Integrated Science relevantly, most of science teachers are from educational background of chemistry, physics, and biology instead of science education, so that teachers find difficulties to create an integrated learning of science. In addition, teachers feel difficulty in determining the depth of the material, limits of integration in integrated science teaching, and did not know the concept of integrated science teaching. This research is a development research. Learning tools developed included : student books, lesson plans, student activity sheets and evaluation tools. The development of the learning which is done in this study use the models of 4D development which includes the step of Define (definition which at this stage conducted a needs analysis. Design : it is the stage of Subject Specific Pedagogy (SSP software design. Development, it is the stage of development after the draft was made followed by a learning device validation by experts. This stage is also conducted to seek input from all the responses, reactions and comments from teachers, students, and observers so that it can be used for further improvement of science teaching later. The Disseminate, it is the stage of field tests are widely but not done. Data collection instruments used in this study include : test items and questionnaire. The conclusion of this development research are as follows : the results of the validation SSP integrated science by learning tools expert, material experts and media experts indicate the category of Very Good (SB so that SSP integrated

  20. Atrocalopteryx melli orohainani ssp. nov. on the Island of Hainan, China (Zygoptera: Calopterygidae)

    OpenAIRE

    Guan, Z.; Han, B-P; Dumont, Henri

    2012-01-01

    The new sp. is described from the mountain core of Hainan, southern China, where it usually occurs at altitudes not lower than 300 m asl. It lives on the same type of small, shaded rivers as the nominate ssp. on the continent, and is distinguished by its larger size, slightly less enfumed wings, and a 2.6% difference in the sequence of the barcoding portion of the mitochodrial DNA-cytochrome c oxidase subunit I gene (COI). Holotype male: Diaoluoshan mountain, 6-VIII-2011; deposited in the Ins...

  1. Full Scale Test of SSP 34m blade, edgewise loading LTT

    DEFF Research Database (Denmark)

    Nielsen, Magda; Jensen, Find Mølholt; Nielsen, Per Hørlyk;

    This report is a part of the research project “Eksperimentel vingeforskning: Strukturelle mekanismer i nutidens og fremtidens store vinger under kombineret last” where a 34m wind turbine blade from SSP-Technology A/S has been tested in edgewise direction (LTT). The applied load is 60% of an...... unrealistic extreme event, corresponding to 75% of a certificated extreme load. This report describes the background, the test set up, the tests and the results. For this project, a new solution has been used for the load application and the solution for the load application is described in this report as...

  2. ENZYMATIC ACTIVITY AND ANTIBIOTIC RESISTANCE PROFILE OF LACTOBACILLUS PARACASEI SSP. PARACASEI-1 ISOLATED FROM REGIONAL YOGURTS OF BANGLADESH

    Directory of Open Access Journals (Sweden)

    Ummay Honi

    2013-12-01

    Full Text Available Lactobacillus paracasei ssp. paracasei-1 was identified from traditional yogurts of Khulna region, Bangladesh and its enzyme and antibiotic resistance profiles were determined. A commercially available API Zym kit was employed to determine the activities of 19 different enzymes. We found that L. paracasei ssp. paracasei-1 showed strong activities for several enzymes, viz. leucine arylamidase, valine arylamidase, napthol-AS-BI-phosphohydrolase, β-galactosidase, α –Glucosidase, N-Acetyl- β- glucosaminidase while activities for other enzymes were absent. Antibiotic resistance profile was assessed by minimum inhibitory concentration (MIC test for 61 major antibiotics and 4 antifungal agents obtained from commercial sources in MRS Agar media. The strain generally showed resistance to gram negative spectrum antibiotic while it showed susceptibility towards β-lactam antibiotic to gram positive spectrum antibiotic. The findings provide the therapeutic basis of using L. paracasei ssp. paracasei-1 in finished food products.

  3. Étude de l'effet antibactérien des huiles essentielles de Thymus ciliatus ssp coloratus

    OpenAIRE

    HADDOUCHE, Khalida

    2015-01-01

    Etude de l'effet antibactérien de l'huile essentielle de Thymus ciliatus ssp coloratus Résumé Les plantes médicinales constituent une source immense de métabolites secondaires, dont les huiles essentielles dotées de nombreuses activités biologiques ; souvent recherchées dans le domaine phytopharmaceutique et en agro-alimentaire. Le présent travail porte sur une étude qualitative du pouvoir antibactérien de l'huile essentielle de la plante médicinale: Thymus ciliatus ssp c...

  4. The Huygens surface science package (SSP): Flight performance review and lessons learned

    Science.gov (United States)

    Leese, M. R.; Lorenz, R. D.; Hathi, B.; Zarnecki, J. C.

    2012-09-01

    The Surface Science Package (SSP) was one of six instruments flown onboard the Huygens probe to Titan, the largest moon of Saturn, in the framework of the NASA/ESA/ASI Cassini-Huygens mission (Matson et al., 2002). The SSP operated throughout the probe's descent and after landing on Titan on 14th January 2005. This paper reviews scientific results from the Surface Science Package, and also reports previously unpublished flight data which illustrate the performance of the measurement systems in the Titan environment. This review provides some lessons learned that may be useful for further detailed analysis of the Huygens mission data, and for payloads for future missions to Titan, in which there has been recent interest (e.g., the Titan Saturn System Mission (TSSM) (Joint TSSM Science Definition Team, 2009), TANDEM (Coustenis et al., 2009) or the Titan Mare Explorer (TiME) Discovery-class proposal (Stofan et al., 2010)), as well as for planetary probe missions more generally.

  5. The Essential Oil Composition of Tanacetum densum (Labill. Heywood ssp. eginense Heywood from Turkey

    Directory of Open Access Journals (Sweden)

    Kaan Polatoğlu

    2012-07-01

    Full Text Available Water-distilled essential oils from aerial parts of Tanacetum densum (L. Heywood ssp. eginense Heywood, from Turkey was analysed by GC and GC-MS. T. densum ssp. eginense flower, stem and leaf oils were characterized with camphor (30.9% , 25.7%, 27.7%, 1,8-Cineole (12.4% flower oil, camphene (10.6%, %7.0, flower and leaf oils, bornyl acetate, (9.4%, 11.8%, stem and leaf oils, α-pinene (7.0%, %5.3, flower and leaf oils , borneol (5.1%, 5.2%, stem and leaf oils, neodihydrocarveol (5.1%, flower oil. An unidentified compound was also present in flower, stem and leaf oils (11.5%, 27.2%, 20.5%. A comparison is done with the previous investigations on the other subspecies of T. densum and the differences were investigated. Flower and stem oils did not show any significant activity to the tested microorganisms when compared to positive control chloramphenicol. Flower and stem oils both showed cytotoxicity to Vibrio fischeri.

  6. Congenital vestibular disease in captive Sumatran tigers (Panthera tigris ssp. sumatrae) in Australasia.

    Science.gov (United States)

    Wheelhouse, Jaimee L; Hulst, Frances; Beatty, Julia A; Hogg, Carolyn J; Child, Georgina; Wade, Claire M; Barrs, Vanessa R

    2015-11-01

    The Sumatran tiger (Panthera tigris ssp. sumatrae) is a critically endangered species in the wild. To ensure that demographic and genetic integrity are maintained in the longer term, those Sumatran tigers held in captivity are managed as a global population under a World Association of Zoos and Aquariums Global Species Management Plan (GSMP). A retrospective study, including segregation and pedigree analysis, was conducted to investigate potential cases of congenital vestibular disease (CVD) in captive Sumatran tigers in Australasian zoos using medical and husbandry records, as well as video footage obtained from 50 tigers between 1975 and 2013. Data from the GSMP Sumatran tiger studbook were made available for pedigree and segregation analysis. Fourteen cases of CVD in 13 Sumatran tiger cubs and one hybrid cub (Panthera tigris ssp. sumatrae × Panthera tigris) were identified. Vestibular signs including head tilt, circling, ataxia, strabismus and nystagmus were observed between birth and 2 months of age. These clinical signs persisted for a median of 237 days and had resolved by 2 years of age in all cases. Pedigree analysis revealed that all affected tigers were closely related and shared a single common ancestor in the last four generations. A genetic cause for the disease is suspected and, based on pedigree and segregation analysis, an autosomal dominant mode of inheritance is likely. Further investigations to determine the world-wide prevalence and underlying pathology of this disorder are warranted. PMID:26403953

  7. Lactoferrin affects the adherence and invasion of Streptococcus dysgalactiae ssp. dysgalactiae in mammary epithelial cells.

    Science.gov (United States)

    O'Halloran, Fiona; Beecher, Christine; Chaurin, Valerie; Sweeney, Torres; Giblin, Linda

    2016-06-01

    Streptococcus dysgalactiae ssp. dysgalactiae is an important causative agent of bovine mastitis worldwide. Lactoferrin is an innate immune protein that is associated with many functions including immunomodulatory, antiproliferative, and antimicrobial properties. This study aimed to investigate the interactions between lactoferrin and a clinical bovine mastitis isolate, Strep. dysgalactiae ssp. dysgalactiae DPC5345. Initially a deliberate in vivo bovine intramammary challenge was performed with Strep. dysgalactiae DPC5345. Results demonstrated a significant difference in lactoferrin mRNA levels in milk cells between the control and infused quarters 7h postinfusion. Milk lactoferrin levels in the Strep. dysgalactiae DPC5345 infused quarters were significantly increased compared with control quarters at 48h postinfusion. In vitro studies demonstrated that lactoferrin had a bacteriostatic effect on the growth of Strep. dysgalactiae DPC5345 and significantly decreased the ability of the bacteria to internalize into HC-11 mammary epithelial cells. Confocal microscopy images of HC-11 cells exposed to Strep. dysgalactiae and lactoferrin further supported this effect by demonstrating reduced invasion of bacteria to HC-11 cells. The combined data suggest that a bovine immune response to Strep. dysgalactiae infection includes a significant increase in lactoferrin expression in vivo, and based on in vitro data, lactoferrin limits mammary cell invasion of this pathogen by binding to the bacteria and preventing its adherence. PMID:27016824

  8. Overexpression of the Brassica rapa transcription factor WRKY12 results in reduced soft rot symptoms caused by Pectobacterium carotovorum in Arabidopsis and Chinese cabbage.

    Science.gov (United States)

    Kim, H S; Park, Y H; Nam, H; Lee, Y M; Song, K; Choi, C; Ahn, I; Park, S R; Lee, Y H; Hwang, D J

    2014-09-01

    Chinese cabbage (Brassica rapa L. ssp. pekinensis), an important vegetable crop, can succumb to diseases such as bacterial soft rot, resulting in significant loss of crop productivity and quality. Pectobacterium carotovorum ssp. carotovorum (Pcc) causes soft rot disease in various plants, including Chinese cabbage. To overcome crop loss caused by bacterial soft rot, a gene from Chinese cabbage was isolated and characterised in this study. We isolated the BrWRKY12 gene from Chinese cabbage, which is a group II member of the WRKY transcription factor superfamily. The 645-bp coding sequence of BrWRKY12 translates to a protein with a molecular mass of approximately 24.4 kDa, and BrWRKY12 was exclusively localised in the nucleus. Transcripts of BrWRKY12 were induced by Pcc infection in Brassica. Heterologous expression of BrWRKY12 resulted in reduced susceptibility to Pcc but not to Pseudomonas syringae pv. tomato in Arabidopsis. Defence-associated genes, such as AtPDF1.2 and AtPGIP2, were constitutively expressed in transgenic lines overexpressing BrWRKY12. The expression of AtWKRY12, which is the closest orthologue of BrWRKY12, was down-regulated by Pcc in Arabidopsis. However, the Atwrky12-2 mutants did not show any difference in response to Pcc, pointing to a difference in function of WRKY12 in Brassica and Arabidopsis. Furthermore, BrWRKY12 in Chinese cabbage also exhibited enhanced resistance to bacterial soft rot and increased the expression of defence-associated genes. In summary, BrWRKY12 confers enhanced resistance to Pcc through transcriptional activation of defence-related genes. PMID:24552622

  9. The Salmonella type III effector SspH2 specifically exploits the NLR co-chaperone activity of SGT1 to subvert immunity.

    Directory of Open Access Journals (Sweden)

    Amit P Bhavsar

    Full Text Available To further its pathogenesis, S. Typhimurium delivers effector proteins into host cells, including the novel E3 ubiquitin ligase (NEL effector SspH2. Using model systems in a cross-kingdom approach we gained further insight into the molecular function of this effector. Here, we show that SspH2 modulates innate immunity in both mammalian and plant cells. In mammalian cell culture, SspH2 significantly enhanced Nod1-mediated IL-8 secretion when transiently expressed or bacterially delivered. In addition, SspH2 also enhanced an Rx-dependent hypersensitive response in planta. In both of these nucleotide-binding leucine rich repeat receptor (NLR model systems, SspH2-mediated phenotypes required its catalytic E3 ubiquitin ligase activity and interaction with the conserved host protein SGT1. SGT1 has an essential cell cycle function and an additional function as an NLR co-chaperone in animal and plant cells. Interaction between SspH2 and SGT1 was restricted to SGT1 proteins that have NLR co-chaperone function and accordingly, SspH2 did not affect SGT1 cell cycle functions. Mechanistic studies revealed that SspH2 interacted with, and ubiquitinated Nod1 and could induce Nod1 activity in an agonist-independent manner if catalytically active. Interestingly, SspH2 in vitro ubiquitination activity and protein stability were enhanced by SGT1. Overall, this work adds to our understanding of the sophisticated mechanisms used by bacterial effectors to co-opt host pathways by demonstrating that SspH2 can subvert immune responses by selectively exploiting the functions of a conserved host co-chaperone.

  10. Induction and purification of chitinase in Brassica napus L. ssp. oleifera infected with Phoma lingam

    DEFF Research Database (Denmark)

    Rasmussen, U.; Giese, H.; Dalgaard Mikkelsen, J.

    1992-01-01

    after tryptic digestion of the protein shows high sequence similarity to basic chitinases from bean, tobacco, potato, Arabidopsis, barley and rice, as well as to acidic chitinases from tobacco and petunia. A close serological relationship was found between the chitinase isoenzyme and an isoenzyme from...

  11. Chemical composition and antifungal activities of essential oils of Satureja thymbra L. and Salvia pomifera ssp. calycina (Sm.) Hayek

    NARCIS (Netherlands)

    Glamoclija, J.; Sokovic, M.; Vukojevic, J.; Milenkovic, I.; Griensven, van L.J.L.D.

    2006-01-01

    This work covers the chemical composition and antifungal activities of essential oils isolated from savory (Satureja thymbra) and sage (Salvia pomifera ssp. calycina) analyzed using GC/MS. The main components of S. thymbra oil were gamma-terpinene (23.2%) and carvacrol (48.5%). The main components i

  12. Impact of Acacia tortilis ssp. raddiana tree on wheat and barley yield in the south of Tunisia

    Science.gov (United States)

    Noumi, Zouhaier; Abdallah, Fathia; Torre, Franck; Michalet, Richard; Touzard, Blaise; Chaieb, Mohamed

    2011-03-01

    In the past, Acacia tortilis ssp. raddiana (Savi) Brenan colonised thousands of hectares in central and southern Tunisia. Nowadays, the geographical distribution of A. tortilis ssp. raddiana is restricted to the National Park of Bou-Hedma (central Tunisia). The Acacia is of considerable interest for local populations and may be considered as a "foundation species" under arid climate. This study examines the effects of Acacia canopy on soil fertility and cereal productivity. The improvement in soil fertility and microclimate provided by A. tortilis ssp. raddiana is known to facilitate the establishment of new species, but little is known about the interaction between the tree species and the cereals cultivated by local farmers. We studied the effect of A. tortilis ssp. raddiana canopy on the yield of three cereals crops ( Hordeum vulgare L., Triticum sativum L. and Triticum aestivum L.). We seeded 168 plots (15 × 15 m) under the tree canopy and in open areas on four different landform types (glacis, plain, wadis, and jessours) and measured cereal yield over two contrasting years (wet and dry). We found that: (1) precipitation and geomorphology are more important in determining cereal yield than canopy cover, (2) these effects on water availability are species-specific with no effect on the stress-tolerant barley. We finally discuss the potential negative effects of Acacia trees which may have balanced the positive effects found for nutrient in our study.

  13. Note on Celastrus paniculatus Willd. ssp. aggregatus K.M. Matthew ex K.T. Matthew (Celastraceae

    Directory of Open Access Journals (Sweden)

    J.W. Francis

    2012-12-01

    Full Text Available Celastrus L., a large genus of family Celastraceae, is represented by ca 31 species in the world. In India the genus is represented by seven species and one subspecies. This paper deals with addition of Celastrus paniculatus ssp. aggregatus to the flora of Andhra Pradesh, Kerala, Goa and Andaman Islands. A note on its distribution is also provided in this paper.

  14. Introgression of genetic material from Zea mays ssp. Mexicana into cultivated maize was facilitated by tissue culture

    International Nuclear Information System (INIS)

    Zea mays ssp. mexicana, a wild relative of cultivated maize (Z. mays ssp. mays), is a useful gene resource for maize breeding. In this study, two populations were generated by conventional breeding scheme (population I) or tissue culture regime (population II), respectively, to introgress genetic material of Z. mays ssp. mexicana into maize. Karyotype analysis showed that the arm ratios of 10 pairs of chromosomes in parent maize Ye515 and derivative lines from 2 different populations with 26% and 38% chromosome variation frequencies, respectively. Alien chromatin was detected in the root tip cells of progeny plants through genomic in situ hybridization (GISH). There were 3.3 chromosomes carrying alien chromatin on average in population I and 6.5 in population II. The hybridization signals were located mainly at the terminal or sub terminal regions of the chromosomes and the sizes were notably variant among lines. Based on those results, it is concluded that the introgression of genetic material from Z. mays ssp. mexicana into cultivated maize was facilitated by tissue culture, and subsequently some excellent materials for maize breeding were created. (author)

  15. CITOGENETICS EFFECTS INDUCED BY THE ASCORBIC ACID TREATMENT OF LARIX DECIDUA MILL. SSP. CARPATICA AND PICEA ABIES (L. KARST

    Directory of Open Access Journals (Sweden)

    Ioana Ieremia

    2006-08-01

    Full Text Available The paper present the influence of ascorbic acid upon the mitotic division of Larix decidua Mill ssp. carpatica and Picea abies (L. Karst. The treatment is applied of two variants, germinated seed in ascorbic acid (variantAand germinated seeds in disttilate water, than treated with ascorbic acid in 3 concentrations (variant B.

  16. A black, non-troglomorphic amphibian from the karst of Slovenia: Proteus anguinus parkelj n. ssp. (Urodela: Proteidae)

    NARCIS (Netherlands)

    Sket, B.; Arntzen, J.W.

    1994-01-01

    A morphologically distinct cavernicolous salamander Proteus anguinus from southeastern Slovenia (Bela Krajina) is described as P. a. parkelj ssp. n. It differs from P. a. anguinus in a dark pigmentation, fully developed eyes, a skull with broader and shorter bones and fewer teeth, a voluminous jaw m

  17. Heterologous Expression and Characterization of an N-Acetyl-beta-D-hexosaminidase from Lactococcus lactis ssp. lactis IL1403

    Czech Academy of Sciences Publication Activity Database

    Nguyen, A. H.; Nguyen, T.-H.; Křen, Vladimír; Eijsink, V. G. H.; Haltrich, D.; Peterbauer, C.

    2012-01-01

    Roč. 60, č. 12 (2012), s. 3275-3281. ISSN 0021-8561 R&D Projects: GA ČR(CZ) GAP207/11/0629 Keywords : N-acetyl-beta-D-hexosaminidase * Lactococcus lactis ssp lactis IL1403 * pNP-GlcNAc Subject RIV: CE - Biochemistry Impact factor: 2.906, year: 2012

  18. Mycoplasma hominis ssp. associated endocarditis with myocardial necrosis in an alpaca (Vicugna pacos) in Manitoba in 2011

    Science.gov (United States)

    Tomczyk, Krzysztof M.; Copeland, Shelagh; Postey, Rosemary; Ngeleka, Musangu

    2015-01-01

    Severe endocarditis with myonecrosis, moderate to severe pleural and pericardial effusions, and mild ascites were found on necropsy in 3 alpacas. Mycoplasma hominis ssp. was detected on polymerase chain reaction (PCR) of fresh affected endocardial tissue in 1 alpaca. PMID:25694661

  19. Combining ability for maturity and plant height in brassica rapa (l.) ssp. dichotoma (roxb.) hanelt

    International Nuclear Information System (INIS)

    A 5 * 5 F1 diallel cross hybrids of Brassica rapa (L.) ssp. dichotoma (Roxb.) Hanelt along with parents were evaluated through combining ability for days to flowering (initiation and completion), days to maturity and plant height. Highly significant differences were recorded for all the traits. Mean squares due to general, specific and reciprocal combining ability were significant for all the traits except plant height for which the latter two components were non-significant. Prevalence of additive (plant height), non-additive (days to flowering completion; days to maturity) and reciprocal effects (days to flowering initiation) were detected. Parental line G-403 was best general combiner for all the traits. The F1 hybrids G-902 * G-265 (days to flowering initiation), G-902 * G-403 (days to flowering completion), G-265 * G-1500 (days to maturity) and G-909 * G-265 (plant height) were superior and may be exploited for future breeding programs. (author)

  20. Herbaspirillum sp. strain GW103 alleviates salt stress in Brassica rapa L. ssp. pekinensis.

    Science.gov (United States)

    Lee, Gun Woong; Lee, Kui-Jae; Chae, Jong-Chan

    2016-05-01

    Mutual interactions between plant and rhizosphere bacteria facilitate plant growth and reduce risks of biotic and abiotic stresses. The present study demonstrates alleviation of salt stress in Brassica rapa L. ssp. perkinensis (Chinese cabbage) by Herbaspirillum sp. strain GW103 isolated from rhizosphere soil of Phragmites australis. The strain was capable of producing plant beneficial factors, such as auxin, siderophore, and 1-aminocylopropane-1-carboxylic acid deaminase. Treatment of strain GW103 on Chinese cabbage under salt stress increased K(+)/Na(+) ratio in roots generating balance in the ratio of ion homeostasis and consequently contributed to the increase of biomass. In addition, root colonization potential of the strain was observed by green fluorescent protein (GFP)-tagging approach. These results strongly suggest the beneficial impact of strain GW103 by inducing the alleviation of salt stress and development of stress tolerance in Chinese cabbage via plant-microbe interaction. PMID:26358119

  1. Antioxidant capacities and polyphenolics of Chinese cabbage (Brassica rapa L. ssp. Pekinensis) leaves.

    Science.gov (United States)

    Seong, Gi-Un; Hwang, In-Wook; Chung, Shin-Kyo

    2016-05-15

    Chinese cabbage (Brassica rapa L. ssp. Pekinensis) is a green leafy vegetable used mainly in kimchi, salted and fermented dishes. Consumer preference for the leaf portion differs according to the type of dishes. In this study, Chinese cabbage was divided into three parts, and their antioxidant activities were investigated through in vitro assays. The total phenolic contents (TPC), total flavonoid contents (TFC), and vitamin C contents were also determined as indicators of antioxidant contents. The phenolic acids and flavonoids were separated and identified using high performance liquid chromatography (HPLC) and liquid chromatography/mass spectrometry (LC/MS). The outer leaf had the strongest antioxidant activity with the maximum antioxidant contents, followed by the mid- and inner leaves. Principal component analysis (PCA) revealed that outer leaf is positively related to caffeic acid, p-coumaric acid, ferulic acid, and myricetin contents, whereas the mid- and inner leaves are negatively related to sinapic acid contents. PMID:26776015

  2. Correction of the structure of a new sesquiterpene from Cistus creticus ssp. creticus.

    Science.gov (United States)

    Hatzellis, Konstantinos; Pagona, Georgia; Spyros, Apostolos; Demetzos, Costas; Katerinopoulos, Haralambos E

    2004-12-01

    In an attempt to identify the structure of a sesquiterpene from Cistus creticus ssp. creticus proposed in the literature as 1,1,4a,6-tetramethyl-5-methylene-1,2,3,4,4alpha,5,8,8alpha-octahydronaphthalene, the synthesis of its cis isomer 2 was carried out in 11 steps and 9.5% yield. Comparison of the spectra of 2 and those reported earlier for the synthetic trans isomer 1 with the spectral profile of the isolated natural product indicated that the latter was not compatible with either 1 or 2. The correct structure was assigned, by detailed spectroscopic analysis of the natural product, as 6-isopropenyl-4,4a-dimethyl-1,2,3,4,4a,5,6,7-octahydronaphthalene (3). PMID:15620240

  3. The identification of MacSe in Streptococcus equi ssp. equi

    Institute of Scientific and Technical Information of China (English)

    Jiande YANG; Yanfei LIU; Jun XU; Jifei MA

    2009-01-01

    Streptococcus equi subsp, equi (S. equi ssp. equi) causes equine strangles, a highly contagious and widespread purulent lymphadenitis of the head and neck. We have identified MacSe, a novel protein of S. equi, by screening a phage library of 3-8 kb random DNA fragments of S. equi CF32. MacSe shares 62% and 67.5% amino acid homology with Mac5005 and Mac8345 of S. pyogenes respectively. Expression during infection was shown by strong reactivity of the protein with convalescent sera and mucosal wash IgA of ponies infected by commingling exposure. Release into the culture medium was detected during the log phase of growth. Dose dependent anti-phagocytic activity for equine neutrophils involved interaction of MacSe with C3 and neutrophils.

  4. Sesquiterpene Lactones of Amphoricarpos autariatus ssp. autariatus from Montenegro - Antifungal Leaf - Surface Constituents

    Directory of Open Access Journals (Sweden)

    Milka Jadranin

    2013-05-01

    Full Text Available The composition of leaf cuticular neutral lipids of Amphoricarpos autariatus ssp. autariatus collected at canyon of river Tara (North Montenegro was investigated by GC/MS (nonpolar fraction, LC-ESI TOF MS and 1H NMR spectroscopy (more polar fraction. The nonpolar fraction (ca. 15% of the whole surface extract contained C 27 - 33 n-alkanes, those with odd-number of carbons predominating. The LC-ESI MS and 1H NMR of the more polar fraction revealed 13 sesquiterpene lactones, constituting ca. 97.5% of the lactone mixture, identified as the known guaianolides, so-called amphoricarpolides, found previously in the aerial parts of the genus. The lactone fraction exhibited considerable in vitro effect against eight fungi, i.e. Aspergillus ochraceus , A. niger, A. versicolor , Penicillium funiculosum, P. ochrochloron, Trichoderma viride, Fusarium verticillioides and Fulvia fulvum.

  5. Full scale test SSP 34m blade, combined load. Data report

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Per H.; Nielsen, Magda; Jensen, Find M. (and others)

    2010-11-15

    This report is part of the research project where a 34m wind turbine blade from SSP-Technology A/S was tested in combined flap and edgewise load. The applied load is 55% of an imaginary extreme event based on the certification load of the blade. This report describes the reason for choosing the loads and the load direction and the method of applying the loads to the blade. A novel load introduction allows the blade to deform in a more realistic manner, allowing the observation of e.g. transverse shear distortion. The global and local deformation of the blade as well as the blades' respond to repeated tests has been studied and the result from these investigations are presented, including the measurements performed. (Author)

  6. Space Shuttle Program (SSP) Shock Test and Specification Experience for Reusable Flight Hardware Equipment

    Science.gov (United States)

    Larsen, Curtis E.

    2012-01-01

    As commercial companies are nearing a preliminary design review level of design maturity, several companies are identifying the process for qualifying their multi-use electrical and mechanical components for various shock environments, including pyrotechnic, mortar firing, and water impact. The experience in quantifying the environments consists primarily of recommendations from Military Standard-1540, Product Verification Requirement for Launch, Upper Stage, and Space Vehicles. Therefore, the NASA Engineering and Safety Center (NESC) formed a team of NASA shock experts to share the NASA experience with qualifying hardware for the Space Shuttle Program (SSP) and other applicable programs and projects. Several team teleconferences were held to discuss past experience and to share ideas of possible methods for qualifying components for multiple missions. This document contains the information compiled from the discussions

  7. Arabidopsis thaliana—Aphid Interaction

    OpenAIRE

    Louis, Joe; Singh, Vijay,; Shah, Jyoti

    2012-01-01

    Aphids are important pests of plants that use their stylets to tap into the sieve elements to consume phloem sap. Besides the removal of photosynthates, aphid infestation also alters source-sink patterns. Most aphids also vector viral diseases. In this chapter, we will summarize on recent significant findings in plant-aphid interaction, and how studies involving Arabidopsis thaliana and Myzus persicae (Sülzer), more commonly known as the green peach aphid (GPA), are beginning to provide impor...

  8. Selenium Speciation in Arabidopsis Thaliana

    OpenAIRE

    Wang, Xiaoou

    2011-01-01

    Selenium has been proved as an essential micronutrient and is beneficial to animals and humans. It is a structural component of the important antioxidant enzyme, glutathione peroxidase, which catalyzes reactions to detoxify reactive oxygen species. However, the essentiality of Se in plants remains controversial and the protective role of Se in plants has rarely been investigated. In this study, Arabidopsis thaliana was grown in controlled environments having selenate or selenite enriched medi...

  9. Stem cell organization in Arabidopsis

    OpenAIRE

    Wendrich, J.R.

    2016-01-01

    Growth of plant tissues and organs depends on continuous production of new cells, by niches of stem cells. Stem cells typically divide to give rise to one differentiating daughter and one non-differentiating daughter. This constant process of self-renewal ensures that the niches of stem cells or meristems stay active throughout plant-life. Specification of stem cells occurs very early during development of the emrbyo and they are maintained during later stages. The Arabidopsis embryo is a hig...

  10. VizieR Online Data Catalog: SSP in NIR. II. Synthesis models (Meneses-Goytia+, 2015)

    Science.gov (United States)

    Meneses-Goytia, S.; Peletier, R. F.; Trager, S. C.; Vazdekis, A.

    2015-08-01

    The present Single Stellar Populations (SSP) models are derived from my Ph.D.'s thesis and this paper. The following nomenclature is used throughout the paper and the website (http://smg.astro-research.net/ssp-models/the-models/) to describe the models, e.g. MarS models use the M08 isochrones (Mar) and the Salpeter (S) IMF. General information about the models is given in table1. For further information, please refer to the paper. Each set of models and their corresponding predictions are available in the website and VIZIER. The spectral energy distributions (SEDs) can be downloaded in a zip-file from those pages in ascii format . The spectral energy distributions (SEDs) can be downloaded in a zip-file from t hose pages in ascii format . The nomenclature of each SED is as follows: isochroneIMFsedXXXXHZX.XXXXXXXXXTgXX.XXXXXXXe+XX - where XXXX tells whether those models contain C-stars or no (COMBO or NOCS respectively) H is the spectral band in which normalization occurred Z_X.XXXXXXXXX is the metallicity in terms of Z Tg_XX.XXXXXXXe+XX is the age in years. Each set of models contains MarS - 96 SEDs GirS - 96 SEDs BaSS - 116 SEDs We have also included in the websites the Integrated colours and line-strength indices from all our models (MarS, GirS and BaSS). The SEDs were convolved to a velocity dispersion of 350km/s before calculating indices. (5 data files).

  11. An International Bioinformatics Infrastructure to Underpin the Arabidopsis Community

    Science.gov (United States)

    The future bioinformatics needs of the Arabidopsis community as well as those of other scientific communities that depend on Arabidopsis resources were discussed at a pair of recent meetings held by the Multinational Arabidopsis Steering Committee (MASC) and the North American Arabidopsis Steering C...

  12. Arabidopsis CDS blastp result: AK106750 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK106750 002-115-C09 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylu ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  13. Arabidopsis CDS blastp result: AK104851 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104851 001-043-A10 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylu ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  14. Arabidopsis CDS blastp result: AK100909 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100909 J023132G24 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylul ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  15. Arabidopsis CDS blastp result: AK058950 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058950 001-020-A07 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylu ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  16. Arabidopsis CDS blastp result: AK059821 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059821 006-205-D11 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylu ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  17. Arabidopsis CDS blastp result: AK064944 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK064944 J013000P14 At4g15560.1 1-deoxy-D-xylulose 5-phosphate synthase, putative / 1-deoxyxylul ... phate synthase, putative / DXP-synthase, putative (DEF ) (CLA1) identical to SP|Q38854 Probable 1-deoxy-D- ... (DXPS). [Mouse-ear cress] {Arabidopsis thaliana}, DEF ... (def icient in photosynthesis) protein [Arabidopsis ...

  18. Arabidopsis CDS blastp result: AK068400 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068400 J013151M04 At3g45810.1 ferric reductase-like transmembrane component family protein sim ... ilar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ... EMBL:AF055357 [gi:3242789], similar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ...

  19. Arabidopsis CDS blastp result: AK066013 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066013 J013047I12 At3g45810.1 ferric reductase-like transmembrane component family protein sim ... ilar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ... EMBL:AF055357 [gi:3242789], similar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ...

  20. Arabidopsis CDS blastp result: AK100241 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100241 J023054P13 At3g45810.1 ferric reductase-like transmembrane component family protein sim ... ilar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ... EMBL:AF055357 [gi:3242789], similar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ...

  1. Arabidopsis CDS blastp result: AK318553 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK318553 J075145A22 At3g45810.1 68416.m04958 ferric reductase-like transmembrane component famil ... y protein similar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ... EMBL:AF055357 [gi:3242789], similar to respiratory burst ... oxidase protein D RbohD from Arabidopsis thaliana, ...

  2. Using "Arabidopsis" Genetic Sequences to Teach Bioinformatics

    Science.gov (United States)

    Zhang, Xiaorong

    2009-01-01

    This article describes a new approach to teaching bioinformatics using "Arabidopsis" genetic sequences. Several open-ended and inquiry-based laboratory exercises have been designed to help students grasp key concepts and gain practical skills in bioinformatics, using "Arabidopsis" leucine-rich repeat receptor-like kinase (LRR RLK) genetic…

  3. Whole Genome Sequences of Three Treponema pallidum ssp. pertenue Strains: Yaws and Syphilis Treponemes Differ in Less than 0.2% of the Genome Sequence

    OpenAIRE

    Čejková, Darina; Zobaníková, Marie; Chen, Lei; Pospíšilová, Petra; Strouhal, Michal; Qin, Xiang; Mikalová, Lenka; Norris, Steven J.; Muzny, Donna M; Gibbs, Richard A.; Fulton, Lucinda L.; Sodergren, Erica; Weinstock, George M.; Šmajs, David

    2012-01-01

    Background The yaws treponemes, Treponema pallidum ssp. pertenue (TPE) strains, are closely related to syphilis causing strains of Treponema pallidum ssp. pallidum (TPA). Both yaws and syphilis are distinguished on the basis of epidemiological characteristics, clinical symptoms, and several genetic signatures of the corresponding causative agents. Methodology/Principal Findings To precisely define genetic differences between TPA and TPE, high-quality whole genome sequences of three TPE strain...

  4. Generation and characterization of Brassica rapa ssp. pekinensis – B. oleracea var. capitata monosomic and disomic alien addition lines

    Indian Academy of Sciences (India)

    Ai xia Gu; Shu Xing Shen; Yan Hua Wang; Jian Jun Zhao; Shu Xin Xuan; Xue Ping Chen; Xiao Feng Li; Shuang Xia Luo; Yu Jing Zhao

    2015-09-01

    Five monosomic alien addition lines (MAALs) of Brassica rapa ssp. pekinensis – B. oleracea var. capitata were obtained by hybridization and backcrossing between B. rapa ssp. pekinensis (female parent) and B. oleracea var. capitata. The alien linkage groups were identified using 42 B. oleracea var. capitata linkage group-specific markers as B. oleracea linkage groups C2, C3, C6, C7 and C8. Based on the chromosomal karyotype of root tip cells, these five MAALs added individual chromosomes from B. oleracea var. capitata: chr 1 (the longest), chr 2 or 3, chr 5 (small locus of 25S rDNA), chr 7 (satellite-carrying) and chr 9 (the shortest). Five disomic alien addition lines were then generated by selfing their corresponding MAALs.

  5. Protein (Viridiplantae): 297827267 [

    Lifescience Database Archive (English)

    Full Text Available XP_002881516.1 33090:14975 35493:14487 131221:14487 3193:14487 58023:10069 78536:8383 58024:8383 ... 83:5566 3701:5566 59689:6118 81972:6118 sodium-and lithium -tolerant 1 Arabidopsis lyrata subsp. lyrata MENHHP ...

  6. Protein (Viridiplantae): 297852222 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 24:3181 3398:3181 71240:3723 91827:3723 71275:1324 91836:455 3699:455 3700:455 980083:455 3701:455 59689:256 81972:256 universa...l stress protein family protein Arabidopsis lyrata subsp. lyrata MQFSRNSILRQLSRKEGWRSASKR

  7. Protein (Viridiplantae): 297830956 [

    Lifescience Database Archive (English)

    Full Text Available XP_002883360.1 33090:13671 35493:12750 131221:12750 3193:12750 58023:9989 78536:6448 58024:6448 ... 0083:2818 3701:2818 59689:5429 81972:5429 time for coffee ... Arabidopsis lyrata subsp. lyrata MAAAGNGLSRRRHRAGS ...

  8. Protein (Viridiplantae): 297822433 [

    Lifescience Database Archive (English)

    Full Text Available XP_002879099.1 33090:21008 35493:15650 131221:15650 3193:15650 58023:14656 78536:14697 58024:146 ... 0:5639 980083:5639 3701:5639 59689:7788 81972:7788 sand ... family protein Arabidopsis lyrata subsp. lyrata MA ...

  9. Computer-assisted diagnostic system for neurodegenerative dementia using brain SPECT and 3D-SSP

    Energy Technology Data Exchange (ETDEWEB)

    Ishii, Kazunari; Kanda, Tomonori; Uemura, Takafumi; Miyamoto, Naokazu; Yoshikawa, Toshiki [Hyogo Brain and Heart Center, Department of Radiology and Nuclear Medicine, Himeji, Hyogo (Japan); Shimada, Kenichi; Ohkawa, Shingo [Hyogo Brain and Heart Center, Institute for Aging Brain and Cognitive Disorders, Himeji, Hyogo (Japan); Minoshima, Satoshi [University of Washington, Radiology and Bioengineering, Department of Radiology, Seattle, WA (United States)

    2009-05-15

    To develop a computer-assisted automated diagnostic system to distinguish among Alzheimer disease (AD), dementia with Lewy bodies (DLB), and other degenerative disorders in patients with mild dementia. Single photon emission computed tomography (SPECT) images with injection of N-Isopropyl-p-[{sup 123}I]iodoamphetamine (IMP) were obtained from patients with mild degenerative dementia. First, datasets from 20 patients mild AD, 15 patients with dementia with DLB, and 17 healthy controls were used to develop an automated diagnosing system based on three-dimensional stereotactic surface projections (3D-SSP). AD- and DLB-specific regional templates were created using 3D-SSP, and critical Z scores in the templates were established. Datasets from 50 AD patients, 8 DLB patients, and 10 patients with non-AD/DLB type degenerative dementia (5 with frontotemporal dementia and 5 with progressive supranuclear palsy) were then used to test the diagnostic accuracy of the optimized automated system in comparison to the diagnostic interpretation of conventional IMP-SPECT images. These comparisons were performed to differentiate AD and DLB from non-AD/DLB and to distinguish AD from DLB. A receiver operating characteristic (ROC) analysis was performed. The area under the ROC curve (Az) and the accuracy of the automated diagnosis system were 0.89 and 82%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 65%, respectively, for AD vs. DLB patients. The mean Az and the accuracy of the visual inspection were 0.84 and 77%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 65%, respectively, for AD vs. DLB patients. The mean Az and the accuracy of the combination of visual inspection and this system were 0.96 and 91%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 66%, respectively, for AD vs. DLB patients. The system developed in the present study achieved as good discrimination of AD, DLB, and other degenerative disorders in patients with mild

  10. Engineering and Safety Partnership Enhances Safety of the Space Shuttle Program (SSP)

    Science.gov (United States)

    Duarte, Alberto

    2007-01-01

    Project Management must use the risk assessment documents (RADs) as tools to support their decision making process. Therefore, these documents have to be initiated, developed, and evolved parallel to the life of the project. Technical preparation and safety compliance of these documents require a great deal of resources. Updating these documents after-the-fact not only requires substantial increase in resources - Project Cost -, but this task is also not useful and perhaps an unnecessary expense. Hazard Reports (HRs), Failure Modes and Effects Analysis (FMEAs), Critical Item Lists (CILs), Risk Management process are, among others, within this category. A positive action resulting from a strong partnership between interested parties is one way to get these documents and related processes and requirements, released and updated in useful time. The Space Shuttle Program (SSP) at the Marshall Space Flight Center has implemented a process which is having positive results and gaining acceptance within the Agency. A hybrid Panel, with equal interest and responsibilities for the two larger organizations, Safety and Engineering, is the focal point of this process. Called the Marshall Safety and Engineering Review Panel (MSERP), its charter (Space Shuttle Program Directive 110 F, April 15, 2005), and its Operating Control Plan emphasizes the technical and safety responsibilities over the program risk documents: HRs; FMEA/CILs; Engineering Changes; anomalies/problem resolutions and corrective action implementations, and trend analysis. The MSERP has undertaken its responsibilities with objectivity, assertiveness, dedication, has operated with focus, and has shown significant results and promising perspectives. The MSERP has been deeply involved in propulsion systems and integration, real time technical issues and other relevant reviews, since its conception. These activities have transformed the propulsion MSERP in a truly participative and value added panel, making a

  11. Computer-assisted diagnostic system for neurodegenerative dementia using brain SPECT and 3D-SSP

    International Nuclear Information System (INIS)

    To develop a computer-assisted automated diagnostic system to distinguish among Alzheimer disease (AD), dementia with Lewy bodies (DLB), and other degenerative disorders in patients with mild dementia. Single photon emission computed tomography (SPECT) images with injection of N-Isopropyl-p-[123I]iodoamphetamine (IMP) were obtained from patients with mild degenerative dementia. First, datasets from 20 patients mild AD, 15 patients with dementia with DLB, and 17 healthy controls were used to develop an automated diagnosing system based on three-dimensional stereotactic surface projections (3D-SSP). AD- and DLB-specific regional templates were created using 3D-SSP, and critical Z scores in the templates were established. Datasets from 50 AD patients, 8 DLB patients, and 10 patients with non-AD/DLB type degenerative dementia (5 with frontotemporal dementia and 5 with progressive supranuclear palsy) were then used to test the diagnostic accuracy of the optimized automated system in comparison to the diagnostic interpretation of conventional IMP-SPECT images. These comparisons were performed to differentiate AD and DLB from non-AD/DLB and to distinguish AD from DLB. A receiver operating characteristic (ROC) analysis was performed. The area under the ROC curve (Az) and the accuracy of the automated diagnosis system were 0.89 and 82%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 65%, respectively, for AD vs. DLB patients. The mean Az and the accuracy of the visual inspection were 0.84 and 77%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 65%, respectively, for AD vs. DLB patients. The mean Az and the accuracy of the combination of visual inspection and this system were 0.96 and 91%, respectively, for AD/DLB vs. non-AD/DLB patients, and 0.70 and 66%, respectively, for AD vs. DLB patients. The system developed in the present study achieved as good discrimination of AD, DLB, and other degenerative disorders in patients with mild dementia

  12. 8th International Conference on Solid State Physics (SSP 2004), Workshop “Mössbauer Spectroscopy of Locally Heterogeneous Systems”

    CERN Document Server

    Kadyrzhanov, K. K; SSP 2004

    2006-01-01

    This volume contains papers presented at the 8th International Conference on Solid State Physics (SSP 2004), Workshop "Mössbauer Spectroscopy of Locally Heterogeneous Systems", held in Almaty, Kazakhstan, 23–26 August 2004. It should be of interest to researchers and PhD students working or interested in recent results in the locally inhomogeneous system investigations by Mössbauer Spectroscopy and the new concepts of data evaluation of complex Mössbauer spectra.

  13. Overcoming interspecific incompatibility in the cross Brassica campestris ssp. japonica x Brassica oleracea var. botrytis using irradiated mentor pollen page

    International Nuclear Information System (INIS)

    The cross B. campestris ssp. japonica x B. oleracea var. botrytis fails due to incompatibility barrier at the stigma. To realize this cross, irradiated compatible pollen (mentor pollen) was used before the incompatible pollination. The presence of mentor pollen stimulated the incompatible pollen to germinate and effect fertilization and seed set. One hybrid was thus obtained. Most of the seeds were inviable. Of the 5 plants raised one was a hybrid and 4 resembled the female parent. 1 tab., 7 refs

  14. Application of a Simple In-House PCR-SSP Technique for HLA-B* 27 Typing in Spondyloarthritis Patients

    OpenAIRE

    Parasannanavar, Devraj J.; Anjali Rajadhyaksha; Kanjaksha Ghosh

    2013-01-01

    Background. Microlymphocytotoxicity (MLCT) and flowcytometry (FC) are the conventional serological methods to detect HLA-B* 27. Due to some disadvantages in these methods, most of the HLA laboratories have now switched over to molecular methods. Molecular techniques based on commercial kits are expensive; as such many laboratories with limited funds in developing countries cannot afford these techniques. Aims. Our main aim was to standardize a simple inexpensive in-house PCR-SSP technique for...

  15. The effect of 5,6-dimethylbenzimidazole on vitamin B12 synthesis and protein production in Propionibacterium freudenreichii ssp. freudenreichii

    OpenAIRE

    Ishchenko, Tatiana

    2014-01-01

    Propionibacterium freudenreichii is commonly known as a Swiss-type cheese ripening culture, and is also frequently applied in the industrial production of vitamin B12 (cobalamin). One way to increase vitamin B12 productivity is the supplementation of medium with 5,6-dimethylbenzimidazole (DMBI), the lower ligand of cobalamin. The aim of this thesis was to investigate the effect of exogenous DMBI on vitamin B12 synthesis and protein production in type strain of P. freudenreichii ssp. freudenre...

  16. Conservation of nuclear SSR loci reveals high affinity of Quercus infectoria ssp. veneris A. Kern (Fagaceae) to section Robur

    OpenAIRE

    Neophytou, Charalambos; Dounavi, Aikaterini; Aravanopoulos, Filippos A.

    2013-01-01

    Conservation of 16 nuclear microsatellite loci, originally developed for Quercus macrocarpa (section Albae), Q. petraea, Q. robur (section Robur) and Q. myrsinifolia, (subgenus Cyclobalanopsis) was tested in a Q. infectoria ssp. veneris population from Cyprus. All loci could be amplified successfully and displayed allele size and diversity patterns that match those of oak species belonging to the section Robur. At least in one case, limited amplification and high levels of homozygosity suppor...

  17. Cu,Cr and As determination in preserved woods (Eucalyptus ssp.) by X-ray fluorescence spectrometries

    International Nuclear Information System (INIS)

    Brazil produces around 2.2 millions of cubic meters of treated wood to meet the annual demand of railway, electric, rural and construction sectors. The most used wood species are eucalyptus (Eucalyptus ssp.) and pine (Pinus ssp.).The treated woods used for poles, sleepers, fence posts and plywoods should be according to Brazilian norms requirements. The most usual wood preservative products used in Brazil are CCA (chromated copper arsenate) and CCB (copper chromium and boron salt). The analytical methods, such as flame atomic absorption spectrometry (FAAS), plasma inductively coupled optical emission spectrometry (ICPOES) and X-ray fluorescence spectrometry (XRFS) have been used for the analytical control of those treatment processes. In this work, the eucalyptus trees (Eucalyptus ssp) samples was obtained from Minas Gerais State, Brazil, cut plantation areas. Under pressure, eucalyptus wood samples were submitted to different concentration of CCA solution reaching 3.9, 6.7, 9.1, 12.4 and 14.0 kg of CCA by m-³ sapwood retentions. Samples in cylinders and sawdust forms were obtained from treated wood samples. Copper, chromium and arsenic determination was performed using the energy dispersive X-ray fluorescence spectrometry (EDXRFS), portable X-ray fluorescence spectrometry (PXRFS), flame atomic absorption spectrometry (FAAS) and instrumental neutron activation analysis. In this work, the method of analysis, sensitivity, precision and accuracy performances of the related techniques were outlined. (author)

  18. Influence of different strains of Agrobacterium rhizogenes on induction of hairy roots and lignan production in Linum tauricum ssp. tauricum

    Directory of Open Access Journals (Sweden)

    Iliana Ionkova

    2009-01-01

    Full Text Available Hairy root cultures were induced from leaf explants of Linum tauricum ssp. Tauricum by infection with Agrobacterium rhizogenes. Different bacterial strains of Agrobacterium rhizogenes - TR 105 and ATCC 15834 were evaluated for induction of transformed hairy roots in Linum tauricum ssp. Tauricum. These different strains varied in their virulence for induction of hairy roots in this species. Acetosyringon in cultivation medium was used to increase of frequency of hairy root induction. Growth kinetics of transgenic roots indicated a similar pattern of growth, with maximum growth occurring between 17 and 20 days. The transformed nature of tissue was confirmed by the production of opines. The lignin production of different clones was found to be growth-related. The cultures produced to 2.6% of the lignin 4′-demethyl-6-methoxypodophylotoxin (4′-DM-MPTOX and to 3.5% of the lignin 6-methoxypodophyllotoxin (6MPTOX on a dry weight basis, which was 10 to 12 times higher than in Linum tauricum ssp. Tauricum cell suspensions. Transformed cultures showed significant differences in lignin content. The highest amount of 4′-DM-MPTOX and MPTOX was found in transformed line induced by strain ATCC 15834. Rapidly growing root lines were selected to increase the efficiency of he production of lignans.

  19. A crystallizable form of the Streptococcus gordonii surface antigen SspB C-domain obtained by limited proteolysis

    International Nuclear Information System (INIS)

    The C-terminal domain of the S. gordonii surface protein SspB has been expressed, purified and crystallized. Diffraction data have been collected to 2.1 Å resolution. SspB is a 1500-residue adhesin expressed on the surface of the oral bacterium Streptococcus gordonii. Its interaction with other bacteria and host cells initiates the development of dental plaque. The full-length C-terminal domain of SspB was cloned, overexpressed in Escherichia coli and purified. However, the protein could not be crystallized. Limited proteolysis of the full-length C-domain identified a core fragment. The proteolysis product was cloned, expressed and purified. The protein was crystallized using the hanging-drop vapour-diffusion method. X-ray data were collected and processed to a maximum resolution of 2.1 Å with 96.4% completeness. The crystals belonged to space group P21, with one molecule in the asymmetric unit, a solvent content of 33.7% and a corresponding Matthews coefficient of 1.85 Å3 Da−1

  20. Comparative Transcriptome Analysis Reveals Heat-Responsive Genes in Chinese Cabbage (Brassica rapa ssp. chinensis)

    Science.gov (United States)

    Wang, Aihua; Hu, Jihong; Huang, Xingxue; Li, Xia; Zhou, Guolin; Yan, Zhixiang

    2016-01-01

    Chinese cabbage (Brassica rapa ssp. chinensis) is an economically and agriculturally significant vegetable crop and is extensively cultivated throughout the world. Heat stress disturbs cellular homeostasis and causes visible growth inhibition of shoots and roots, severe retardation in growth and development, and even death. However, there are few studies on the transcriptome profiling of heat stress in non-heading Chinese cabbage. In this study, we investigated the transcript profiles of non-heading Chinese cabbage from heat-sensitive and heat-tolerant varieties “GHA” and “XK,” respectively, in response to high temperature using RNA sequencing (RNA seq). Approximately 625 genes were differentially expressed between the two varieties. The responsive genes can be divided into three phases along with the time of heat treatment: response to stimulus, programmed cell death and ribosome biogenesis. Differentially expressed genes (DEGs) were identified in the two varieties, including transcription factors (TFs), kinases/phosphatases, genes related to photosynthesis and effectors of homeostasis. Many TFs were involved in the heat stress response of Chinese cabbage, including NAC069 TF which was up-regulated at all the heat treatment stages. And their expression levels were also validated by quantitative real-time-PCR (qRT-PCR). These candidate genes will provide genetic resources for further improving the heat-tolerant characteristics in non-heading Chinese cabbage. PMID:27443222

  1. Complete genome sequence of Treponema pallidum ssp. pallidum strain SS14 determined with oligonucleotide arrays

    Directory of Open Access Journals (Sweden)

    Sodergren Erica

    2008-05-01

    Full Text Available Abstract Background Syphilis spirochete Treponema pallidum ssp. pallidum remains the enigmatic pathogen, since no virulence factors have been identified and the pathogenesis of the disease is poorly understood. Increasing rates of new syphilis cases per year have been observed recently. Results The genome of the SS14 strain was sequenced to high accuracy by an oligonucleotide array strategy requiring hybridization to only three arrays (Comparative Genome Sequencing, CGS. Gaps in the resulting sequence were filled with targeted dideoxy-terminators (DDT sequencing and the sequence was confirmed by whole genome fingerprinting (WGF. When compared to the Nichols strain, 327 single nucleotide substitutions (224 transitions, 103 transversions, 14 deletions, and 18 insertions were found. On the proteome level, the highest frequency of amino acid-altering substitution polymorphisms was in novel genes, while the lowest was in housekeeping genes, as expected by their evolutionary conservation. Evidence was also found for hypervariable regions and multiple regions showing intrastrain heterogeneity in the T. pallidum chromosome. Conclusion The observed genetic changes do not have influence on the ability of Treponema pallidum to cause syphilitic infection, since both SS14 and Nichols are virulent in rabbit. However, this is the first assessment of the degree of variation between the two syphilis pathogens and paves the way for phylogenetic studies of this fascinating organism.

  2. Effects of amendments on the uptake and distribution of DDT in Cucurbita pepo ssp pepo plants

    Energy Technology Data Exchange (ETDEWEB)

    Whitfield Aslund, Melissa L.; Lunney, Alissa I. [Department of Chemistry and Chemical Engineering, Royal Military College of Canada, Kingston, ON, K7K 7B4 (Canada); Rutter, Allison [School of Environmental Studies, Biosciences Complex, Queen' s University, Kingston, ON, K7L 3N6 (Canada); Zeeb, Barbara A., E-mail: zeeb-b@rmc.c [Department of Chemistry and Chemical Engineering, Royal Military College of Canada, Kingston, ON, K7K 7B4 (Canada)

    2010-02-15

    The effects of soil amendments on the phytoextraction of SIGMADDT (DDT + DDD + DDE) from soil ([SIGMADDT] approx 1500 ng/g) by a pumpkin variety of Cucurbita pepo ssp pepo were tested and the patterns of SIGMADDT storage throughout the plant shoot were examined. The soil amendments did not increase the total amount of SIGMADDT extracted into plant shoots, but new information about SIGMADDT distribution in the plants was obtained. As observed previously, the SIGMADDT concentration in plant leaves (mean 290 ng/g) was significantly lower than in plant stems (mean 2600 ng/g). Further analysis revealed that SIGMADDT composition was consistent throughout the plant shoot and that SIGMADDT concentration in leaves and stems decreased exponentially as distance from the root increased, which was previously unknown. This new information about the patterns of SIGMADDT uptake and translocation within pumpkin plants highlights the need for appropriate plant sampling strategies in future POPs phytoextraction research. - Patterns of SIGMADDT storage in a pumpkin plant are elucidated and specific surfactant and mycorrhizal soil amendments did not increase the total amount of SIGMADDT phytoextracted into plant shoots.

  3. RAPID HLA-DRB1 GENERIC TYPING BY PCR-SSP METHOD

    Institute of Scientific and Technical Information of China (English)

    邱长春; 赵岩; 陶贞寅; 朱席林; 徐作军; 董怡

    1995-01-01

    We report a simple and rapid HLA-DRB1 generic typing metbod,PCR-SSP,which is practical and inexpensive.We use 9 sequence-specific primers and 2 group specific primers to define the HLA-DRB1 specificities DR1,DR2,DR3,DR4,DR5,DR6,DR7,DR8,DR9 and DR10. The HLA DR3,DR5,DR6 and DR8 can be amplified by the two primers of DR3568 are positive.Any individuals can be typed with some exception: the three pairs of phenotype DR3/DR3 and DR3/DR6,DR5/DR5 and DR5/DR6, DR8/DR8 and DR8/DR6 cannot be discriminated from each other.We typed 106 unrelated healthy people from Beijing locations in two weeks.We think this typing method is suitable to replace the error-Prone serologic HLA-DR tests in routine clinical practice,including the prospective typing of cadaveric organ donors.

  4. The essential oil of the protected species: Thymus praecox ssp. penyalarensis

    Directory of Open Access Journals (Sweden)

    José Blanco Salas

    2012-03-01

    Full Text Available The essential oil of a protected Spanish species, Thymus praecox ssp. penyalarensis, was firstly analyzed [Gas Chromatography-Mass Spectrometry (GC-MS] from wild populations during the phenological stages of flowering and fruiting. In flowering, the yield was 1.2%, and the major components were identified as thymol (18.5%, p-cymene (14.6%, carvacrol (11.6%, and γ-terpinene (10.1%. In fruiting, the yield was 0.9% and the major components resulted to be p-cymene (19.0%, carvacrol (16.5%, and borneol (10.5%. An experimental cultivation of the taxa was made also in order to analyze its essential oil as well. The yield was 1.3%, and the main compounds were thymol (19.1%, p-cymene (17.0%, and γ-terpinene (12.3%. Finally, the composition of the essential oil of this plant is discussed in relation to chemotaxonomic and biogeographical aspects.

  5. The Discovery of Resistant Sources of Spring Barley, Hordeum vulgare ssp. spontaneum, and Unique Greenbug Biotypes.

    Science.gov (United States)

    Armstrong, J Scott; Mornhinweg, Dolores W; Payton, Mark E; Puterka, Gary J

    2016-02-01

    The genetic sources for host-plant resistance to the greenbug (Schizaphis graminum Rondani) in barley (Hordeum vulgare ssp. spontaneum) are limited in that only two single dominant genes Rsg1 and Rsg2 are available for the complex of greenbug biotypes. We evaluated four new barley lines from the Wild Barley Diversity Collection (WBDC) that previously showed potential for greenbug resistance. Three of those entries, WBDC 53, WBDC 117, WBDC 336, exhibited very dominant sources of resistance to older known biotypes B, C, E, F, H, I, and TX1, which also add to the host-plant differentials used to separate these greenbug biotypes. We also re-evaluated the earlier known set of greenbug biotypes that have been in culture for several years against the known host-plant differentials, and included seven newer greenbug isolates collected from Wyoming to the full complement of small grain differentials. This resulted in the discovery of five new greenbug biotypes, WY10 MC, WY81, WY10 B, WY12 MC, and WY86. Wyoming isolates WY4 A and WY4 B were identical in their phenotypic profile, and should be combined as a single unique greenbug biotype. These barley trials resulted in finding new sources of host-plant resistance, although more research needs to be conducted on what type of resistance was found, and how it can be used. We also document that the Wheatland, Wyoming area serves as a very conducive environment for the development of new greenbug biotypes. PMID:26527793

  6. Diversity of AMF associated with Ammophila arenaria ssp. arundinacea in Portuguese sand dunes.

    Science.gov (United States)

    Rodríguez-Echeverría, Susana; Freitas, Helena

    2006-11-01

    Dune vegetation is essential for the formation and preservation of sand dunes and the protection of the coast line. Coastal sand dunes are harsh environments where arbuscular mycorrhizal fungi (AMF) play an important role in promoting plant establishment and growth. We present a study of the diversity of AMF associated with A. arenaria ssp. arundinacea in two locations of the Portuguese coast under a Mediterranean climate. These two locations were selected to compare a well-preserved dune system from a protected area with a degraded dune system from a public beach. AMF diversity was assessed mainly by cloning and sequencing of a fragment of the ribosomal SSU using the primer NS31 and AM1. Most of the 89 AMF clones obtained from the rhizosphere and roots of A. arenaria belonged to the genus Glomus, the largest clade within the Glomeromycota. Higher AMF diversity was found in the least disturbed site, in which spores of Scutellospora persica, Glomus constrictum and Glomus globiferum were found in the rhizosphere of A. arenaria. PMID:17043895

  7. Anatomical and micromorphological particularities of vegetative organs in endemic Erysimum wittmanii Zaw. ssp. wittmanii

    Directory of Open Access Journals (Sweden)

    Irina Neta GOSTIN

    2009-11-01

    Full Text Available The Erysimum wittmanii ssp. wittmanii is an endemic biennial herbaceous species in South and East Carpathians. In this study the anatomical and micromorphological properties of this specie are investigated. Anatomical properties of root, stem and leaves were underlined. Roots acquire early in ontogenesis the secondary structure. Stems presents collateral vascular bundles both in primary and in secondary structure; cortical small bundles by concentric type, was observed on the cross sections from the top of the stem. The leaves are bifacial and amphystomatic. Scanning electron microscopy investigation regarding upper and lower epidermises of leaves in different developmental stages was carried out. Trichomes occur on both faces of young leaves. The tector hairs are multicelullar, usually three-armed; rarely four-armed or two-armed (especially on the epidermis from the veins. The hairs cell walls are thin and the surface is smooth in the first developmental stages (on very young leaves; on the young and mature leaves the trichomes have thick-walled cells, densely covered by micro-papillae.

  8. Characterization of a sagebrush (Artemisia tridentata ssp. wyomingensis) die-off on the Handford Site

    International Nuclear Information System (INIS)

    The Hanford Site contains one of the few remaining contiguous areas of shrub-steppe habitat left in Washington State. This habitat is home to many native plant and wildlife species, some of which are threatened with extinction or are unique to the Site. The importance of the Hanford Site increases as other lands surrounding the Site are developed, and these native species and habitats are lost. Stands of Wyoming big sagebrush (Artemisia tridentata ssp. wyomingensis) on the Site are a particularly important component of shrub-steppe habitat, because a number of wildlife require big sagebrush for food and cover. Since 1993, researchers and field biologists have made anecdotal observations of dying and declining sagebrush in stands of shrubs near the 100 Areas. This study was initiated to delineate and document the general boundary where sagebrush stands appear to be declining. We mapped the areal extent of the die-off using a global positioning system and found that the central portion of the die-off encompasses 280 hectares. Shrub stand defoliation was estimated to be near or greater than 80% in this area. The remainder of the die-off area exhibits varying mixtures of completely defoliated, partially defoliated, and healthy-looking stands. Declining sagebrush stands comprise a total of 1776 hectares

  9. Variation in Nectar Volume and Sugar Concentration of Allium ursinum L. ssp. ucrainicum in Three Habitats

    Directory of Open Access Journals (Sweden)

    Ágnes Farkas

    2012-01-01

    Full Text Available Floral nectar volume and concentration of ramson (Allium ursinum L. ssp. ucrainicum were investigated in three different habitats, including two types of sessile oak-hornbeam association on brown forest soil with clay illuviation and a silver lime-flowering ash rock forest association on rendzina. Daily nectar production ranged from 0.1 to 3.8 μL per flower with sugar concentrations of 25 to 50%. Mean nectar volumes and concentrations showed significant differences between freely exposed flowers and covered flowers, which had been isolated from flower visitors 24 h prior to nectar studies. Both the amount and quality of nectar were affected by microclimatic conditions and soil properties and varied between populations at different habitats. In the silver lime-flowering ash rock-forest association mean nectar volumes and concentrations were lower than in a typical sessile oak-hornbeam association on three occasions, the difference being significant in two cases. During full bloom, the date of sampling did not have a profound effect on either nectar volume or concentration.

  10. Complete genome sequence of Treponema pallidum ssp. pallidum strain SS14 determined with oligonucleotide arrays

    Science.gov (United States)

    Matějková, Petra; Strouhal, Michal; Šmajs, David; Norris, Steven J; Palzkill, Timothy; Petrosino, Joseph F; Sodergren, Erica; Norton, Jason E; Singh, Jaz; Richmond, Todd A; Molla, Michael N; Albert, Thomas J; Weinstock, George M

    2008-01-01

    Background Syphilis spirochete Treponema pallidum ssp. pallidum remains the enigmatic pathogen, since no virulence factors have been identified and the pathogenesis of the disease is poorly understood. Increasing rates of new syphilis cases per year have been observed recently. Results The genome of the SS14 strain was sequenced to high accuracy by an oligonucleotide array strategy requiring hybridization to only three arrays (Comparative Genome Sequencing, CGS). Gaps in the resulting sequence were filled with targeted dideoxy-terminators (DDT) sequencing and the sequence was confirmed by whole genome fingerprinting (WGF). When compared to the Nichols strain, 327 single nucleotide substitutions (224 transitions, 103 transversions), 14 deletions, and 18 insertions were found. On the proteome level, the highest frequency of amino acid-altering substitution polymorphisms was in novel genes, while the lowest was in housekeeping genes, as expected by their evolutionary conservation. Evidence was also found for hypervariable regions and multiple regions showing intrastrain heterogeneity in the T. pallidum chromosome. Conclusion The observed genetic changes do not have influence on the ability of Treponema pallidum to cause syphilitic infection, since both SS14 and Nichols are virulent in rabbit. However, this is the first assessment of the degree of variation between the two syphilis pathogens and paves the way for phylogenetic studies of this fascinating organism. PMID:18482458

  11. Internalization-dependent recognition of Mycobacterium avium ssp. paratuberculosis by intestinal epithelial cells.

    Science.gov (United States)

    Pott, Johanna; Basler, Tina; Duerr, Claudia U; Rohde, Manfred; Goethe, Ralph; Hornef, Mathias W

    2009-12-01

    Mycobacterium avium ssp. paratuberculosis (MAP) is the causative agent of Johne's disease, a highly prevalent chronic intestinal infection in domestic and wildlife ruminants. The microbial pathogenesis of MAP infection has attracted additional attention due to an association with the human enteric inflammatory Crohn's disease. MAP is acquired by the faecal-oral route prompting us to study the interaction with differentiated intestinal epithelial cells. MAP was rapidly internalized and accumulated in a late endosomal compartment. In contrast to other opportunistic mycobacteria or M. bovis, MAP induced significant epithelial activation as indicated by a NF-kappaB-independent but Erk-dependent chemokine secretion. Surprisingly, MAP-induced chemokine production was completely internalization-dependent as inhibition of Rac-dependent bacterial uptake abolished epithelial activation. In accordance, innate immune recognition of MAP by differentiated intestinal epithelial cells occurred through the intracellularly localized pattern recognition receptors toll-like receptor 9 and NOD1 with signal transduction via the adaptor molecules MyD88 and RIP2. The internalization-dependent innate immune activation of intestinal epithelial cells is in contrast to the stimulation of professional phagocytes by extracellular bacterial constituents and might significantly contribute to the histopathological changes observed during enteric MAP infection. PMID:19681906

  12. Growth Behavior of Phytopathogen Clavibacter michiganensis ssp. sepedonicus Treated with Selenium Biocomposites of Mushroom Origin

    Directory of Open Access Journals (Sweden)

    A.I. Perfileva

    2016-02-01

    Full Text Available The results of studying the effect of biologically obtained selenium nanocomposites on the bacterium Clavibacter michiganensis ssp. sepedonicus (Cms are presented. Cms is a Gram-positive bacterium, which causes one of the most dangerous potato diseases, ring rot. The effective alongside ecologically safe methods for combating Cms are lacking. As the agents feasible for use in this purpose, we examined the selenium nanocomposites obtained from the macrobasidiomycetes' submerged cultures. For exploring the bionanocomposites effect on Cms, the methods of agar well diffusion, the suspension turbidity measurement, and the colony-forming units count were applied. The results showed that all the nanocomposites under study lowered the bacterial suspension's absorption values compared to the reference specimen, that testified to the observation of bacteriostatic effect of the agents tested. The suppression action of nanocompostes was elucidated by means of both agar well diffusion assay and colony-forming units count. Thus, the results obtained demonstrate the occurrence of bacteriostatic and bactericidal effects of the substances under study, and favor the supposition on advisability of further research into the selenium nanocomposites as the agents for agricultural recovery from the bacterial pathogens.

  13. Full Scale Test of SSP 34m blade, edgewise loading LTT. Data Report 1

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Magda; Jensen, Find M.; Nielsen, Per H. (and others)

    2010-01-15

    This report is a part of a research project where a 34m wind turbine blade from SSP-Technology A/S has been tested in edgewise direction (LTT). The applied load is 60% of an unrealistic extreme event, corresponding to 75% of a certificated extreme load. This report describes the background, the test set up, the tests and the results. For this project, a new solution has been used for the load application and the solution for the load application is described in this report as well. The blade has been submitted to thorough examination. More areas have been examined with DIC, both global and local deflections have been measured, and also 378 strain gauge measurements have been performed. Furthermore Acoustic Emission has been used in order to detect damage while testing new load areas. The global deflection is compared with results from a previous test and results from FEM analyses in order to validate the solution as to how the gravity load on the blade was handled. Furthermore, the DIC measurement and the displacement sensors measurements are compared in order to validate the results from the DIC measurements. The report includes the results from the test and a description of the measurement equipment and the data acquisition. (author)

  14. Comparative Transcriptome Analysis Reveals Heat-Responsive Genes in Chinese Cabbage (Brassica rapa ssp. chinensis).

    Science.gov (United States)

    Wang, Aihua; Hu, Jihong; Huang, Xingxue; Li, Xia; Zhou, Guolin; Yan, Zhixiang

    2016-01-01

    Chinese cabbage (Brassica rapa ssp. chinensis) is an economically and agriculturally significant vegetable crop and is extensively cultivated throughout the world. Heat stress disturbs cellular homeostasis and causes visible growth inhibition of shoots and roots, severe retardation in growth and development, and even death. However, there are few studies on the transcriptome profiling of heat stress in non-heading Chinese cabbage. In this study, we investigated the transcript profiles of non-heading Chinese cabbage from heat-sensitive and heat-tolerant varieties "GHA" and "XK," respectively, in response to high temperature using RNA sequencing (RNA seq). Approximately 625 genes were differentially expressed between the two varieties. The responsive genes can be divided into three phases along with the time of heat treatment: response to stimulus, programmed cell death and ribosome biogenesis. Differentially expressed genes (DEGs) were identified in the two varieties, including transcription factors (TFs), kinases/phosphatases, genes related to photosynthesis and effectors of homeostasis. Many TFs were involved in the heat stress response of Chinese cabbage, including NAC069 TF which was up-regulated at all the heat treatment stages. And their expression levels were also validated by quantitative real-time-PCR (qRT-PCR). These candidate genes will provide genetic resources for further improving the heat-tolerant characteristics in non-heading Chinese cabbage. PMID:27443222

  15. Chemical composition and nutritional evaluation of the seeds of Acacia tortilis (Forssk.) Hayne ssp. raddiana.

    Science.gov (United States)

    Embaby, Hassan E; Rayan, Ahmed M

    2016-06-01

    Chemical composition and nutritional evaluation as well as physicochemical and functional properties of seed flour of Acacia tortilis (Forssk.) Hayne ssp. raddiana were studied. The results indicated that seeds contained 5.30% moisture, 3.99% ash, 9.19% fat, 14.31% fiber, 27.21% protein and 45.30% carbohydrates. Potassium was the predominant element followed by calcium and then phosphorous. Phytic acid, tannins and trypsin inhibitor as antinutrients were detected. The amino acid profile compared well with FAO/WHO recommended pattern except for cystine/methionine, isoleucine, tyrosine/phenylalanine, lysine and threonine. Also, the first limiting amino acid was lysine. Fatty acid composition showed that linoleic acid was the major fatty acid, followed by palmitic, stearic, oleic and arachidic acids. The seed oil showed absorbance in the ultraviolet ranges, thus it can be used as a broad spectrum UV protectant. For physicochemical and functional properties, acacia seeds flour had excellent water holding index, swelling index, foaming capacity and foam stability. PMID:26830561

  16. Effects of amendments on the uptake and distribution of DDT in Cucurbita pepo ssp pepo plants

    International Nuclear Information System (INIS)

    The effects of soil amendments on the phytoextraction of ΣDDT (DDT + DDD + DDE) from soil ([ΣDDT] ∼ 1500 ng/g) by a pumpkin variety of Cucurbita pepo ssp pepo were tested and the patterns of ΣDDT storage throughout the plant shoot were examined. The soil amendments did not increase the total amount of ΣDDT extracted into plant shoots, but new information about ΣDDT distribution in the plants was obtained. As observed previously, the ΣDDT concentration in plant leaves (mean 290 ng/g) was significantly lower than in plant stems (mean 2600 ng/g). Further analysis revealed that ΣDDT composition was consistent throughout the plant shoot and that ΣDDT concentration in leaves and stems decreased exponentially as distance from the root increased, which was previously unknown. This new information about the patterns of ΣDDT uptake and translocation within pumpkin plants highlights the need for appropriate plant sampling strategies in future POPs phytoextraction research. - Patterns of ΣDDT storage in a pumpkin plant are elucidated and specific surfactant and mycorrhizal soil amendments did not increase the total amount of ΣDDT phytoextracted into plant shoots.

  17. Ectopically expressed sweet pepper ferredoxin PFLP enhances disease resistance to Pectobacterium carotovorum subsp. carotovorum affected by harpin and protease-mediated hypersensitive response in Arabidopsis.

    Science.gov (United States)

    Ger, Mang-Jye; Louh, Guan-Yu; Lin, Yi-Hsien; Feng, Teng-Yung; Huang, Hsiang-En

    2014-12-01

    Plant ferredoxin-like protein (PFLP) is a photosynthesis-type ferredoxin (Fd) found in sweet pepper. It contains an iron-sulphur cluster that receives and delivers electrons between enzymes involved in many fundamental metabolic processes. It has been demonstrated that transgenic plants overexpressing PFLP show a high resistance to many bacterial pathogens, although the mechanism remains unclear. In this investigation, the PFLP gene was transferred into Arabidopsis and its defective derivatives, such as npr1 (nonexpresser of pathogenesis-related gene 1) and eds1 (enhanced disease susceptibility 1) mutants and NAHG-transgenic plants. These transgenic plants were then infected with the soft-rot bacterial pathogen Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora ssp. carotovora, ECC) to investigate the mechanism behind PFLP-mediated resistance. The results revealed that, instead of showing soft-rot symptoms, ECC activated hypersensitive response (HR)-associated events, such as the accumulation of hydrogen peroxide (H2 O2 ), electrical conductivity leakage and expression of the HR marker genes (ATHSR2 and ATHSR3) in PFLP-transgenic Arabidopsis. This PFLP-mediated resistance could be abolished by inhibitors, such as diphenylene iodonium (DPI), 1-l-trans-epoxysuccinyl-leucylamido-(4-guanidino)-butane (E64) and benzyloxycarbonyl-Val-Ala-Asp-fluoromethylketone (z-VAD-fmk), but not by myriocin and fumonisin. The PFLP-transgenic plants were resistant to ECC, but not to its harpin mutant strain ECCAC5082. In the npr1 mutant and NAHG-transgenic Arabidopsis, but not in the eds1 mutant, overexpression of the PFLP gene increased resistance to ECC. Based on these results, we suggest that transgenic Arabidopsis contains high levels of ectopic PFLP; this may lead to the recognition of the harpin and to the activation of the HR and other resistance mechanisms, and is dependent on the protease-mediated pathway. PMID:24796566

  18. Arabidopsis CDS blastp result: AK119708 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119708 002-157-E08 At1g28330.1 dormancy-associated protein, putative (DRM1) identical to dormancy...-associated protein [Arabidopsis thaliana] GI:2995990; similar to dormancy-associated protei

  19. Arabidopsis CDS blastp result: AK060981 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060981 006-202-H08 At1g28330.1 dormancy-associated protein, putative (DRM1) identical to dormancy...-associated protein [Arabidopsis thaliana] GI:2995990; similar to dormancy-associated protei

  20. Arabidopsis CDS blastp result: AK111736 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111736 J023047L09 At1g68370.1 gravity -responsive protein / altered response to gravity ... protein ... (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  1. Arabidopsis CDS blastp result: AK070093 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK070093 J023041M10 At2g39290.1 phosphatidylglycerolphosphate synthase (PGS1) identical to phosphati...dylglycerolphosphate synthase GI:13365519 from [Arabidopsis thaliana] 7e-78 ...

  2. Arabidopsis CDS blastp result: AK060009 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060009 006-302-D03 At2g39290.1 phosphatidylglycerolphosphate synthase (PGS1) identical to phosphati...dylglycerolphosphate synthase GI:13365519 from [Arabidopsis thaliana] 8e-71 ...

  3. Arabidopsis CDS blastp result: AK058419 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058419 001-015-D06 At4g16280.3 flowering time ... control protein / FCA gamma (FCA) identical to S ... P|O04425 Flowering time ... control protein FCA {Arabidopsis thaliana}; four a ...

  4. Arabidopsis CDS blastp result: AK073225 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK073225 J033023C04 At4g16280.3 flowering time ... control protein / FCA gamma (FCA) identical to SP ... |O04425 Flowering time ... control protein FCA {Arabidopsis thaliana}; four a ...

  5. Arabidopsis CDS blastp result: AK102695 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK102695 J033103F21 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  6. Arabidopsis CDS blastp result: AK102134 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK102134 J033085F12 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  7. Arabidopsis CDS blastp result: AK066835 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066835 J013087I16 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-171 ...

  8. Arabidopsis CDS blastp result: AK065259 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065259 J013002J18 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  9. Arabidopsis CDS blastp result: AK100523 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100523 J023100P04 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  10. Arabidopsis CDS blastp result: AK288065 [KOME

    Lifescience Database Archive (English)

    Full Text Available al to sulfate tansporter Sultr1;3 [Arabidopsis thaliana] GI:10716805; contains Pfam profile PF00916: Sulfate... transporter family; contains Pfam profile PF01740: STAS domain; contains TIGRfam profile TIGR00815: sulfate permease 1e-145 ...

  11. Arabidopsis CDS blastp result: AK288002 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288002 J075110B01 At1g68510.1 68414.m07826 LOB domain protein 42 ... / lateral organ boundaries do ... main protein 42 ... (LBD42 ) identical to LOB DOMAIN 42 ... [Arabidopsis th ...

  12. Arabidopsis CDS blastp result: AK241043 [KOME

    Lifescience Database Archive (English)

    Full Text Available upted by a stop codon, creating non-consensus donor and acceptor splice sites. 2e-41 ... ...tical to SP|P92997 Germin-like protein subfamily 1 member 13 precursor {Arabidopsis thaliana}; exon 2 interr

  13. Arabidopsis CDS blastp result: AK243135 [KOME

    Lifescience Database Archive (English)

    Full Text Available upted by a stop codon, creating non-consensus donor and acceptor splice sites. 7e-43 ... ...tical to SP|P92997 Germin-like protein subfamily 1 member 13 precursor {Arabidopsis thaliana}; exon 2 interr

  14. Arabidopsis CDS blastp result: AK111785 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111785 J023089N11 At5g62310.1 incomplete root hair ... elongation (IRE) / protein kinase, putative ... nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  15. Arabidopsis CDS blastp result: AK243050 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243050 J100011E04 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  16. Arabidopsis CDS blastp result: AK242758 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242758 J090051H03 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  17. Arabidopsis CDS blastp result: AK242717 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242717 J090043H19 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  18. Arabidopsis CDS blastp result: AK288095 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288095 J075191E21 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  19. Arabidopsis CDS blastp result: AK242638 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242638 J090023J02 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  20. Arabidopsis CDS blastp result: AK242651 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242651 J090026B08 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  1. Arabidopsis CDS blastp result: AK287631 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287631 J065073J24 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  2. Arabidopsis CDS blastp result: AK288923 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288923 J090081P06 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  3. Arabidopsis CDS blastp result: AK242271 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242271 J075187A19 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  4. Arabidopsis CDS blastp result: AK242681 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242681 J090032N04 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  5. Arabidopsis CDS blastp result: AK243656 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243656 J100088L22 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  6. Arabidopsis CDS blastp result: AK241519 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241519 J065170E12 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  7. Arabidopsis CDS blastp result: AK240655 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240655 J023135E11 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  8. Arabidopsis CDS blastp result: AK242733 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242733 J090047O22 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  9. Arabidopsis CDS blastp result: AK242859 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242859 J090073L24 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  10. Arabidopsis CDS blastp result: AK243187 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243187 J100039E11 At5g62310.1 68418.m07822 incomplete root hair ... elongation (IRE) / protein kin ... putative nearly identical to IRE (incomplete root hair ... elongation) [Arabidopsis thaliana] gi|6729346|dbj| ...

  11. Arabidopsis CDS blastp result: AK242550 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242550 J080319D10 At2g35630.1 68415.m04369 microtubule organization 1 protein (MO...R1) identical to microtubule organization 1 protein GI:14317953 from [Arabidopsis thaliana] 5e-44 ...

  12. Arabidopsis CDS blastp result: AK101368 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK101368 J033035L13 At5g24270.1 calcineurin B-like protein, putative / calcium sensor ... homolog (S ... OS3) identical to calcium sensor ... homolog [Arabidopsis thaliana] GI:3309575; similar ...

  13. Arabidopsis CDS blastp result: AK111570 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111570 J013071C24 At5g24270.1 calcineurin B-like protein, putative / calcium sensor ... homolog (S ... OS3) identical to calcium sensor ... homolog [Arabidopsis thaliana] GI:3309575; similar ...

  14. Arabidopsis CDS blastp result: AK243065 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243065 J100015N03 At5g24270.1 68418.m02855 calcineurin B-like protein, putative / calcium sensor ... or homolog (SOS3) identical to calcium sensor ... homolog [Arabidopsis thaliana] GI:3309575; similar ...

  15. The fifth international conference on Arabidopsis research

    Energy Technology Data Exchange (ETDEWEB)

    Hangarter, R.; Scholl, R.; Davis, K.; Feldmann, K.

    1993-12-31

    This volume contains abstracts of oral and poster presentations made in conjunction with the Fifth International Conference on Arabidopsis Research held August 19--22, 1993 at the Ohio State University, Columbus, Ohio.

  16. Arabidopsis CDS blastp result: AK070528 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK070528 J023060D13 At3g10920.1 superoxide dismutase [Mn], mitochondrial (SODA) / manganese ... supe ... roxide dismutase (MSD1) identical to manganese ... superoxide dismutase [Arabidopsis thaliana] gi|327 ...

  17. Arabidopsis CDS blastp result: AK119904 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119904 002-182-A05 At3g10920.1 superoxide dismutase [Mn], mitochondrial (SODA) / manganese ... sup ... eroxide dismutase (MSD1) identical to manganese ... superoxide dismutase [Arabidopsis thaliana] gi|327 ...

  18. Arabidopsis CDS blastp result: AK104030 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104030 001-020-C01 At3g10920.1 superoxide dismutase [Mn], mitochondrial (SODA) / manganese ... sup ... eroxide dismutase (MSD1) identical to manganese ... superoxide dismutase [Arabidopsis thaliana] gi|327 ...

  19. Arabidopsis CDS blastp result: AK104160 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK104160 006-211-E09 At3g10920.1 superoxide dismutase [Mn], mitochondrial (SODA) / manganese ... sup ... eroxide dismutase (MSD1) identical to manganese ... superoxide dismutase [Arabidopsis thaliana] gi|327 ...

  20. Arabidopsis CDS blastp result: AK287459 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287459 J043019O07 At4g37000.1 68417.m05242 accelerated cell death ... 2 (ACD2) identical to accele ... rated cell death ... 2 (ACD2) GI:12484129 from [Arabidopsis thaliana] 4 ...

  1. Arabidopsis CDS blastp result: AK288034 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288034 J075140H07 At4g37000.1 68417.m05242 accelerated cell death ... 2 (ACD2) identical to accele ... rated cell death ... 2 (ACD2) GI:12484129 from [Arabidopsis thaliana] 5 ...

  2. Arabidopsis CDS blastp result: AK111576 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111576 J013075J23 At1g01510.1 C-terminal binding protein (ANGUSTIFOLIA) nearly id...entical to C-terminal binding protein ANGUSTIFOLIA [Arabidopsis thaliana] GI:15408535; contains Pfam profile

  3. Arabidopsis CDS blastp result: AK120838 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK120838 J023022B11 At1g01510.1 C-terminal binding protein (ANGUSTIFOLIA) nearly id...entical to C-terminal binding protein ANGUSTIFOLIA [Arabidopsis thaliana] GI:15408535; contains Pfam profile

  4. Arabidopsis CDS blastp result: AK111921 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111921 001-013-A10 At1g01510.1 C-terminal binding protein (ANGUSTIFOLIA) nearly i...dentical to C-terminal binding protein ANGUSTIFOLIA [Arabidopsis thaliana] GI:15408535; contains Pfam profil

  5. 大白菜BrTCP24基因的克隆与功能分析%Cloning and Functional Analysis of BrTCP24 Gene in Chinese Cabbage (Brassica rapa L.ssp.pekinensis)

    Institute of Scientific and Technical Information of China (English)

    王凤德; 谭婷婷; 张一卉; 李景娟; 李化银; 李利斌; 刘立锋; 高建伟

    2013-01-01

    It is very important to isolate and characterize the genes responsible for negative control of the leaf heading growth of Chinese cabbage,which can be help to speed up breeding progress of the small heading Chinese cabbage varieties that meet the current market demands.Here,a full-length TCP cDNA named BrTCP24,which belongs to the second subgroups of TCP domain family,was isolated from leaves of Chinese cabbage inbred line Fushanbaotou (Brassica rapa L.ssp.pekinensis).The full-length cDNA of BrTCP24 consisted of 1 221 nucleotides,and was predicted to code a 406-amino acid polypeptide.In addition,there were no introns in BrTCP24 gene.The phylogenetic analysis about BrTCP24 and TCP families in Arabidopsis was carried out using the software of MEGA4.0.The result indicated that BrTCP24 gene and Arabidopsis AtTCP3 gene would belong to the same branch,which suggested they had closely genetic relationship.The alignment of predicted amino acid sequences of BrTCP24 and Arabidopsis AtTCP3 indicated that there was 55.15% identity between them.Additionally,these two proteins contained conserved TCP domain and had 91.53% identity in this domain.These results suggested that BrTCP24 and Arabidopsis AtTCP3 would have similar biological functions.The semiquantitive RT-PCR indicated that BrTCP24 gene was expressed in roots,dwarf stems,rosette leaves,folding leaves,flowers,siliques and bud flowers examined in Chinese cabbage.Among them,rosette leaves had the highest mRNA level,followed by roots,folding leaves,flowers,siliques and bud flowers,while dwarf stems had the lowest mRNA level.Interestingly,the expression level of BrTCP24 didn't effect by 5 μmol NAA treatment in 12 h period.To test the function of BrTCP24,we then engineered Arabidopsis plants that would over-express BrTCP24 ectopically,driven by CaMV 35S promoter,and obtained 17 transgenic lines by Kanamycin and PCR screening.Using RT-PCR method,we randomly detected 5 transgenic lines and found all of them could express

  6. Arabidopsis CDS blastp result: AK073140 [KOME

    Lifescience Database Archive (English)

    Full Text Available me 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains a Ser/Thr protein...AK073140 J033022I01 At2g39840.1 serine/threonine protein phosphatase PP1 isozyme 4 (TOPP4) / phosphoprotein... phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphatase PP1 isozy... phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 1e-168 ...

  7. Arabidopsis CDS blastp result: AK120439 [KOME

    Lifescience Database Archive (English)

    Full Text Available me 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains a Ser/Thr protein...AK120439 J013098H20 At2g39840.1 serine/threonine protein phosphatase PP1 isozyme 4 (TOPP4) / phosphoprotein... phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphatase PP1 isozy... phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 1e-154 ...

  8. Arabidopsis CDS blastp result: AK121378 [KOME

    Lifescience Database Archive (English)

    Full Text Available me 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains a Ser/Thr protein...AK121378 J023127F14 At2g39840.1 serine/threonine protein phosphatase PP1 isozyme 4 (TOPP4) / phosphoprotein... phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphatase PP1 isozy... phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 1e-142 ...

  9. Arabidopsis CDS blastp result: AK063856 [KOME

    Lifescience Database Archive (English)

    Full Text Available yme 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains a Ser/Thr protein...AK063856 001-122-D05 At2g39840.1 serine/threonine protein phosphatase PP1 isozyme 4 (TOPP4) / phosphoprotein... phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphatase PP1 isoz... phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 6e-46 ...

  10. Terpene Specialized Metabolism in Arabidopsis thaliana

    OpenAIRE

    Tholl, Dorothea; Lee, Sungbeom

    2011-01-01

    Terpenes constitute the largest class of plant secondary (or specialized) metabolites, which are compounds of ecological function in plant defense or the attraction of beneficial organisms. Using biochemical and genetic approaches, nearly all Arabidopsis thaliana (Arabidopsis) enzymes of the core biosynthetic pathways producing the 5-carbon building blocks of terpenes have been characterized and closer insight has been gained into the transcriptional and posttranscriptional/translational mech...

  11. Cis-regulatory Evolution of Chalcone-Synthase Expression in the Genus Arabidopsis

    OpenAIRE

    de Meaux, J. (Juliette); Pop, A.(National Institute for Physics and Nuclear Engineering, Bucharest, Romania); Mitchell-Olds, T.

    2006-01-01

    The contribution of cis-regulation to adaptive evolutionary change is believed to be essential, yet little is known about the evolutionary rules that govern regulatory sequences. Here, we characterize the short-term evolutionary dynamics of a cis-regulatory region within and among two closely related species, A. lyrata and A. halleri, and compare our findings to A. thaliana. We focused on the cis-regulatory region of chalcone synthase (CHS), a key enzyme involved in the synthesis of plant sec...

  12. Khorasan wheat population researching (Triticum turgidum, ssp. Turanicum (McKey in the minimum tillage conditions

    Directory of Open Access Journals (Sweden)

    Ikanović Jela

    2014-01-01

    Full Text Available Khorasan wheat occupies a special place in the group of new-old cereals (Triticum turgidum, ssp. Turanicum McKey. It is an ancient species, native to eastern Persia, that is very close to durum wheat by morphological characteristics. Investigations were carried out in agro ecological conditions of the eastern Srem, with two wheat populations with dark and bright awns as objects of study. The following morphological and productive characteristics were investigated: plant height (PH, spike length (SH, number of spikelets per spike (NSS, absolute weight (AW and grain weight per spike (GW, seed germination (G and grains yield (YG. Field micro-experiments were set on the carbonate chernozem soil type on loess plateau in 2011 and 2012. Hand wheat sowing was conducted in early March with drill row spacing of 12 cm. The experiment was established as complete randomized block system with four replications. Tending crops measures were not applied during the growing season. Plants were grown without usage of NPK mineral nutrients. Chemical crop protection measures were not applied, although powdery mildew (Erysiphe graminis was appeared before plants spike formation in a small extent. The results showed that both populations have a genetic yield potential. In general, both populations manifested a satisfactory tolerance on lodging and there was no seed dispersal. Plants from bright awns population were higher, had longer spikes and larger number of spikelet’s per spike. However, plants from dark awns population had higher absolute weight and grains weight per spike, as well as grain yield per plant. Strong correlation connections were identified among the investigated characteristics. The determination of correlations, as well as direct and indirect affects, enabled easier understanding of the mutual relationships and their balancing in order to improve the yield per unit area. [Projekat Ministarstva nauke Republike Srbije, br. TR 31078 i br. TR 31022

  13. Short communication: Evaluation of sampling socks for detection of Mycobacterium avium ssp. paratuberculosis on dairy farms.

    Science.gov (United States)

    Wolf, R; Orsel, K; De Buck, J; Kanevets, U; Barkema, H W

    2016-04-01

    Mycobacterium avium ssp. paratuberculosis (MAP) causes Johne's disease, a production-limiting disease in cattle. Detection of infected herds is often done using environmental samples (ES) of manure, which are collected in cattle pens and manure storage areas. Disadvantages of the method are that sample accuracy is affected by cattle housing and type of manure storage area. Furthermore, some sampling locations (e.g., manure lagoons) are frequently not readily accessible. However, sampling socks (SO), as used for Salmonella spp. testing in chicken flocks, might be an easy to use and accurate alternative to ES. The objective of the study was to assess accuracy of SO for detection of MAP in dairy herds. At each of 102 participating herds, 6 ES and 2 SO were collected. In total, 45 herds had only negative samples in both methods and 29 herds had ≥1 positive ES and ≥1 positive SO. Furthermore, 27 herds with ≥1 positive ES had no positive SO, and 1 herd with no positive ES had 1 positive SO. Bayesian simulation with informative priors on sensitivity of ES and MAP herd prevalence provided a posterior sensitivity for SO of 43.5% (95% probability interval=33-58), and 78.5% (95% probability interval=62-93) for ES. Although SO were easy to use, accuracy was lower than for ES. Therefore, with improvements in the sampling protocol (e.g., more SO per farm and more frequent herd visits), as well as improvements in the laboratory protocol, perhaps SO would be a useful alternative for ES. PMID:26851860

  14. [Effects of ruta SSP on the activity of the smooth gastrointestinal muscle isolated of rat].

    Science.gov (United States)

    Grigorjev, Carlota A; Brizuela, Nilda Y

    2010-01-01

    Ruta graveolens L. and Ruta chalepensis L. are plants used in folkloric medicine as antispasmodics, digestive and for intestinal gases. Animals used as experimental model were rats of the Wistar line, adult females, clinically healthy and with a weight average of 250 grams. We used strips of stomach and duodenum. Each one of the segments mounted on two stirrups in a bath of organ isolated with Ringer-lactate solution, at 37° C , pH: 7.3-7.4, and bubbled with 95% O2, 5% CO2. One of the stirrups was connected vertically to the bottom of the bath and the other to a transducer of tension connected to a Beckman polygraph. We applied 500 mgs of basal tension. After the stabilization, the ethanolic extract of Ruta ssp was added in increasing doses. At 50μl/ml the tone lower 23% in small intestine and lower 27% in stomach. However at 100 μl/ml the tone lower 32% and 35% respectively. In the other parameters the amplitude decrease 50% in the stomach at dose of 5 μl/ml while in the small intestine the amplitude lower 60%. With 10 μl/ml the amplitude change in both organs ( 96% in small intestine, and 75% in stomach). The frequency changes in both organs ( 32% in small intestine, and 50% in stomach) at 10 μl/ml Rue showed decreased effects on isolated small intestine and stomach were is dose dependent, maybe we were demonstrated the effects digestive of Ruta. PMID:21450144

  15. Flowering time in wild beet ( Beta vulgaris ssp. maritima) along a latitudinal cline

    Science.gov (United States)

    Dijk, Henk Van; Boudry, Pierre; McCombre, Helen; Vernet, Philippe

    The wild beet ( Beta vulgaris ssp. maritima, a perennial species from the Mediterranean and the European Atlantic coasts) shows marked variation in flowering time in terms of both the year of first flowering and flowering date in a given year. Much of this variability is related to latitude. Beta vulgaris plants flower either in the same year as they germinate or in their second year. This is mainly due to differences in their requirement for vernalization, which is determined by a single gene B/b and by quantitative trait loci. The more southern the origin of the plants, the less vernalization is required. Also the B allele, which cancels vernalization requirement completely, has a high frequency in the Mediterranean region, but is completely absent in the northern part of the distribution of this species. We found that flowering date variation in relation to the latitude of origin is maintained under greenhouse conditions but does not follow a simple clinal relationship. From the Mediterranean northwards to the west coast of Brittany, flowering occurs progressively earlier, but from Brittany northwards to south-east England and The Netherlands it is progressively later. A possible explanation for this difference is that in the southern part of the range sensitivity to daylength and warmth control flowering time, whereas further north vernalization requirement is also a key factor. A substantial part of all differences in flowering time was heritable: heritability within populations was measured as 0.33 under greenhouse conditions. The high heritability implies evolutionary change may occur in this character.

  16. Cloning by 3′-RACE and Expression of BrMYB34-3 Gene from Brassica rapa ssp.pekinensis%大白菜BrMYB34-3基因的3′-RACE克隆及表达

    Institute of Scientific and Technical Information of China (English)

    国静; 刘庆霞; 李梦莎; 张耀伟; 阎秀峰

    2011-01-01

    以大白菜叶片为材料,根据NCBI数据库中BrMYB34-3基因序列的已知信息,利用3-RACE获得了BrMYB34-3基因全长,用RT-PCR方法对BrMYB34-3在不同组织中的表达进行分析.结果显示,该基因全长1 135 bp,编码280个氨基酸.BrMYB34-3具有R2R3-MYB(含有2个MYB结构域的转录因子)典型的R2、R3结构域及基序.其氨基酸序列与大白菜的BrMYB34-1和BrMYB34-2、拟南芥的AtMYB34具有较高的一致性.BrMYB34-3在莲座叶、当天开的花中表达水平较高,在花序顶端表达水平较低,在根和花序轴中未检测到表达,这与拟南芥AtMYB34的表达模式不同.研究表明,BrMYB34-3是大白菜中的MYB34同源基因,在功能上可能与拟南芥AtMYB34基因存在差异.%An R2R3-MYB gene,BrMYB34-3, was isolated from the leaves of Brassica rapa ssp. pekinensis by 3′-RACE techniques based on the partial sequence in NCBI database. The full length of BrMYB34-3 cDNA was 1 135 bp,encoding 280 amino acids. The deduced amino acid sequence contained the conserved R2 and R3 domains near the N-terminus and a conserved motif which is the characteristic of R2R3-MYB transcription factor. Phylogenetic analysis revealed that BrMYB34-3 was clustered with BrMYB34-1 and BrMYB34-2 from Brassica rapa ssp. pekinensis and AtMYB34 from Arabidopsis thaliana. Expression analysis by RT-PCR showed that BrMYB34-3 was highly expressed in rosette leaves and flowers and lowly expressed in the tip of inflorescences,but not expressed in the roots and the inflorescence stems, which is different from the expression pattern of AtMYB34 in Arabidopsis thaliana. These results indicate that BrMYB34-3 is a homologous gene of MYB34 in Brassica rapa ssp. pekinensis,and it might have at least partial different functions with Arabidopsis AtMYB34.

  17. Avaliação da atividade antimicrobiana e citotóxica de extratos de Gochnatia polymorpha ssp floccosa Evaluation of antimicrobial and cytotoxic activitiy of extracts from Gochnatia polymorpha (Less) ssp floccosa

    OpenAIRE

    Maria Élida A. Stefanello; Marcos J. Salvador; Izabel Y. Ito; Patrícia A.T. Macari

    2006-01-01

    Neste estudo procedeu-se a avaliação da atividade antimicrobiana e citotóxica de extratos de Gochnatia polymorpha ssp floccosa, espécie empregada na medicina popular contra doenças respiratórias. Folhas, cascas do tronco e ramos foram extraídos com hexano, diclorometano e etanol, sucessivamente, sendo obtidos os respectivos extratos brutos. A atividade antimicrobiana foi determinada pelo método de difusão em ágar utilizando-se bactérias Gram-positivas, Gram-negativas e fungos. A avaliação da ...

  18. Salmonella enterica ssp. arizonae infection in a 43-year-old Italian man with hypoglobulinemia: a case report and review of the literature

    Directory of Open Access Journals (Sweden)

    Noto Pasquale

    2011-07-01

    Full Text Available Abstract Introduction Salmonella enterica ssp. arizonae is an uncommon human pathogen with serious infections reported in immunocompromised hosts. In Europe, only a few cases have been described. Patients with this infection usually have a history of contact with reptiles or travel abroad. We present a case report of infection in a patient with hypoglobulinemia and a literature review. Case presentation We describe the case of a 43-year-old Caucasian Italian man with hypoglobulinemia who presented to our hospital with sepsis and diarrhea. A stool culture yielded S. enterica ssp. arizonae. Our patient was treated with oral ciprofloxacin and made a full recovery. We also present a review of the cases of S. enterica ssp. arizonae infections previously reported in Europe. Conclusions The majority of infections from S. enterica ssp. arizonae occur in patients who are immunocompromised. Data from the literature suggests that it may be difficult to eradicate the bacteria and thus, prolonged antibiotic courses are often used. It would be advisable for clinicians to investigate for pre-existing immune dysfunction if S. enterica ssp. arizonae is isolated. In Italy, although there have only been a few cases, the likely route of transmission remains unclear and requires further surveillance.

  19. Advances in Arabidopsis research in China from 2006 to 2007

    Institute of Scientific and Technical Information of China (English)

    LIANG Yan; ZUO JianRu; YANG WeiCai

    2007-01-01

    @@ Arabidopsis thaliana, a model plant species, has a number of advantages over other plant species as an experimental organism due to many of its genetic and genomic features. The Chinese Arabidopsis community has made significant contributions to plant biology research in recent years[1,2]. In 2006, studies of plant biology in China received more attention than ever before, especially those pertaining to Arabidopsis research. Here we briefly summarize recent advances in Arabidopsis research in China.

  20. A modified method of 3D-SSP analysis for amyloid PET imaging using [11C]BF-227

    International Nuclear Information System (INIS)

    Three-dimensional stereotactic surface projection (3D-SSP) analyses have been widely used in dementia imaging studies. However, 3D-SSP sometimes shows paradoxical results on amyloid positron emission tomography (PET) analyses. This is thought to be caused by errors in anatomical standardization (AS) based on an 18F-fluorodeoxyglucose (FDG) template. We developed a new method of 3D-SSP analysis for amyloid PET imaging, and used it to analyze 11C-labeled 2-(2-[2-dimethylaminothiazol-5-yl]ethenyl)-6-(2-[fluoro]ethoxy) benzoxazole (BF-227) PET images of subjects with mild cognitive impairment (MCI) and Alzheimer's disease (AD). The subjects were 20 with MCI, 19 patients with AD, and 17 healthy controls. Twelve subjects with MCI were followed up for 3 years or more, and conversion to AD was seen in 6 cases. All subjects underwent PET with both FDG and BF-227. For AS and 3D-SSP analyses of PET data, Neurostat (University of Washington, WA, USA) was used. Method 1 involves AS for BF-227 images using an FDG template. In this study, we developed a new method (Method 2) for AS: First, an FDG image was subjected to AS using an FDG template. Then, the BF-227 image of the same patient was registered to the FDG image, and AS was performed using the transformation parameters calculated for AS of the corresponding FDG images. Regional values were normalized by the average value obtained at the cerebellum and values were calculated for the frontal, parietal, temporal, and occipital lobes. For statistical comparison of the 3 groups, we applied one-way analysis of variance followed by the Bonferroni post hoc test. For statistical comparison between converters and non-converters, the t test was applied. Statistical significance was defined as p < 0.05. Among the 56 cases we studied, Method 1 demonstrated slight distortions after AS of the image in 16 cases and heavy distortions in 4 cases in which the distortions were not observed with Method 2. Both methods demonstrated that the

  1. Evaluation of the wood CCA preservative treatment process of Eucalyptus (Eucaliptus ssp) by X-ray fluorescence technique

    International Nuclear Information System (INIS)

    Brazil produces around 1,2 mi m3 of treated wood to meet the annual demand of railway, electric, rural and construction sectors. The treated woods used for poles, sleepers, fence posts and plywoods should be according to Brazilian norms requirements. The most used wood species are eucalyptus (Eucaliptus ssp)and pine (Pinus ssp). The most wood preservative products used in Brazil are CCA (Chromated Copper Arsenate) and CCB (Copper Chromium and Boron Salt). The analytical methods, such as Flame Atomic Absorption Spectrometry (FAAS) and Plasma Inductively Coupled Optical Emission Spectrometry (ICPOES) have been used for the evaluation of those treatment processes. In this work, the sapwood sample was obtained from eucalyptus trees (Eucaliptus ssp) obtained from Minas Gerais State, Brazil, cut plantation areas. Sawdust sapwood sample was grounded and submitted to different additions of CCA solutions (0.2, 0.7, 1.3, 2.3, 3.6, 6.3, 11.7and17.9 kg m-3). Power and pressed pellets sapwood samples, analyzed by EDXRFS, showed a good linear relation (r2>0.99) between the characteristic intensity fluorescent lines (CuΚα, CrΚαand AsΚΒ) and their concentration, also, showed adequate sensitivity (LQ -1) for Cu, Cr and As determination in treated woods. Cu, Cr and As were determined in powdered sawdust samples by FAA spectrometry, using the AWPA A11-93 standard method; the relation between the CCA retention and their concentration showed a lower linear relation than EDXRFS; the FAAS spreading result could be attributed to laboratorial CCA addition process. (author)

  2. Bacillus amyloliquefaciens ssp. plantarum strains as potential protective starter cultures for the production of Bikalga, an alkaline fermented food

    DEFF Research Database (Denmark)

    Compaor, C.S.; Nielsen, D.S.; Sawadogo-Lingani, H.;

    2013-01-01

    Aims: To identify and screen dominant Bacillus spp. strains isolated from Bikalga, fermented seeds of Hibiscus sabdariffa for their antimicrobial activities in brain heart infusion (BHI) medium and in a H. sabdariffa seed-based medium. Further, to characterize the antimicrobial substances produced...... produced several lipopeptide antibiotics and showed good potential for biological control of Bikalga. Significance and Impact of the Study: Pathogenic bacteria often occur in spontaneous food fermentations. This is the first report to identify indigenous B. amyloliquefaciens ssp. plantarum strains as...

  3. The enhancement of anther culture efficiency in Brassica napus ssp. oleifera Metzg. (Sinsk.) using low doses of gamma irradiation

    International Nuclear Information System (INIS)

    Selected buds of Brassica napus ssp. oleifera Metzg. (Sinsk) cvs Ariana and Primor were treated with various doses of γ-irradiation. When the anthers were removed and cultured, it was shown that low doses of γ-irradiation greatly enhanced anther culture efficiency in both cultivars. When microspore culture techniques were used, however, embryogenesis was reduced by irradiation in all treatments. Some of the resulting embryoids developed directly into plantlets, whereas others developed abnormally and produced secondary embryoids. Plants were regenerated from both anther embryoids and secondary embryoids and, following diploidization, seed was obtained from these plants. (author)

  4. Analysis of expressed sequence tags from Musa acuminata ssp. burmannicoides, var. Calcutta 4 (AA) leaves submitted to temperature stresses

    OpenAIRE

    Santos, C R; Martins, N.F.; Horberg, H.M.; Almeida, E.R.P.; Coelho, M.C.F.; Togawa, R.; F. R. Silva; Caetano, A.R.; Miller, R.N.G.; de Souza, M T

    2005-01-01

    In order to discover genes expressed in leaves of Musa acuminata ssp. burmannicoides var. Calcutta 4 (AA), from plants submitted to temperature stress, we produced and characterized two full-length enriched cDNA libraries. Total RNA from plants subjected to temperatures ranging from 5°C to 25°C and from 25°C to 45°C was used to produce a COLD and a HOT cDNA library, respectively. We sequenced 1,440 clones from each library. Following quality analysis and vector trimming, we assembled 2,286 se...

  5. Full Scale Test SSP 34m blade, edgewise loading LTT. Extreme load and PoC_InvE Data report

    DEFF Research Database (Denmark)

    Nielsen, Magda; Roczek-Sieradzan, Agnieszka; Jensen, Find Mølholt;

    edgewise direction (LTT). The blade has been submitted to thorough examination by means of strain gauges, displacement transducers and a 3D optical measuring system. This data report presents results obtained during full scale testing of the blade up to 80% Risø load, where 80% Risø load corresponds to 100......This report is the second report covering the research and demonstration project “Eksperimentel vingeforskning: Strukturelle mekanismer i nutidens og fremtidens store vinger under kombineret last”, supported by the EUDP program. A 34m wind turbine blade from SSP-Technology A/S has been tested in...

  6. Mining the active proteome of Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Renier A. L. Van Der Hoorn

    2011-11-01

    Full Text Available Assigning functions to the >30.000 proteins encoded by the Arabidopsis genome is a challenging task of the Arabidopsis Functional Genomics Network. Although genome-wide technologies like proteomics and transcriptomics have generated a wealth of information that significantly accelerated gene annotation, protein activities are poorly predicted by transcript or protein levels as protein activities are post-translationally regulated. To directly display protein activities in Arabidopsis proteomes, we developed and applied Activity-based Protein Profiling (ABPP. ABPP is based on the use of small molecule probes that react with the catalytic residues of distinct protein classes in an activity-dependent manner. Labeled proteins are separated and detected from proteins gels and purified and identified by mass spectrometry. Using probes of six different chemotypes we have displayed of activities of 76 Arabidopsis proteins. These proteins represent over ten different protein classes that contain over 250 Arabidopsis proteins, including cysteine- serine- and metallo-proteases, lipases, acyltransferases, and the proteasome. We have developed methods for identification of in vivo labeled proteins using click-chemistry and for in vivo imaging with fluorescent probes. In vivo labeling has revealed novel protein activities and unexpected subcellular activities of the proteasome. Labeling of extracts displayed several differential activities e.g. of the proteasome during immune response and methylesterases during infection. These studies illustrate the power of ABPP to display the functional proteome and testify to a successful interdisciplinary collaboration involving chemical biology, organic chemistry and proteomics.

  7. Bioavailability of nanoparticulate hematite to Arabidopsis thaliana

    International Nuclear Information System (INIS)

    The environmental effects and bioavailability of nanoparticulate iron (Fe) to plants are currently unknown. Here, plant bioavailability of synthesized hematite Fe nanoparticles was evaluated using Arabidopsis thaliana (A. thaliana) as a model. Over 56-days of growing wild-type A. thaliana, the nanoparticle-Fe and no-Fe treatments had lower plant biomass, lower chlorophyll concentrations, and lower internal Fe concentrations than the Fe-treatment. Results for the no-Fe and nanoparticle-Fe treatments were consistently similar throughout the experiment. These results suggest that nanoparticles (mean diameter 40.9 nm, range 22.3–67.0 nm) were not taken up and therefore not bioavailable to A. thaliana. Over 14-days growing wild-type and transgenic (Type I/II proton pump overexpression) A. thaliana, the Type I plant grew more than the wild-type in the nanoparticle-Fe treatment, suggesting Type I plants cope better with Fe limitation; however, the nanoparticle-Fe and no-Fe treatments had similar growth for all plant types. -- Highlights: ► Iron nanoparticles were synthesized and assessed for bioavailability to Arabidopsis. ► Arabidopsis grew better in the presence of EDTA-bound iron than nanoparticulate iron. ► Arabidopsis grew the same in the presence of nanoparticulate iron compared to no iron. -- Synthesized iron nanoparticles were not bioavailable to Arabidopsis thaliana in agar nutrient media

  8. Fertilization in Brassica campestris ssp.pekinensis and its duration of each stage

    Institute of Scientific and Technical Information of China (English)

    PENG Jie; SHEN Jiaheng

    2007-01-01

    This paper reports the process of fertilization in Brassica campestris ssp.pekinensis and the duration of each stage.The results are as follows:(1)Pollen germinates on stigma 2-3 h after pollination.(2)4-8 h after pollination,pollen tube grows in the style.(3)8-14 h after pollination,pollen tube grows in the ovary and gets into the ovule via the micropyle.(4)16 h after pollination,one sperm nucleus moves to the egg and enters it.(5)The sperm nucleus adheres to the nuclear membrane of the egg 18 h after pollination.(6)20 h after pollination,it enters the egg nucleus and male chromatin gradually disperses and 24 h after pollination,a male nucleolus appears.A large female nucleolus and a small male nucleolus occur in the nucleus of the fertilized egg,and zygote formed.The dispersing of sperm chromatin in the egg nucleus takes about 4 h.(7)32--34 h after pollination,the division of zygote begins.The dormancy stage of the zygote lasts for about 8-10 h.(8)The pair polar nuclei lie in the chalazal end of the egg betbre fertilization,which may fuse into a secondary nucleus or not.(9)16-18 h after pollination,the sperm nucleus moves to the polar nuclei or the secondary nucleus.18 h after pollination,the sperm nucleus adheres to the nuclear membrane of the polar nuclei or that of the secondary nucleus.(10)20 h after pollination,the sperm nucleus enters one of the polar nuclei or the secondary nucleus and a triple fusion takes place.The process of fusion is similar to the karyogamy but faster.The dispersing of the sperm chromatin in the polar nucleus or secondary nucleus takes about 2 h.(11)22 h after pollination,the primary endosperm nucleus formed.The female and male nucleoli cannot fuse with each other betbre mitotic division of the primary endosperm nucleus.(12)24 h after pollination,the division of the primary endosperm nucleus actually takes place.

  9. Subsurface irrigation of potato crop (Solanum tuberosum ssp. Andigena) in Suka Kollus with different drainage systems

    Science.gov (United States)

    Serrano-Coronel, Genaro; Chipana-Rivera, René; Fátima Moreno-Pérez, María; Roldán-Cañas, José

    2016-04-01

    Among the most important hydraulic structures of pre-Hispanic ancestral technology developed in the Andean region, we find the suka kollus, aymara word, called also waru waru, en quechua or raised fields, in English. They are raised platforms surrounded by water canals that irrigate subsurface, but also have the function of draining, to deal with floods because they are surrounding Lake Titicaca. They also have the property of generating a thermoregulatory effect to crops, depending on the configuration of the channels and platforms. Such agro-ecosystems are being abandoned, however, if properly addressed crop management and some drainage canals are replaced by underground drains for increased crop area could be very useful in enabling marginal soils affected by salts and / or excess water. For these reasons, the objective of this study was to evaluate the subsurface irrigation in the potato crop in suka kollus under a system of surface drainage, and mixed drainage (surface and subsurface). The study was conducted in marginal soils of Kallutaca area, located 30 km from the city of La Paz, Bolivia, at a height of 3892 m.a.s.l. The cultivation of the potato (Solanum tuberosum ssp. Andigena) was used. Four treatments were tested with different widths of the platforms: T1 (Control) with drainage through channels; T2 (replacing a channel by a drain); T3 (replacing two channels by two drains); T4 (replacing three channels by three drains). The flow of water into the soil from the water table was predominantly upward, except during periods of high rainfall. In terms of treatments, the flow in T1 was higher, mainly at weeks 8 to 11 after seedling emergence, coinciding with the phenological phases of flowering and at the beginning of the tuber ripening. It was followed by T3, T2 and T4 treatments, respectively. Tuber yield, if one considers that the channels detract arable land, was higher in the T3 treatment,16.4 Mg / ha, followed by T2 treatment, 15.2 Mg / ha, T1

  10. Recent Progress in Arabidopsis Research in China: A Preface

    Institute of Scientific and Technical Information of China (English)

    Zhi-Hong Xu

    2006-01-01

    @@ In 2002, a workshop on Arabidopsis research in China was held in Shanghai, when a small group of Chinese plant scientists was working on this model species. Since then, we have witnessed the rapid growth of Arabidopsis research in China. This special issue of Journal of Integrative Plant Biology is dedicated exclusively to the Fourth Workshop on Arabidopsis Research in China, scheduled on November 30, 2005, in Beijing. In addition to reports collected in this special issue, the Chinese Arabidopsis community has been able to make significant contributions to many research fields. Here, I briefly summarize recent advances in Arabidopsis research in China.

  11. The arabidopsis cyclic nucleotide interactome

    KAUST Repository

    Donaldson, Lara

    2016-05-11

    Background Cyclic nucleotides have been shown to play important signaling roles in many physiological processes in plants including photosynthesis and defence. Despite this, little is known about cyclic nucleotide-dependent signaling mechanisms in plants since the downstream target proteins remain unknown. This is largely due to the fact that bioinformatics searches fail to identify plant homologs of protein kinases and phosphodiesterases that are the main targets of cyclic nucleotides in animals. Methods An affinity purification technique was used to identify cyclic nucleotide binding proteins in Arabidopsis thaliana. The identified proteins were subjected to a computational analysis that included a sequence, transcriptional co-expression and functional annotation analysis in order to assess their potential role in plant cyclic nucleotide signaling. Results A total of twelve cyclic nucleotide binding proteins were identified experimentally including key enzymes in the Calvin cycle and photorespiration pathway. Importantly, eight of the twelve proteins were shown to contain putative cyclic nucleotide binding domains. Moreover, the identified proteins are post-translationally modified by nitric oxide, transcriptionally co-expressed and annotated to function in hydrogen peroxide signaling and the defence response. The activity of one of these proteins, GLYGOLATE OXIDASE 1, a photorespiratory enzyme that produces hydrogen peroxide in response to Pseudomonas, was shown to be repressed by a combination of cGMP and nitric oxide treatment. Conclusions We propose that the identified proteins function together as points of cross-talk between cyclic nucleotide, nitric oxide and reactive oxygen species signaling during the defence response.

  12. Anti-microbial and anti-oxidant activities of Illicium verum, Crataegus oxyacantha ssp. monogyna and Allium cepa red and white varieties

    OpenAIRE

    Benmalek, Yamina; Yahia, Ouahiba Ait; Belkebir, Aicha; Fardeau, Marie-Laure

    2013-01-01

    Illicium verum (badiane or star anise), Crataegus oxyacantha ssp monogyna (hawthorn) and Allium cepa (onion), have traditionnally been used as medicinal plants in Algeria. This study showed that the outer layer of onion is rich in flavonols with contents of 103 +/- 7.90 mu g/g DW (red variety) and 17.3 +/- 0.69 mu g/g DW (white variety). We also determined flavonols contents of 14.3 +/- 0.21 mu g/g 1.65 +/- 0.61 mu g/g for Crataegus oxyacantha ssp monogyna leaves and berries and 2.37 +/- 0.10...

  13. Production of antihypertensive peptides by enzymatic zein hydrolysate from maize-zea mays ssp. mexicana introgression line

    International Nuclear Information System (INIS)

    Teosintes are essential gene reservoir for maize breeding improvement, among which Zea mays ssp. mexicana has many valuable traits deserved to be transferred into maize genetic background. In this study, one maize-teosinte introgression line SD00100 was selected from the population of Zea mays ssp. mexicana as wild parent. This introgression line manifested the outstanding agricultural traits similar to maize parent Ye 515 and alien genetic material was identified by genomic in situ hybridization (GISH). To produce bioactive peptides with potent angiotensin converting enzyme (ACE) inhibitory activity, zein extracted from endosperm meal was then undergone enzymatic hydrolysis with thermolysin and the hydrolysate was then filtered through a 3 kDa cut-off membrane. ACE inhibitory activity of permeate from Ye 515 and SD00100 was evaluated by RP-HPLC. The IC50 values of the peptides obtained from maize parent and the introgression line were 96.9 micro g/ml and 22.9 micro g/ml, respectively, with significant difference between them. Our results showed that an outstanding inbred maize line was obtained for production of antihypertensive peptides as well as for further development of functional food. (author)

  14. HLA-DRβ1*04 typing by simple in-house PCR-SSP technique for rheumatoid arthritis patients.

    Science.gov (United States)

    Parasannanavar, Devaraj Jatteppa; Yeola, Avani; Pradhan, Vandana; Rajyadhaksha, Anjali; Ghosh, Kanjaksha

    2013-04-01

    A strong association between rheumatoid arthritis (RA) and human leukocyte antigen (HLA) has been observed in many different populations and that accounts for approximately one-third of the genetic component of RA susceptibility. The greatest effect comes from DRβ1 gene where the strongest association has been found with DRβ1*04 (DR4) allele. As serology has some disadvantages over polymerase chain reaction (PCR)-based techniques and commercially available PCR-based kits are expensive, this study was aimed to standardize simple in-house PCR-SSP technique. Accuracy of this test was further checked with standard PCR-SSOP (RLS) results. The frequency HLA-DRβ1*04 was significantly increased among RA patients when compared with normal controls. In this study, a very simple, convenient and more cost-effective in-house PCR-SSP technique was standardized for HLA-DRβ1*04 typing that is helpful to RA diagnosis in developing countries like India, which can be used as a good screening test. PMID:22623274

  15. Macrolide Resistance in the Syphilis Spirochete, Treponema pallidum ssp. pallidum: Can We Also Expect Macrolide-Resistant Yaws Strains?

    Science.gov (United States)

    Šmajs, David; Paštěková, Lenka; Grillová, Linda

    2015-10-01

    Treponema pallidum ssp. pallidum (TPA) causes over 10 million new cases of syphilis worldwide whereas T. pallidum ssp. pertenue (TPE), the causative agent of yaws, affects about 2.5 million people. Although penicillin remains the drug of choice in the treatment of syphilis, in penicillin-allergic patients, macrolides have been used in this indication since the 1950s. Failures of macrolides in syphilis treatment have been well documented in the literature and since 2000, there has been a dramatic increase in a number of clinical samples with macrolide-resistant TPA. Scarce data regarding the genetics of macrolide-resistant mutations in TPA suggest that although macrolide-resistance mutations have emerged independently several times, the increase in the proportion of TPA strains resistant to macrolides is mainly due to the spread of resistant strains, especially in developed countries. The emergence of macrolide resistance in TPA appears to require a two-step process including either A2058G or A2059G mutation in one copy of the 23S rRNA gene and a subsequent gene conversion unification of both rRNA genes. Given the enormous genetic similarity that was recently revealed between TPA and TPE strains, there is a low but reasonable risk of emergence and spread of macrolide-resistant yaws strains following azithromycin treatment. PMID:26217043

  16. USE OF METHYL JASMONATE TO ENHANCE THE PRODUCTION OF 6-METHOXYPODOPHYLLOTOXIN IN CELL CULTURES OF LINUM THRACICUM SSP. THRACICUM

    Directory of Open Access Journals (Sweden)

    Pavlina Sasheva

    2015-09-01

    Full Text Available Secondary metabolites, such as lignans have important ecological role for plants and at the same time are lead structures for drug design in human medicine. The aryltetralin type of lignans are strong cytotoxic agents and are found in members of the genus Linum (Linaceae.Objective: In vitro cultures of Linum thracicum ssp. thracicum were developed to identify a medium type and an elicitation technique that favor enhanced production of the aryltetralin lignan 6-methoxypodophyllotoxin.Method: Methyl jasmonate and salicylic acid were administered to four cell lines of Linum thracicum ssp. thracicum for 24 and 72 hours. The 6-methoxypodophyllotoxin was identified by HPLS-ESI-MS/MS in positive ion mode, and its production was determined via quantitative HPLC analysis.Results: A cell line, called Li-20, which was developed in reduced sucrose environment proved to be the fastest growing and the highest producing among the tested cell lines. Within 24 hours upon MJ elicitation, the eight-day-old Li-20 increased 2.3-fold in 6-methoxypodophyllotoxin content, reaching 4.3 mg on a dry weight basis. Negative or no effect was registered after salicylic acid application.Conclusion: MJ elicitation is an effective strategy to improve the 6-methoxypodophyllotoxin accumulation within short periods of time, and an optimization of the cultivation medium beforehand is a prerequisite in the pipeline.

  17. Application of a Simple In-House PCR-SSP Technique for HLA-B* 27 Typing in Spondyloarthritis Patients

    Directory of Open Access Journals (Sweden)

    Devraj J. Parasannanavar

    2013-01-01

    Full Text Available Background. Microlymphocytotoxicity (MLCT and flowcytometry (FC are the conventional serological methods to detect HLA-B* 27. Due to some disadvantages in these methods, most of the HLA laboratories have now switched over to molecular methods. Molecular techniques based on commercial kits are expensive; as such many laboratories with limited funds in developing countries cannot afford these techniques. Aims. Our main aim was to standardize a simple inexpensive in-house PCR-SSP technique for HLA-B* 27 typing. Materials and Methods. Sequence Specific primers were designed to amplify all the subtypes of B* 27 using IMGT-HLA sequence database. Accuracy was checked by retyping of 90 PCR-SSOP typed controls. Results. The presence of 149 bp specific band with control band on 2% agarose gel showed B* 27 positivity. No discrepancies were found when compared with PCR-SSOP results. The frequency of HLA-B* 27 was found to be significantly increased (68.75% versus 4.40%, O.R 46.909: P value 6.62E-32 among 700 SpA patients as compared to controls. Clinically, 54% of patients had polyarticular arthritis with SI joints involvement (68% and restricted spine flexion (60%. Conclusion. In-house PCR-SSP technique is very simple and inexpensive technique to detect B* 27 allele, which was strongly associated with SpA patients from Western India.

  18. A SNP and SSR based genetic map of asparagus bean (Vigna. unguiculata ssp. sesquipedialis and comparison with the broader species.

    Directory of Open Access Journals (Sweden)

    Pei Xu

    Full Text Available Asparagus bean (Vigna. unguiculata ssp. sesquipedialis is a distinctive subspecies of cowpea [Vigna. unguiculata (L. Walp.] that apparently originated in East Asia and is characterized by extremely long and thin pods and an aggressive climbing growth habit. The crop is widely cultivated throughout Asia for the production of immature pods known as 'long beans' or 'asparagus beans'. While the genome of cowpea ssp. unguiculata has been characterized recently by high-density genetic mapping and partial sequencing, little is known about the genome of asparagus bean. We report here the first genetic map of asparagus bean based on SNP and SSR markers. The current map consists of 375 loci mapped onto 11 linkage groups (LGs, with 191 loci detected by SNP markers and 184 loci by SSR markers. The overall map length is 745 cM, with an average marker distance of 1.98 cM. There are four high marker-density blocks distributed on three LGs and three regions of segregation distortion (SDRs identified on two other LGs, two of which co-locate in chromosomal regions syntenic to SDRs in soybean. Synteny between asparagus bean and the model legume Lotus. japonica was also established. This work provides the basis for mapping and functional analysis of genes/QTLs of particular interest in asparagus bean, as well as for comparative genomics study of cowpea at the subspecies level.

  19. Arabidopsis CDS blastp result: AK243152 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase PP1 isozyme 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains...P1 isozyme 4 (TOPP4) / phosphoprotein phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphat... a Ser/Thr protein phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 1e-154 ... ...AK243152 J100032N02 At2g39840.1 68415.m04893 serine/threonine protein phosphatase P

  20. Arabidopsis CDS blastp result: AK288069 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase PP1 isozyme 4 (EC 3.1.3.16) {Arabidopsis thaliana}, phosphoprotein phosphatase 1 GI:166801 (Arabidopsis thaliana); contains...P1 isozyme 4 (TOPP4) / phosphoprotein phosphatase 1 identical to SP|P48484 Serine/threonine protein phosphat... a Ser/Thr protein phosphatase signature (PDOC00115); contains a metallo-phosphoesterase motif (QDOC50185) 6e-70 ... ...AK288069 J075158N05 At2g39840.1 68415.m04893 serine/threonine protein phosphatase P

  1. Gibberellins control fruit patterning in Arabidopsis thaliana.

    Science.gov (United States)

    Arnaud, Nicolas; Girin, Thomas; Sorefan, Karim; Fuentes, Sara; Wood, Thomas A; Lawrenson, Tom; Sablowski, Robert; Østergaard, Lars

    2010-10-01

    The Arabidopsis basic helix-loop-helix (bHLH) proteins INDEHISCENT (IND) and ALCATRAZ (ALC) specify tissues required for fruit opening that have major roles in seed dispersal and plant domestication. Here, we show that synthesis of the phytohormone gibberellin is a direct and necessary target of IND, and that ALC interacts directly with DELLA repressors, which antagonize ALC function but are destabilized by gibberellin. Thus, the gibberellin/DELLA pathway has a key role in patterning the Arabidopsis fruit, and the interaction between DELLA and bHLH proteins, previously shown to connect gibberellin and light responses, is a versatile regulatory module also used in tissue patterning. PMID:20889713

  2. Identification of Yellow Pigmentation Genes in Brassica rapa ssp. pekinensis Using Br300 Microarray

    Directory of Open Access Journals (Sweden)

    Hee-Jeong Jung

    2014-01-01

    Full Text Available The yellow color of inner leaves in Chinese cabbage depends on its lutein and carotene content. To identify responsible genes for yellow pigmentation in leaves, the transcriptome profiles of white (Kenshin and yellow leaves (Wheessen were examined using the Br300K oligomeric chip in Chinese cabbage. In yellow leaves, genes involved in carotene synthesis (BrPSY, BrPDS, BrCRTISO, and BrLCYE, lutein, and zeaxanthin synthesis (BrCYP97A3 and BrHYDB were upregulated, while those associated with carotene degradation (BrNCED3, BrNCED4, and BrNCED6 were downregulated. These expression patterns might support that the content of both lutein and total carotenoid was much higher in the yellow leaves than that in the white leaves. These results indicate that the yellow leaves accumulate high levels of both lutein and β-carotene due to stimulation of synthesis and that the degradation rate is inhibited. A large number of responsible genes as novel genes were specifically expressed in yellow inner leaves, suggesting the possible involvement in pigment synthesis. Finally, we identified three transcription factors (BrA20/AN1-like, BrBIM1, and BrZFP8 that are specifically expressed and confirmed their relatedness in carotenoid synthesis from Arabidopsis plants.

  3. Progeny of Eucalyptus globulus Labill ssp. Globulus%蓝桉子代测定

    Institute of Scientific and Technical Information of China (English)

    臧道群; 张川红; 罗军民; 黄永祥; 朱仁刚

    2003-01-01

    本文对云南省一平浪蓝桉实生种子园的子代测定林进行初期评价.该子代测定采用α-循环设计,21个重复,每个重复有18个不完全区组,每个区组分为15个小区,每小区2株树.全部270个家系均为自由授粉的半同胞家系,按来源分为3个类型(原产地天然林、云南地方品种和种子园),11个地区.调查和分析的数据包括造林后2年时的树高、胸径、冠幅、干形、抗寒性和存活率等性状.分析结果如下:1. 不同的类型在生长表现上存在显著差异,来自种子园的类型为最好.2. 自不同地区的蓝桉在各性状上都表现出显著差异.在生长表现上,来自维克多利亚东部、西部和各种子园的子代比其它地区的好.云南当地蓝桉子代的耐寒性和两年时的保存率为最好,在生长、干形和抗病方面与塔斯马尼亚东部和南部的蓝桉子代表现相似.采用两株小区,明显比单株小区降低小区缺失率,提高分析的可靠性.表3参7.%The preliminary assessment of progeny test in a seed orchard of Eucalyptus globulus Labill. ssp. globulus at Yipinglang State Farm of Yunnan Province in China was conducted. The trial was composed of 21 replications, with 2 trees on each plot, 15 plots in each incomplete block, and 18 incomplete blocks in each replication, laid out in a α- design of 270 open-pollinated families . The families were of three categories (natural populations, local land race and seed orchard). They were further subdivided into 11 regions. The data from an assessment of growth, stem form and other characteristics of the young trees after being planted 2 years were analyzed. Results are as follows: the different categories differed significantly in their growth, with the families from seed orchards being the best. Regions also differed significantly in their growth. The families from the regions of Western Victoria, Eastern Victoria and all three seed orchards were better than others. The

  4. Arabidopsis CDS blastp result: AK066771 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066771 J013083K07 At1g01170.1 ozone-responsive stress-related protein, putative s...imilar to stress-related ozone-induced protein AtOZI1 (GI:790583) [Arabidopsis thaliana]; contains 1 predicted transmembrane domain; 2e-29 ...

  5. Arabidopsis CDS blastp result: AK059353 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059353 001-026-D01 At1g01170.1 ozone-responsive stress-related protein, putative ...similar to stress-related ozone-induced protein AtOZI1 (GI:790583) [Arabidopsis thaliana]; contains 1 predicted transmembrane domain; 2e-29 ...

  6. Arabidopsis CDS blastp result: AK059160 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK059160 001-023-D05 At1g01170.1 ozone-responsive stress-related protein, putative ...similar to stress-related ozone-induced protein AtOZI1 (GI:790583) [Arabidopsis thaliana]; contains 1 predicted transmembrane domain; 3e-28 ...

  7. Arabidopsis CDS blastp result: AK242849 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242849 J090072M15 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  8. Arabidopsis CDS blastp result: AK288959 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288959 J090084E19 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  9. Arabidopsis CDS blastp result: AK243008 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243008 J090097H12 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  10. Arabidopsis CDS blastp result: AK288072 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288072 J075161I05 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  11. Arabidopsis CDS blastp result: AK243178 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243178 J100036P15 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  12. Arabidopsis CDS blastp result: AK243505 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243505 J100074N19 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  13. Arabidopsis CDS blastp result: AK287577 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287577 J065037N08 At1g68370.1 68414.m07809 gravity -responsive protein / altered response to gravity ... ty protein (ARG1) identical to Altered Response to Gravity ... [Arabidopsis thaliana] GI:4249662; contains Pfam p ...

  14. Protease gene families in Populus and Arabidopsis

    Directory of Open Access Journals (Sweden)

    Jansson Stefan

    2006-12-01

    Full Text Available Abstract Background Proteases play key roles in plants, maintaining strict protein quality control and degrading specific sets of proteins in response to diverse environmental and developmental stimuli. Similarities and differences between the proteases expressed in different species may give valuable insights into their physiological roles and evolution. Results We have performed a comparative analysis of protease genes in the two sequenced dicot genomes, Arabidopsis thaliana and Populus trichocarpa by using genes coding for proteases in the MEROPS database 1 for Arabidopsis to identify homologous sequences in Populus. A multigene-based phylogenetic analysis was performed. Most protease families were found to be larger in Populus than in Arabidopsis, reflecting recent genome duplication. Detailed studies on e.g. the DegP, Clp, FtsH, Lon, rhomboid and papain-Like protease families showed the pattern of gene family expansion and gene loss was complex. We finally show that different Populus tissues express unique suites of protease genes and that the mRNA levels of different classes of proteases change along a developmental gradient. Conclusion Recent gene family expansion and contractions have made the Arabidopsis and Populus complements of proteases different and this, together with expression patterns, gives indications about the roles of the individual gene products or groups of proteases.

  15. Arabidopsis CDS blastp result: AK241402 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241402 J065159A02 At4g19070.1 68417.m02810 cadmium-responsive protein / cadmium i...nduced protein (AS8) identical to cadmium induced protein AS8 SP:P42735 from [Arabidopsis thaliana] 3e-11 ...

  16. Arabidopsis CDS blastp result: AK242143 [KOME

    Lifescience Database Archive (English)

    Full Text Available ar to GI:6573119 from [Lycopersicon esculentum] (Plant Physiol. 122 (1), 292 (2000)) 3e-12 ... ... identical to SP|Q9C888 Phospholipase D epsilon (EC 3.1.4.4) (AtPLDepsilon) (PLD epsilon) (PLDalpha3) {Arabidopsis thaliana}; simil

  17. Arabidopsis CDS blastp result: AK242143 [KOME

    Lifescience Database Archive (English)

    Full Text Available ar to GI:6573119 from [Lycopersicon esculentum] (Plant Physiol. 122 (1), 292 (2000)) 6e-22 ... ... identical to SP|Q9C888 Phospholipase D epsilon (EC 3.1.4.4) (AtPLDepsilon) (PLD epsilon) (PLDalpha3) {Arabidopsis thaliana}; simil

  18. Arabidopsis CDS blastp result: AK240654 [KOME

    Lifescience Database Archive (English)

    Full Text Available ar to GI:6573119 from [Lycopersicon esculentum] (Plant Physiol. 122 (1), 292 (2000)) 1e-160 ... ... identical to SP|Q9C888 Phospholipase D epsilon (EC 3.1.4.4) (AtPLDepsilon) (PLD epsilon) (PLDalpha3) {Arabidopsis thaliana}; simil

  19. Arabidopsis CDS blastp result: AK242290 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242290 J075191E07 At4g13870.1 68417.m02148 Werner Syndrome-like exonuclease (WEX)... contains Pfam profile PF01612: 3'-5' exonuclease; identical to Werner Syndrome-like exonuclease [Arabidopsis thaliana] GP:28195109 gb:AAO33765 1e-20 ...

  20. Arabidopsis CDS blastp result: AK063585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK063585 001-118-A04 At4g13870.2 Werner Syndrome-like exonuclease (WEX) contains Pf...am profile PF01612: 3'-5' exonuclease; identical to Werner Syndrome-like exonuclease [Arabidopsis thaliana] GP:28195109 gb:AAO33765 6e-16 ...

  1. Arabidopsis CDS blastp result: AK242290 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242290 J075191E07 At4g13870.2 68417.m02149 Werner Syndrome-like exonuclease (WEX)... contains Pfam profile PF01612: 3'-5' exonuclease; identical to Werner Syndrome-like exonuclease [Arabidopsis thaliana] GP:28195109 gb:AAO33765 1e-20 ...

  2. Arabidopsis CDS blastp result: AK243230 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243230 J100044L04 At1g19850.1 68414.m02490 transcription factor MONOPTEROS (MP) /... auxin-responsive protein (IAA24) / auxin response factor 5 (ARF5) identical to transcription factor MONOPTEROS (MP/IAA24/ARF5) SP:P93024 from [Arabidopsis thaliana] 2e-65 ...

  3. Arabidopsis CDS blastp result: AK103452 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK103452 J033129I11 At1g19850.1 transcription factor MONOPTEROS (MP) / auxin-respon...sive protein (IAA24) / auxin response factor 5 (ARF5) identical to transcription factor MONOPTEROS (MP/IAA24/ARF5) SP:P93024 from [Arabidopsis thaliana] 1e-166 ...

  4. Arabidopsis CDS blastp result: AK318617 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK318617 J100090H20 At1g19850.1 68414.m02490 transcription factor MONOPTEROS (MP) /... auxin-responsive protein (IAA24) / auxin response factor 5 (ARF5) identical to transcription factor MONOPTEROS (MP/IAA24/ARF5) SP:P93024 from [Arabidopsis thaliana] 2e-63 ...

  5. Arabidopsis CDS blastp result: AK287832 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287832 J065187F20 At1g30950.1 68414.m03790 unusual floral organ (UFO ) / F-box family protein ( ... ubunit; almost identical to unusual floral organs (UFO )GI:4376159 from [Arabidopsis thaliana] Landsberg-e ...

  6. Arabidopsis CDS blastp result: AK241547 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241547 J065176G22 At1g30950.1 68414.m03790 unusual floral organ (UFO ) / F-box family protein ( ... ubunit; almost identical to unusual floral organs (UFO )GI:4376159 from [Arabidopsis thaliana] Landsberg-e ...

  7. Arabidopsis CDS blastp result: AK242616 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 2e-34 ... ...AK242616 J090017C19 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  8. Arabidopsis CDS blastp result: AK242846 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 9e-12 ... ...AK242846 J090071I10 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  9. Arabidopsis CDS blastp result: AK241162 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241162 J065116A05 At5g54800.1 68418.m06826 glucose-6-phosphate/phosphate translocator, putative identic...al to glucose 6 phosphate/phosphate translocator [Arabidopsis thaliana] gi|7229675|gb|AAF42936 2e-11 ...

  10. Arabidopsis CDS blastp result: AK242098 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 3e-22 ... ...AK242098 J075143H11 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  11. Arabidopsis CDS blastp result: AK243041 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 4e-31 ... ...AK243041 J100008G07 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  12. Arabidopsis CDS blastp result: AK243539 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 6e-34 ... ...AK243539 J100078G04 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  13. Arabidopsis CDS blastp result: AK242576 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 3e-22 ... ...AK242576 J090009A15 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  14. Arabidopsis CDS blastp result: AK289111 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 5e-20 ... ...AK289111 J090096N14 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  15. Arabidopsis CDS blastp result: AK289248 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK289248 J100079D02 At5g54800.1 68418.m06826 glucose-6-phosphate/phosphate translocator, putative identic...al to glucose 6 phosphate/phosphate translocator [Arabidopsis thaliana] gi|7229675|gb|AAF42936 7e-19 ...

  16. Arabidopsis CDS blastp result: AK287695 [KOME

    Lifescience Database Archive (English)

    Full Text Available ve contains PF00481: Protein phosphatase 2C domain; identical to protein phosphatase 2C (GI:4587992) [Arabidopsis thaliana] 3e-81 ... ...AK287695 J065129B08 At2g40180.1 68415.m04941 protein phosphatase 2C, putative / PP2C, putati

  17. Arabidopsis CDS blastp result: AK243048 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243048 J100010D20 At1g07370.1 68414.m00786 proliferating cell nuclear ... antigen 1 (PCNA1) identi ... cal to SP|Q9M7Q7 Proliferating cellular nuclear ... antigen 1 (PCNA 1) {Arabidopsis thaliana}; nearly ... identical to SP|Q43124 Proliferating cell nuclear ... antigen (PCNA) {Brassica napus}; contains Pfam pro ...

  18. Arabidopsis CDS blastp result: AK071591 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK071591 J023105C08 At2g29570.1 proliferating cell nuclear ... antigen 2 (PCNA2) identical to SP|Q9Z ... W35 Proliferating cell nuclear ... antigen 2 (PCNA 2) {Arabidopsis thaliana}; nearly ... identical to SP|Q43124 Proliferating cell nuclear ... antigen (PCNA) {Brassica napus}; contains Pfam pro ...

  19. Arabidopsis CDS blastp result: AK243048 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243048 J100010D20 At2g29570.1 68415.m03591 proliferating cell nuclear ... antigen 2 (PCNA2) identi ... cal to SP|Q9ZW35 Proliferating cell nuclear ... antigen 2 (PCNA 2) {Arabidopsis thaliana}; nearly ... identical to SP|Q43124 Proliferating cell nuclear ... antigen (PCNA) {Brassica napus}; contains Pfam pro ...

  20. Arabidopsis CDS blastp result: AK241265 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241265 J065132C02 At3g19450.1 68416.m02466 cinnamyl-alcohol dehydrogenase (CAD ) identical to S ... 523 Cinnamyl-alcohol dehydrogenase (EC 1.1.1.195) (CAD ) [Arabidopsis thaliana] 1e-81 ...

  1. Arabidopsis CDS blastp result: AK105739 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105739 001-202-A05 At3g19450.1 cinnamyl-alcohol dehydrogenase (CAD ) identical to SP|P48523 Cin ... namyl-alcohol dehydrogenase (EC 1.1.1.195) (CAD ) [Arabidopsis thaliana] 2e-46 ...

  2. Arabidopsis CDS blastp result: AK243022 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243022 J100001E20 At3g19450.1 68416.m02466 cinnamyl-alcohol dehydrogenase (CAD ) identical to S ... 523 Cinnamyl-alcohol dehydrogenase (EC 1.1.1.195) (CAD ) [Arabidopsis thaliana] 4e-64 ...

  3. Arabidopsis CDS blastp result: AK287708 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287708 J065132C02 At3g19450.1 68416.m02466 cinnamyl-alcohol dehydrogenase (CAD ) identical to S ... 523 Cinnamyl-alcohol dehydrogenase (EC 1.1.1.195) (CAD ) [Arabidopsis thaliana] 1e-81 ...

  4. Arabidopsis CDS blastp result: AK121261 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121261 J023104H13 At1g55350.4 calpain-type cysteine protease family identical to calpain...-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family... cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 0.0 ...

  5. Arabidopsis CDS blastp result: AK100867 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100867 J023124E13 At2g29640.1 josephin family protein contains Pfam domain PF02099: Jose...phin; similar to Josephin-like protein (Swiss-Prot:O82391) [Arabidopsis thaliana] 7e-59 ...

  6. Arabidopsis CDS blastp result: AK065851 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065851 J013041L15 At1g79010.1 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial (TY ... ursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-23KD) (CI -23KD) (Complex I- 28.5KD) (CI -28.5KD) {Arabidopsis ...

  7. Arabidopsis CDS blastp result: AK119532 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119532 001-203-F01 At1g79010.1 NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial (T ... ursor (EC 1.6.5.3) (EC 1.6.99.3) (Complex I-23KD) (CI -23KD) (Complex I- 28.5KD) (CI -28.5KD) {Arabidopsis ...

  8. Arabidopsis CDS blastp result: AK243512 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243512 J100075C18 At4g16280.3 68417.m02471 flowering time ... control protein / FCA gamma (FCA) id ... entical to SP|O04425 Flowering time ... control protein FCA {Arabidopsis thaliana}; four a ...

  9. Arabidopsis CDS blastp result: AK243512 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243512 J100075C18 At4g16280.2 68417.m02470 flowering time ... control protein / FCA gamma (FCA) id ... entical to SP|O04425 Flowering time ... control protein FCA {Arabidopsis thaliana}; four a ...

  10. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-130 ...

  11. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 2e-65 ...

  12. Arabidopsis CDS blastp result: AK110534 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK110534 002-168-A07 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-114 ...

  13. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 1e-24 ...

  14. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  15. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 2e-45 ...

  16. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 3e-66 ...

  17. Arabidopsis CDS blastp result: AK069071 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK069071 J023010H01 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-167 ...

  18. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-124 ...

  19. Arabidopsis CDS blastp result: AK060286 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060286 001-006-C08 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 6e-78 ...

  20. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 0.0 ...

  1. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 2e-29 ...

  2. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 5e-25 ...

  3. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At5g16910.1 68418.m01982 cellulose synthase family protein similar to gi:2827143 cellulo...se synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 1e-28 ...

  4. Arabidopsis CDS blastp result: AK105393 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105393 001-123-B04 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 0.0 ...

  5. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 8e-25 ...

  6. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 1e-126 ...

  7. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 8e-63 ...

  8. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 1e-125 ...

  9. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At1g32180.1 68414.m03958 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-9 (gi:9622890) from Zea mays 0.0 ...

  10. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 2e-26 ...

  11. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 4e-47 ...

  12. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 4e-98 ...

  13. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 8e-98 ...

  14. Arabidopsis CDS blastp result: AK109812 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK109812 002-147-H02 At5g16910.1 cellulose synthase family protein similar to gi:2827143 cellulose... synthase catalytic subunit, Arabidopsis thaliana, gi:9622886 cellulose synthase-7 from Zea mays 5e-90 ...

  15. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32540.1 68415.m03975 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 3e-31 ...

  16. Arabidopsis CDS blastp result: AK121003 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121003 J023045B21 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-167 ...

  17. Arabidopsis CDS blastp result: AK242601 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242601 J090014G03 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 5e-48 ...

  18. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At4g23990.1 68417.m03448 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 1e-45 ...

  19. Arabidopsis CDS blastp result: AK242585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242585 J090010M20 At4g38190.1 68417.m05391 cellulose synthase family protein similar to cellulose... synthase catalytic subunit gi:2827143 from [Arabidopsis thaliana], cellulose synthase-5 (gi:9622882) from Zea mays 4e-27 ...

  20. Arabidopsis CDS blastp result: AK061162 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061162 006-209-A01 At2g32540.1 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 3e-35 ...

  1. Arabidopsis CDS blastp result: AK242890 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242890 J090079L19 At2g32530.1 68415.m03974 cellulose synthase family protein similar to cellulose... synthase catalytic subunit from Arabidopsis thaliana [gi:5230423], cellulose synthase-5 from Zea mays [gi:9622882] 4e-50 ...

  2. Arabidopsis CDS blastp result: AK066153 [KOME

    Lifescience Database Archive (English)

    Full Text Available pC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino... terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  3. Arabidopsis CDS blastp result: AK287906 [KOME

    Lifescience Database Archive (English)

    Full Text Available subunit / ClpC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF028...61: Clp amino terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  4. Arabidopsis CDS blastp result: AK069552 [KOME

    Lifescience Database Archive (English)

    Full Text Available pC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino... terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  5. Arabidopsis CDS blastp result: AK100126 [KOME

    Lifescience Database Archive (English)

    Full Text Available pC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino... terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  6. Arabidopsis CDS blastp result: AK058510 [KOME

    Lifescience Database Archive (English)

    Full Text Available lpC almost identical to ClpC GI:2921158 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amin...o terminal domain; contains Pfam profile PF00004: ATPase, AAA family; contains Pfam profile PF02151: UvrB/uvrC motif 0.0 ...

  7. Shotgun Proteomic Analysis of Arabidopsis thaliana Leaves

    Science.gov (United States)

    Two shotgun tandem mass spectrometry proteomics approaches, Multidimensional Protein Identification Technology (MudPIT) and 1D-Gel-LC-MS/MS, were used to identify Arabidopsis thaliana leaf proteins. These methods utilize different protein/peptide separation strategies. Detergents not compatible wit...

  8. Arabidopsis CDS blastp result: AK318553 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK318553 J075145A22 At4g11230.1 68417.m01819 respiratory burst ... oxidase, putative / NADPH oxidase ... , putative similar to respiratory burst ... oxidase homolog F [gi:3242456], RbohAp108 [gi:2654 ... 868] from Arabidopsis thaliana, respiratory burst ... oxidase homolog [GI:16549087] from Solanum tuberos ...

  9. Arabidopsis CDS blastp result: AK110694 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK110694 002-170-A08 At5g59560.2 sensitivity to red light reduced protein (SRR1) id...entical to sensitivity to red light reduced protein [Arabidopsis thaliana] GI:25527089; supporting cDNA gi|25527088|gb|AY127047.1| 1e-18 ...

  10. Arabidopsis CDS blastp result: AK099399 [KOME

    Lifescience Database Archive (English)

    Full Text Available 079; contains weak similarity to the SAPB protein (TR:E236624) [Arabidopsis thaliana]; similar to seven transme...AK099399 J013000O17 At3g05010.1 transmembrane protein, putative similar to GB:AAB61...mbrane domain orphan receptor (GI:4321619) [Mus musculus] contains 7 transmembrane domains; 2e-89 ...

  11. Arabidopsis CDS blastp result: AK241202 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241202 J065122B10 At3g20600.1 68416.m02607 non-race specific disease resistance protein (NDR1) ... protein (NDR1) GB:AF021346 [Arabidopsis thaliana] (Science ... 278 (5345), 1963-1965 (1997)) 2e-11 ...

  12. Arabidopsis CDS blastp result: AK240830 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240830 J065014C16 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retin...oblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  13. Arabidopsis CDS blastp result: AK121431 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121431 J023138G19 At3g12280.1 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma...-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  14. Arabidopsis CDS blastp result: AK064987 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK064987 J013001D03 At3g12280.1 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma...-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  15. Arabidopsis CDS blastp result: AK241627 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241627 J065187G05 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retin...oblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma...-associated protein A domain, PF01857 retinoblastoma-associated protein B domain 0.0 ...

  16. Arabidopsis CDS blastp result: AK241568 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241568 J065179E12 At3g56700.1 68416.m06307 male ... sterility protein, putative similar to SP|Q088 ... 91 Male ... sterility protein 2 {Arabidopsis thaliana}; contai ... ns Pfam profile PF03015: Male ... sterility protein 2e-70 ...

  17. Arabidopsis CDS blastp result: AK242888 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242888 J090079L06 At3g56700.1 68416.m06307 male ... sterility protein, putative similar to SP|Q088 ... 91 Male ... sterility protein 2 {Arabidopsis thaliana}; contai ... ns Pfam profile PF03015: Male ... sterility protein 8e-81 ...

  18. Arabidopsis CDS blastp result: AK287630 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287630 J065073I15 At5g22260.1 68418.m02593 male ... sterility 1 protein, putative (MS1) identical ... to male ... sterility 1 protein [Arabidopsis thaliana] gi|1555 ... fam profile PF00628: PHD-finger; identical to cDNA male ... sterility 1 protein (ms1 gene) GI:15554514 3e-78 ...

  19. Arabidopsis CDS blastp result: AK058440 [KOME

    Lifescience Database Archive (English)

    Full Text Available 20S proteasome beta subunit PBB1 (PBB1) GB:AAC32066 [Arabidopsis thaliana] (Genetics 149 (2), 677-692 (1998)); contains Pfam profile: PF00227 proteasome A-type and B-type; 1e-92 ...

  20. Arabidopsis CDS blastp result: AK119246 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119246 001-121-C04 At5g26570.1 glycoside hydrolase starch -binding domain-containing protein si ... milar to SEX1 (starch ... excess) [Arabidopsis thaliana] GI:12044358; contai ... ns Pfam profile PF00686: Starch ... binding domain 1e-116 ...

  1. Arabidopsis CDS blastp result: AK072331 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072331 J023039L19 At5g26570.1 glycoside hydrolase starch -binding domain-containing protein sim ... ilar to SEX1 (starch ... excess) [Arabidopsis thaliana] GI:12044358; contai ... ns Pfam profile PF00686: Starch ... binding domain 0.0 ...

  2. Arabidopsis CDS blastp result: AK107208 [KOME

    Lifescience Database Archive (English)

    Full Text Available Ala hydrolase, putative virtually identical to gr1-protein from [Arabidopsis thaliana] GI:3559811; similar t...AK107208 002-125-B11 At1g44350.1 IAA-amino acid hydrolase 6, putative (ILL6) / IAA-

  3. Arabidopsis CDS blastp result: AK072218 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072218 J013167O21 At1g55350.4 calpain-type cysteine protease family identical to calpain...-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family... cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 1e-150 ...

  4. Arabidopsis CDS blastp result: AK287447 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287447 J043016O04 At2g46590.1 68415.m05811 Dof zinc finger protein DAG2 / Dof affecting germination... 2 (DAG2) identical to SP|Q9ZPY0 DOF zinc finger protein DAG2 (Dof affecting germination 2) {Arabidopsis thaliana} 2e-30 ...

  5. Arabidopsis CDS blastp result: AK103126 [KOME

    Lifescience Database Archive (English)

    Full Text Available 0S proteasome beta subunit PBB1 (PBB1) GB:AAC32066 [Arabidopsis thaliana] (Genetics 149 (2), 677-692 (1998)); contains Pfam profile: PF00227 proteasome A-type and B-type; 1e-129 ...

  6. Arabidopsis CDS blastp result: AK243298 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243298 J100053J04 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 2e-44 ...

  7. Arabidopsis CDS blastp result: AK241385 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241385 J065156D02 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 1e-11 ...

  8. Arabidopsis CDS blastp result: AK241333 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241333 J065144I22 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 2e-35 ...

  9. Arabidopsis CDS blastp result: AK240730 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK240730 J043030K09 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 6e-11 ...

  10. Arabidopsis CDS blastp result: AK241521 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241521 J065170L14 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 9e-32 ...

  11. Arabidopsis CDS blastp result: AK288402 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288402 J090030B22 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 7e-25 ...

  12. Arabidopsis CDS blastp result: AK241581 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241581 J065181K09 At3g30290.1 68416.m03825 cytochrome P450 family protein similar to Cytochrom ... similar to GB:C71417 from [Arabidopsis thaliana] (Nature ... 391 (6666), 485-488 (1998)) 7e-12 ...

  13. Engineering calcium oxalate crystal formation in Arabidopsis

    Science.gov (United States)

    Many plants accumulate crystals of calcium oxalate. Just how these crystals form remains unknown. To gain insight into the mechanisms regulating calcium oxalate crystal formation, a crystal engineering approach was initiated utilizing the non-crystal accumulating plant, Arabidopsis. The success of t...

  14. Arabidopsis CDS blastp result: AK288349 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288349 J090023P19 At2g46590.1 68415.m05811 Dof zinc finger protein DAG2 / Dof affecting germination... 2 (DAG2) identical to SP|Q9ZPY0 DOF zinc finger protein DAG2 (Dof affecting germination 2) {Arabidopsis thaliana} 1e-23 ...

  15. Arabidopsis CDS blastp result: AK241364 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241364 J065152E11 At2g46590.1 68415.m05811 Dof zinc finger protein DAG2 / Dof affecting germination... 2 (DAG2) identical to SP|Q9ZPY0 DOF zinc finger protein DAG2 (Dof affecting germination 2) {Arabidopsis thaliana} 2e-20 ...

  16. Arabidopsis thaliana glucuronosyltransferase in family GT14.

    Science.gov (United States)

    Dilokpimol, Adiphol; Geshi, Naomi

    2014-01-01

    Arabinogalactan proteins are abundant cell-surface proteoglycans in plants and are involved in many cellular processes including somatic embryogenesis, cell-cell interactions, and cell elongation. We reported a glucuronosyltransferase encoded by Arabidopsis AtGlcAT14A, which catalyzes an addition of glucuronic acid residues to β-1,3- and β-1,6-linked galactans of arabinogalactan (Knoch et al. 2013). The knockout mutant of this gene resulted in the enhanced growth rate of hypocotyls and roots of seedlings, suggesting an involvement of AtGlcAT14A in cell elongation. AtGlcAt14A belongs to the family GT14 in the Carbohydrate Active Enzyme database (CAZy; www.cazy.org), in which a total of 11 proteins, including AtGLCAT14A, are classified from Arabidopsis thaliana. In this paper, we report the enzyme activities for the rest of the Arabidopsis GT14 isoforms, analyzed in the same way as for AtGlcAT14A. Evidently, two other Arabidopsis GT14 isoforms, At5g15050 and At2g37585, also possess the glucuronosyltransferase activity adding glucuronic acid residues to β-1,3- and β-1,6-linked galactans. Therefore, we named At5g15050 and At2g37585 as AtGlcAT14B and AtGlcAT14C, respectively. PMID:24739253

  17. Arabidopsis CDS blastp result: AK242817 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242817 J090063G17 At3g48560.1 68416.m05302 acetolactate synthase, chloroplast / acetohydroxy-a ... cid synthase (ALS ) nearly identical to SP|P17597 Acetolactate syntha ... ormerly EC 4.1.3.18) (Acetohydroxy-acid synthase) (ALS ) {Arabidopsis thaliana} 0.0 ...

  18. Arabidopsis CDS blastp result: AK058963 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058963 001-020-C04 At3g48560.1 acetolactate synthase, chloroplast / acetohydroxy-acid synthase ... (ALS ) nearly identical to SP|P17597 Acetolactate syntha ... ormerly EC 4.1.3.18) (Acetohydroxy-acid synthase) (ALS ) {Arabidopsis thaliana} 2e-15 ...

  19. Arabidopsis CDS blastp result: AK109628 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK109628 002-138-C02 At3g48560.1 acetolactate synthase, chloroplast / acetohydroxy-acid synthase ... (ALS ) nearly identical to SP|P17597 Acetolactate syntha ... ormerly EC 4.1.3.18) (Acetohydroxy-acid synthase) (ALS ) {Arabidopsis thaliana} 0.0 ...

  20. Arabidopsis CDS blastp result: AK242722 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242722 J090045F10 At3g16857.2 68416.m02153 two-component responsive regulator fam...ily protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 2e-22 ...

  1. Arabidopsis CDS blastp result: AK111864 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111864 J033025G23 At3g16857.2 two-component responsive regulator family protein / response regulato...r family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 1e-92 ...

  2. Arabidopsis CDS blastp result: AK241362 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241362 J065151H17 At3g16857.1 68416.m02152 two-component responsive regulator fam...ily protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 5e-13 ...

  3. Arabidopsis CDS blastp result: AK112039 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK112039 001-044-C11 At3g16857.2 two-component responsive regulator family protein / response regulato...r family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 4e-18 ...

  4. Arabidopsis CDS blastp result: AK111899 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK111899 J023034P21 At3g16857.2 two-component responsive regulator family protein / response regulato...r family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 1e-92 ...

  5. Arabidopsis CDS blastp result: AK242722 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242722 J090045F10 At3g16857.1 68416.m02152 two-component responsive regulator fam...ily protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 2e-22 ...

  6. Arabidopsis CDS blastp result: AK241362 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241362 J065151H17 At3g16857.2 68416.m02153 two-component responsive regulator fam...ily protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain; similar to... ARR1 protein GB:BAA74528 from [Arabidopsis thaliana] (Plant Cell Physiol. (1998) 39 (11), 1232-1239) 5e-13 ...

  7. HYDROPONIC METHOD FOR CULTURING POPULATIONS OF ARABIDOPSIS

    Science.gov (United States)

    A plant life-cycle bioassay using Arabidopsis thaliana (L.) Heynh. was developed to detect potential chemical phytotoxicity. The bioassay requires large numbers of plants to maximize the probability of detecting deleterious effect and to avoid any bias that could occur if only a ...

  8. Arabidopsis CDS blastp result: AK119521 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK119521 001-202-D09 At3g57050.2 cystathionine beta-lyase, chloroplast / beta-cystathionase...thionase) (Cysteine lyase) {Arabidopsis thaliana} 1e-173 ... ... / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cysta

  9. Arabidopsis CDS blastp result: AK108403 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108403 002-142-G06 At3g57050.2 cystathionine beta-lyase, chloroplast / beta-cystathionase...thionase) (Cysteine lyase) {Arabidopsis thaliana} 5e-36 ... ... / cysteine lyase (CBL) identical to SP|P53780 Cystathionine beta-lyase, chloroplast precursor (EC 4.4.1.8) (CBL) (Beta-cysta

  10. Arabidopsis CDS blastp result: AK065345 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK065345 J013008D19 At1g19720.1 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-87 ...

  11. Arabidopsis CDS blastp result: AK243514 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243514 J100075D15 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 7e-40 ...

  12. Arabidopsis CDS blastp result: AK243585 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243585 J100082O14 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 5e-20 ...

  13. Arabidopsis CDS blastp result: AK287666 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK287666 J065117E22 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 1e-41 ...

  14. Arabidopsis CDS blastp result: AK242010 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242010 J075106F03 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 7e-14 ...

  15. Arabidopsis CDS blastp result: AK243244 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243244 J100046N20 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 4e-29 ...

  16. Arabidopsis CDS blastp result: AK288271 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288271 J090017A22 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 3e-24 ...

  17. Arabidopsis CDS blastp result: AK242268 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242268 J075186C19 At1g33280.1 68414.m04116 no apical meristem (NAM) family protein similar to ... CUC1 (GP:12060422) {Arabidopsis thaliana} amd ... to NAM (GP:1279640) {Petunia x hybrida} 1e-45 ...

  18. Arabidopsis CDS blastp result: AK069545 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK069545 J023025I06 At5g13630.1 magnesium -chelatase subunit chlH, chloroplast, putative / Mg-pro ... IX chelatase, putative (CHLH) nearly identical to magnesium ... chelatase subunit GI:1154627 from [Arabidopsis tha ... liana]; contains Pfam profile: PF02514 CobN/magnesium ... chelatase family protein 0.0 ...

  19. Arabidopsis CDS blastp result: AK065420 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065420 J013022D10 At5g13630.1 magnesium -chelatase subunit chlH, chloroplast, putative / Mg-pro ... IX chelatase, putative (CHLH) nearly identical to magnesium ... chelatase subunit GI:1154627 from [Arabidopsis tha ... liana]; contains Pfam profile: PF02514 CobN/magnesium ... chelatase family protein 1e-166 ...

  20. Arabidopsis CDS blastp result: AK062262 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062262 001-047-H04 At5g13630.1 magnesium -chelatase subunit chlH, chloroplast, putative / Mg-pr ... IX chelatase, putative (CHLH) nearly identical to magnesium ... chelatase subunit GI:1154627 from [Arabidopsis tha ... liana]; contains Pfam profile: PF02514 CobN/magnesium ... chelatase family protein 0.0 ...

  1. Arabidopsis CDS blastp result: AK060612 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060612 001-025-F03 At5g13630.1 magnesium -chelatase subunit chlH, chloroplast, putative / Mg-pr ... IX chelatase, putative (CHLH) nearly identical to magnesium ... chelatase subunit GI:1154627 from [Arabidopsis tha ... liana]; contains Pfam profile: PF02514 CobN/magnesium ... chelatase family protein 0.0 ...

  2. Arabidopsis CDS blastp result: AK067323 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK067323 J013106B16 At5g13630.1 magnesium -chelatase subunit chlH, chloroplast, putative / Mg-pro ... IX chelatase, putative (CHLH) nearly identical to magnesium ... chelatase subunit GI:1154627 from [Arabidopsis tha ... liana]; contains Pfam profile: PF02514 CobN/magnesium ... chelatase family protein 0.0 ...

  3. Over-expression of an Arabidopsis δ-OAT gene enhances salt and drought tolerance in transgenic rice

    Institute of Scientific and Technical Information of China (English)

    WU Liangqi; FAN Zhanmin; GUO Lei; LI Yongqing; ZHANG Wenjing; QU Li-Jia; CHEN Zhangliang

    2003-01-01

    δ-OAT, ornithine-δ-aminotransferase, is the key enzyme involved in proline biosynthesis. In this study the Arabidopsisδ-OAT gene was transferred into rice (Oryza sativa L. ssp japonica cv. Zhongzuo 321), whose successful integration was demonstrated by PCR and Southern blot analysis. The over-expression of the gene in transgenic rice was also confirmed. Biochemical analysis showed that, under salt or drought stress conditions, proline contents in the leaves and roots in transgenic rice plants were 5- to 15-fold of those in non-transgenic controls. Under stress conditions, germinating rate of transgenic lines is higher than that of controls. Although the growth of rice plants tested were more and more retarded with the increasing of NaCl concentration, the transgenic plants grow faster compared to the controls under the same stress condition. Meanwhile, the resistance to KCl and MgSO4 stresses was also found enhanced in transgenic rice. Furthermore, the over-expression ofδ-OAT also improved the yield of transgenic plants under stress conditions. The average yield per plant of transgenic lines increases about 12%-41% more than that of control lines under 0.1 mol/L NaCl stress. These data indicated that the over-expression of δ-OAT, with the accumulation of proline, resulted in the enhancement of salt and drought tolerance and an increase of rice yield, which is of significance in agriculture.

  4. CITOGENETICS EFFECTS INDUCED BY THE ADMINISTRATION OF SUBSTANCES WITH REDUCTION POTENTIAL AT LARIX DECIDUA MILL. SSP. CARPATICA, PICEA ABIES (L. KARST. AND THUJA ORIENTALIS L

    Directory of Open Access Journals (Sweden)

    Ioana Anca Ieremia

    2007-08-01

    Full Text Available The paper present the influence of ascorbic acid, riboflavin, citric acid and sodium bisulphit upon the mitotic division of Larix decidua Mill ssp. carpatica, Picea abies (L. Karst and Thuja orientalis L. The treatment was applied in one variant, germinated seeds in ascorbic acid, riboflavin, citric acid and sodium bisulphit in 3 concentrations.

  5. Note on Celastrus paniculatus Willd. ssp. aggregatus K.M. Matthew ex K.T. Matthew (Celastraceae)

    OpenAIRE

    Francis, J W; M.M. Dandu; M. M. Sardesai; A.S. Dhabe

    2012-01-01

    Celastrus L., a large genus of family Celastraceae, is represented by ca 31 species in the world. In India the genus is represented by seven species and one subspecies. This paper deals with addition of Celastrus paniculatus ssp. aggregatus to the flora of Andhra Pradesh, Kerala, Goa and Andaman Islands. A note on its distribution is also provided in this paper.

  6. Anti-microbial and anti-oxidant activities of Illicium verum, Crataegus oxyacantha ssp monogyna and Allium cepa red and white varieties.

    Science.gov (United States)

    Benmalek, Yamina; Yahia, Ouahiba Ait; Belkebir, Aicha; Fardeau, Marie-Laure

    2013-01-01

    Illicium verum (badiane or star anise), Crataegus oxyacantha ssp monogyna (hawthorn) and Allium cepa (onion), have traditionnally been used as medicinal plants in Algeria. This study showed that the outer layer of onion is rich in flavonols with contents of 103 ± 7.90 µg/g DW (red variety) and 17.3 ± 0.69 µg/gDW (white variety). We also determined flavonols contents of 14.3 ± 0.21 µg/g 1.65 ± 0.61 µg/g for Crataegus oxyacantha ssp monogyna leaves and berries and 2.37 ± 0.10 µg/g for Illicium verum. Quantitative analysis of anthocyanins showed highest content in Crataegus oxyacantha ssp monogyna berries (5.11 ± 0.266 mg/g), while, inner and outer layers of white onion had the lowest contents with 0.045 ± 0.003mg/g and 0.077 ± 0.001 mg/g respectively.   Flavonols extracts presented high antioxidant activity as compared with anthocyanins and standards antioxidants (ascorbic acid and quercetin). Allium cepa and Crataegus oxyacantha ssp monogyna exhibited the most effective antimicrobial activity. PMID:23579100

  7. Primula munroi 的产自东喜马拉雅的一个新亚种 --P. munroi ssp. schizocalyx%A new subspecies of Primula munroi Lindl. from the Eastern Himalaya--P. munroi ssp. schizocalyx

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ In the course of revising the genus Primula Linn.(Primulaceae) in the Himalayas of Indian region, the authors came across a set of collections identified as P. involucrata Wall. gathered by the pioneer Himalayan travellers, merely written on determinavit slips as P. involucrata Wall. forma schizocalyx by I. B. Balfour without any date. Critical studies revealed that these specimens are quite distinct from the species proper so far described. The new taxon is described as a subspecies and illustrated. As P. involucrata Wall. ex Duby (1844) is a later homonym of P. involucrata Sweet (1839) and illegitimate, and its correct name is P. munroi Lindl. (1847), we name our new subspecies as P. munroi ssp. schizocalyx Balf. f. ex Basak et Maiti. 

  8. Pólen 2n e mecanismos meióticos de formação em Solanum commersonii ssp 2n pollen and meiotic mechanisms of Formation in Solanum commersonii ssp

    Directory of Open Access Journals (Sweden)

    Lívia Gracielle Oliveira Tomé

    2009-04-01

    Full Text Available Solanum commersonii subsp. commersonii Dun. e Solanum commersonii subsp. malmeanum Bitt. (2n=2x=24 - 1EBN não podem ser diretamente cruzadas com a batata cultivada de S. tuberosum subsp. tuberosum L. (2n=4x=48 -4 EBN em razão da barreira da ploidia e do número de equilíbrio do endosperma (EBN. No entanto, a produção de pólen não reduzido por S. commersonii ssp. (2x=2n=24 - 1EBN, permite o cruzamento desta com dihaplóides de batata e com as espécies diplóides S. phureja Juz. & Bukasov. e S. chacoense Bitt., que possuem 2 EBN. Conduziu-se este trabalho, com o objetivo de determinar o mecanismo meiótico e a freqüência dos grãos de pólen não reduzidos em cinco clones de Solanum commersonii ssp. Foram avaliados três clones de S. commersonii subsp. commersonii (SCC e dois de S. commersonii subsp. malmeanum (SCM. Nas avaliações, duzentos grãos de pólen viáveis foram corados (carmim acético 2% e mensurados, sendo considerados não reduzidos aqueles com o diâmetro igual ou superior a 25 µm. O clone Solanum commersonii subsp. commersonii Dun. (SCC 100 produz 26.1% de polen não reduzido, por fusos fundidos e fusos paralelos, o qual pode ser utilizado em programas de melhoramento.Solanum commersonii subsp. commersonii Dun. and Solanum commersonii subsp. malmeanum Bitt. (2n=2x=24 -1EBN cannot be directly crossed with the cultivated Solanum tuberosum subsp. Tuberosum L. (2n=4x=48 - 4EBN species due to ploidy barriers and endosperm balance number (EBN. However, non-reduced pollen production by the wild species S. commersonii ssp. (2x=2n=24 -1EBN, allows the crossing of these species with dihaploids of potato and with the diploids species, S. phureja Juz. & Bukasov. and S. chacoense Bitt., all with 2EBN. The aim of this work was to determine the meiotic mechanism and frequency of non-reduced pollen production of five clones of S. commersonii ssp. Three different clones of S. commersonii subsp. commersonii Dun. (SCC and two of S

  9. Enhanced natural killer cell activation by exopolysaccharides derived from yogurt fermented with Lactobacillus delbrueckii ssp. bulgaricus OLL1073R-1.

    Science.gov (United States)

    Makino, Seiya; Sato, Asako; Goto, Ayako; Nakamura, Marie; Ogawa, Miho; Chiba, Yoshika; Hemmi, Jun; Kano, Hiroshi; Takeda, Kazuyoshi; Okumura, Ko; Asami, Yukio

    2016-02-01

    Yogurt is generally recognized as a beneficial food for our health, but research into its physiological effects has focused mainly on intestinal dysfunctions such as constipation and diarrhea. We previously found yogurt fermented with Lactobacillus delbrueckii ssp. bulgaricus OLL1073R-1 (hereafter OLL1073R-1) could reduce risks of catching the common cold and flu in human trials. It was assumed that immunostimulatory exopolysaccharide (EPS) produced from OLL1073R-1 play an important role in this context. However, few studies have examined the immunostimulatory effects of traditional Bulgarian yogurts fermented with different strains of lactobacilli and their metabolites. Therefore, we screened 139 L. delbrueckii ssp. bulgaricus strains and identified OLL1073R-1 as the most robust producer of EPS. This strain was also the only strain that induced the production of IFN-γ in vitro. Oral administration of the EPS or yogurt fermented with OLL1073R-1 and Streptococcus thermophilus OLS3059 (OLL1073R-1 yogurt) augmented natural killer (NK) cell activity and induced IFN-γ production in spleen cells in mice, whereas 2 other yogurts fermented with other strains had no effect on NK cell activity. Cellular preparations of the OLL1073R-1 strain also slightly augmented NK cell activity, but were less effective than EPS itself. The EPS-dependent stimulation of NK cell activity was abrogated in IFN-γ knockout mice and in myeloid differentiation factor 88 knockout mice. Furthermore, IFN-γ production from spleen cells stimulated with EPS was completely blocked with both anti-IL-12 and anti-IL-18 antibodies in vitro. These findings suggest that NK cell activation by OLL1073R-1 yogurt is EPS-dependent, occurs via IL-12- and IL-18-mediated IFN-γ production, and requires myeloid differentiation factor 88. We showed that traditional Bulgarian yogurt could exert immunostimulatory effects by selecting starter strains and part of the mechanisms depend on IFN-γ inducible EPS produced

  10. Putative lipoproteins identified by bioinformatic genome analysis of Leifsonia xyli ssp. xyli, the causative agent of sugarcane ratoon stunting disease.

    Science.gov (United States)

    Sutcliffe, Iain C; Hutchings, Matthew I

    2007-01-01

    SUMMARY Leifsonia xyli ssp. xyli is the causative agent of ratoon stunting disease, a major cause of economic loss in sugarcane crops. Understanding of the biology of this pathogen has been hampered by its fastidious growth characteristics in vitro. However, the recent release of a genome sequence for this organism has allowed significant novel insights. Further to this, we have performed a bioinformatic analysis of the lipoproteins encoded in the L. xyli genome. These analyses suggest that lipoproteins represent c. 2.0% of the L. xyli predicted proteome. Functional analyses suggest that lipoproteins make an important contribution to the physiology of the pathogen and may influence its ability to cause disease in planta. PMID:20507484

  11. Transformation of Chinese Cabbage (Brassica rapa L. ssp.pekinensis) by Agrobacterium Micro-Injection into Flower Bud

    Institute of Scientific and Technical Information of China (English)

    YAN Ji-yong; HE Yu-ke; CAO Jia-shu

    2003-01-01

    We obtained two lines of Chinese head cabbage (Brassica rapa L. ssp. pekinensis) selfed progenies containing both an anti-sense gene of BcpLH and a gene for resistance to kanamycin by micro-injecting buds of their primary transformants (T0) with Agrobacterium tumefaciens strain LBA4404. 31 positive plants resistant to kanamycien were recovered. Southern blot analysis confirmed the presence of T-DNA in two transgenic plants. One (DHZ-13-1) exhibits the characteristics of out-toward rosette and cauline leaves, and nested flower model in which secondary complete flower developed from the base of the primary ovary and the third flower from the ovary in the secondary flower, and so on, while another(DHZ-6-1) has no phenotype change. ABA and IAA affected the root growth of progeny of DHZ-13-1, but 6-BA was insensitive to hypocotyl growth during its seedling development.

  12. The biological effects of gamma irradiation on secondary embryoids of Brassica napus ssp. oleifera (Metzg.) Sinsk., winter oilseed rape

    International Nuclear Information System (INIS)

    The effects of gamma irradiation on secondary embryoids of Brassica napus ssp. oleifera (Metzg.) Sinsk., winter oilseed rape, are reported. A kill curve was established, and the secondary embryoids were found to be more tolerant of high doses of irradiation than tissues of many other plant species. Secondary embryoids which had received less than 320 Gy retained their secondary embryogenic potential at subsequent subcultures, although their potential to develop into plantlets was greatly reduced. A haploid line from the cultivar Rapora was found to be more sensitive to gamma irradiation than a diploid line from the cultivar Primor. A number of regenerant plants have been established from irradiated embryoids and grown on to flowering. (author)

  13. Preventative effects of a probiotic,Lactobacillus salivarius ssp.salivarius,in the TNBS model of rat colitis

    Institute of Scientific and Technical Information of China (English)

    Laura Peran; Julio Galvez; Desiree Camuesco; Monica Comalada; Ana Nieto; Angel Concha; Maria Paz Diaz-Ropero; Monica Olivares; Jordi Xaus; Antonio Zarzuelo

    2005-01-01

    AIM: To investigate the intestinal anti-inflammatory effect and mechanism of a probiotic Lactobacillus sakuvarius ssp.salivariusCECT5713 in the TNBS model of rat colitis.METHODS: Female Wistar rats (180-200 g) were used in this study. A group of rats were administered orally the probiotic L. salivarius ssp. salivarius (5×108 CFU suspended in 0.5 mL of skimmed milk) daily for 3 wk. Two additional groups were used for reference, a non-colitic and a control colitic without probiotic treatment, which received orally the vehicle used to administer the probiotic. Two weeks after starting the experiment, the rats were rendered colitic by intracolonic administration of 10 mg of TNBS dissolved in 0.25 mL of 500 mL/L ethanol. One week after colitis induction, all animals were killed and colonic damage was evaluated both histologically and biochemically. The biochemical studies performed in colonic homogenates include determination of myeloperoxidase (MPO) activity,glutathione (GSH) content, leukotriene B4 (LTB4) and tumor necrosis factor α (TNF-α) levels, as well as inducible nitric oxide synthase (iNOS) expression. In addition, the luminal contents obtained from colonic samples were used for microbiological studies, in order to determine Lactobacilli and Bifidobacteria counts.RESULTS: Treatment of colitic rats with L. salivarius ssp.salivarius resulted in amelioration of the inflammatory response in colitic rats, when compared with the corresponding control group without probiotic treatment. This antiinflammatory effect was evidenced macroscopically by a significant reduction in the extent of colonic necrosis and/or inflammation induced by the administration of TNBS/ethanol (2.3+0.4 cm vs3.4+0.3 cm in control group,P<0.01) and histologically by improvement of the colonic architecture associated with a reduction in the neutrophil infiltrate in comparison with non-treated colitic rats. The latter was confirmed biochemically by a significant reduction of colonic MPO

  14. Kinetics of Batch Fermentation in the Cultivation of a Probiotic Strain Lactobacillus Delbrueckii Ssp. Bulgaricus B1

    Directory of Open Access Journals (Sweden)

    Goranov Bogdan

    2015-07-01

    Full Text Available A comparative study of kinetic models to describe the dynamics of the fermentation process of culturing of a probiotic strain Lactobacillus delbrueckii ssp. bulgaricus B1 was performed. The models of Monod, Aiba, Tiessier, Hinshelwood and the equation of the logistic curve combined with the model of Ludeking-Piret were used. It has been found that the different models described the observed fermentation dynamics differently. The conducted comparative study demonstrated that the models of Monod and the equation of the logistic curve combined with the model of Ludeking-Piret were suitable for the description of the fermentation dynamics. The mathematical models showed no significant product and/or substrate inhibition. The culture developed with a low specific growth rate, but nevertheless it accumulated 1012-1013 viable cells. The substrate was absorbed primarily from cells in the stationary growth phase rather than cells in the exponential growth phase

  15. Morphologlcal and anatomical structure of generative organs of Salsola kali ssp. ruthenica (lljin Soó at the SEM level

    Directory of Open Access Journals (Sweden)

    Krystyna Idzikowska

    2011-04-01

    Full Text Available The morphology and anatomy of generative organs of Salsola kali ssp. ruthenica was examined in detail using the light (LM and scanning electron microscopy (SEM. The whole flowers, fruits and their parts (pistil, stamens, sepals, embryo, seed were observed in different developmental stages. In the first stage (June, flower buds were closed. In the second stage (August, flowers were ready for pollination/fertilization. In the third stage (September, fruits were mature. Additionally, the anatomical and morphological structure of sepals was observed by means of LM and SEM. Thanks to the transverse and longitudinal semi-sections through sepals, the first phase of wing formation was recorded by SEM. The appearance of stomata in the epidermal cells of sepals above the forming wings was very interesting, too. The stomata were observed also in mature fruits.

  16. Different myrosinase and idioblast distribution in Arabidopsis and Brassica napus

    DEFF Research Database (Denmark)

    Andreasson, Erik; Jørgensen, Lise Bolt; Höglund, Anna-Stina;

    2001-01-01

    Arabidopsis, Brassica napus, Myrosinase, Myrosinase Binding Protein, Glucosinolates, Myrosin Cell, Immunocytochemistry......Arabidopsis, Brassica napus, Myrosinase, Myrosinase Binding Protein, Glucosinolates, Myrosin Cell, Immunocytochemistry...

  17. Whole genome sequence of Treponema pallidum ssp. pallidum, strain Mexico A, suggests recombination between yaws and syphilis strains.

    Directory of Open Access Journals (Sweden)

    Helena Pětrošová

    Full Text Available BACKGROUND: Treponema pallidum ssp. pallidum (TPA, the causative agent of syphilis, and Treponema pallidum ssp. pertenue (TPE, the causative agent of yaws, are closely related spirochetes causing diseases with distinct clinical manifestations. The TPA Mexico A strain was isolated in 1953 from male, with primary syphilis, living in Mexico. Attempts to cultivate TPA Mexico A strain under in vitro conditions have revealed lower growth potential compared to other tested TPA strains. METHODOLOGY/PRINCIPAL FINDINGS: The complete genome sequence of the TPA Mexico A strain was determined using the Illumina sequencing technique. The genome sequence assembly was verified using the whole genome fingerprinting technique and the final sequence was annotated. The genome size of the Mexico A strain was determined to be 1,140,038 bp with 1,035 predicted ORFs. The Mexico A genome sequence was compared to the whole genome sequences of three TPA (Nichols, SS14 and Chicago and three TPE (CDC-2, Samoa D and Gauthier strains. No large rearrangements in the Mexico A genome were found and the identified nucleotide changes occurred most frequently in genes encoding putative virulence factors. Nevertheless, the genome of the Mexico A strain, revealed two genes (TPAMA_0326 (tp92 and TPAMA_0488 (mcp2-1 which combine TPA- and TPE- specific nucleotide sequences. Both genes were found to be under positive selection within TPA strains and also between TPA and TPE strains. CONCLUSIONS/SIGNIFICANCE: The observed mosaic character of the TPAMA_0326 and TPAMA_0488 loci is likely a result of inter-strain recombination between TPA and TPE strains during simultaneous infection of a single host suggesting horizontal gene transfer between treponemal subspecies.

  18. Differences between the rhizosphere microbiome of Beta vulgaris ssp. maritima - ancestor of all beet crops - and modern sugar beets

    Directory of Open Access Journals (Sweden)

    Christin eZachow

    2014-08-01

    Full Text Available The structure and function of the plant microbiome is driven by plant species and prevailing environmental conditions. Effectuated by breeding efforts, modern crops diverge genetically and phenotypically from their wild relatives but little is known about consequences for the associated microbiota. Therefore, we studied bacterial rhizosphere communities associated with the wild beet B. vulgaris ssp. maritima grown in their natural habitat soil from coastal drift lines (CS and modern sugar beets (Beta vulgaris ssp. vulgaris cultivated in CS and potting soil (PS under greenhouse conditions. Analysis of 16S rRNA gene fingerprints and pyrosequencing-based amplicon libraries revealed plant genotype- and soil-specific microbiomes. Wild beet plants harbor distinct operational taxonomic units (OTUs and a more diverse bacterial community than the domesticated sugar beet plants. Although the rhizospheres of both plant genotypes were dominated by Proteobacteria and Planctomycetes, 47.4% of dominant OTUs were additionally detected in the wild beet rhizosphere. Analysis of the cultivable fraction confirmed these plant genotype-specific differences at functional level. The proportion of isolates displayed in vitro activity against phytopathogens was lower for wild beet (≤45.8% than for sugar beet (≤57.5%. Conversely, active isolates from the wild beet exhibited stronger ability to cope with abiotic stresses. From all samples, active isolates of Stenotrophomonas rhizophila were frequently identified. In addition, soil type-specific impacts on the composition of bacterial communities were found: Acidobacteria, Chloroflexi, and Planctomycetes were only detected in plants cultivated in CS; whereas Bacteroidetes and Proteobacteria dominated in PS. Overall, in comparison to modern sugar beets, wild beets were associated with taxonomically and functionally distinct microbiomes.

  19. Whole Genome Sequence of Treponema pallidum ssp. pallidum, Strain Mexico A, Suggests Recombination between Yaws and Syphilis Strains

    Science.gov (United States)

    Pětrošová, Helena; Zobaníková, Marie; Čejková, Darina; Mikalová, Lenka; Pospíšilová, Petra; Strouhal, Michal; Chen, Lei; Qin, Xiang; Muzny, Donna M.; Weinstock, George M.; Šmajs, David

    2012-01-01

    Background Treponema pallidum ssp. pallidum (TPA), the causative agent of syphilis, and Treponema pallidum ssp. pertenue (TPE), the causative agent of yaws, are closely related spirochetes causing diseases with distinct clinical manifestations. The TPA Mexico A strain was isolated in 1953 from male, with primary syphilis, living in Mexico. Attempts to cultivate TPA Mexico A strain under in vitro conditions have revealed lower growth potential compared to other tested TPA strains. Methodology/Principal Findings The complete genome sequence of the TPA Mexico A strain was determined using the Illumina sequencing technique. The genome sequence assembly was verified using the whole genome fingerprinting technique and the final sequence was annotated. The genome size of the Mexico A strain was determined to be 1,140,038 bp with 1,035 predicted ORFs. The Mexico A genome sequence was compared to the whole genome sequences of three TPA (Nichols, SS14 and Chicago) and three TPE (CDC-2, Samoa D and Gauthier) strains. No large rearrangements in the Mexico A genome were found and the identified nucleotide changes occurred most frequently in genes encoding putative virulence factors. Nevertheless, the genome of the Mexico A strain, revealed two genes (TPAMA_0326 (tp92) and TPAMA_0488 (mcp2-1)) which combine TPA- and TPE- specific nucleotide sequences. Both genes were found to be under positive selection within TPA strains and also between TPA and TPE strains. Conclusions/Significance The observed mosaic character of the TPAMA_0326 and TPAMA_0488 loci is likely a result of inter-strain recombination between TPA and TPE strains during simultaneous infection of a single host suggesting horizontal gene transfer between treponemal subspecies. PMID:23029591

  20. Arabidopsis: An Adequate Model for Dicot Root Systems?

    OpenAIRE

    Zobel, Richard W.

    2016-01-01

    The Arabidopsis root system is frequently considered to have only three classes of root: primary, lateral, and adventitious. Research with other plant species has suggested up to eight different developmental/functional classes of root for a given plant root system. If Arabidopsis has only three classes of root, it may not be an adequate model for eudicot plant root systems. Recent research, however, can be interpreted to suggest that pre-flowering Arabidopsis does have at least five (5) of t...

  1. Physiological and molecular basis of Azospirillum-Arabidopsis Interaction

    OpenAIRE

    Nazeer, Ahmed

    2012-01-01

    The present study was aimed at revealing the early signalling events during the interaction of the diazotrophic soil bacterium Azospirillum brasilense with its host plant Arabidopsis thaliana. Furthermore, taking advantage of the micro array technique, a comprehensive overview of Arabidopsis genes has been undertaken which are affected upon association with A. brasilense The characterization of the early responses of Arabidopsis plants upon inoculation with Azospirillum brasilense strain Sp7 ...

  2. Root gravitropism in maize and Arabidopsis

    Science.gov (United States)

    Evans, Michael L.

    1993-01-01

    Research during the period 1 March 1992 to 30 November 1993 focused on improvements in a video digitizer system designed to automate the recording of surface extension in plants responding to gravistimulation. The improvements included modification of software to allow detailed analysis of localized extension patterns in roots of Arabidopsis. We used the system to analyze the role of the postmitotic isodiametric growth zone (a region between the meristem and the elongation zone) in the response of maize roots to auxin, calcium, touch and gravity. We also used the system to analyze short-term auxin and gravitropic responses in mutants of Arabidopsis with reduced auxin sensitivity. In a related project, we studied the relationship between growth rate and surface electrical currents in roots by examining the effects of gravity and thigmostimulation on surface potentials in maize roots.

  3. Arabidopsis CDS blastp result: AK100975 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK100975 J023143J04 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  4. Arabidopsis CDS blastp result: AK240654 [KOME

    Lifescience Database Archive (English)

    Full Text Available (PLDALPHA1) (PLD1) / choline phosphatase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha... 1) (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK240654 J023098I11 At3g15730.1 68416.m01993 phospholipase D alpha 1 / PLD alpha 1

  5. Arabidopsis CDS blastp result: AK065102 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK065102 J013001N03 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  6. Arabidopsis CDS blastp result: AK119523 [KOME

    Lifescience Database Archive (English)

    Full Text Available osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...AK119523 001-202-E03 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  7. Arabidopsis CDS blastp result: AK066556 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 4e-63 ... ...AK066556 J013073D11 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  8. Arabidopsis CDS blastp result: AK072121 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK072121 J013122J23 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  9. Arabidopsis CDS blastp result: AK119861 [KOME

    Lifescience Database Archive (English)

    Full Text Available osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...AK119861 002-178-H08 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  10. Arabidopsis CDS blastp result: AK121264 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK121264 J023105D06 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  11. Arabidopsis CDS blastp result: AK243041 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243041 J100008G07 At3g11410.1 68416.m01392 protein phosphatase 2C, putative / PP2C, putative identic...osphatase 2C; identical to cDNA protein phosphatase 2C GI:633027 2e-21 ... ...al to protein phosphatase 2C (PP2C) GB:P49598 [Arabidopsis thaliana]; contains Pfam profile PF00481: Protein ph

  12. Arabidopsis CDS blastp result: AK100278 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK100278 J023073L15 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  13. Arabidopsis CDS blastp result: AK120459 [KOME

    Lifescience Database Archive (English)

    Full Text Available ase 1 identical to SP:Q38882 Phospholipase D alpha 1 (EC 3.1.4.4) (AtPLDalpha1) (PLD alpha 1) (Choline ph...osphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1) (PLDalpha) [Arabidopsis thaliana] 0.0 ... ...AK120459 J013106C05 At3g15730.1 phospholipase D alpha 1 / PLD alpha 1 (PLDALPHA1) (PLD1) / choline phosphat

  14. Arabidopsis CDS blastp result: AK064381 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK064381 002-108-E01 At1g55350.4 calpain-type cysteine protease family identical to calpain...-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain famil...y cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 0.0 ...

  15. Flavonoid-specific staining of Arabidopsis thaliana.

    Science.gov (United States)

    Sheahan, J J; Rechnitz, G A

    1992-12-01

    Crop yields may be threatened by increases in UV-B radiation resulting from depletion of the ozone layer. In higher plants, the presence of flavonols provides a protective mechanism, and we report a novel staining procedure for the visualization of such protectants in plant tissue. It is shown that the proposed technique provides sensitive and specific fluorescence of flavonoids in chlorophyll-bleached tissue of Arabidopsis thaliana. PMID:1282347

  16. Unraveling the circadian clock in Arabidopsis

    OpenAIRE

    Wang, Xiaoxue; Ma, Ligeng

    2012-01-01

    The circadian clock is an endogenous timing system responsible for coordinating an organism’s biological processes with its environment. Interlocked transcriptional feedback loops constitute the fundamental architecture of the circadian clock. In Arabidopsis, three feedback loops, the core loop, morning loop and evening loop, comprise a network that is the basis of the circadian clock. The components of these three loops are regulated in distinct ways, including transcriptional, post-transcri...

  17. Ecology and Evolutionary Biology of Arabidopsis

    OpenAIRE

    Pigliucci, Massimo

    2002-01-01

    Arabidopsis thaliana is now widely used as a model system in molecular and developmental biology, as well as in physiology and cell biology. However, ecologists and evolutionary biologists have turned their attention to the mouse ear cress only much more recently and almost reluctantly. The reason for this is the perception that A. thaliana is not particularly interesting ecologically and that it represents an oddity from an evolutionary standpoint. While there is some truth in both these att...

  18. Fluorescence-Activated Nucleolus Sorting in Arabidopsis.

    Science.gov (United States)

    Pontvianne, Frédéric; Boyer-Clavel, Myriam; Sáez-Vásquez, Julio

    2016-01-01

    Nucleolar isolation allows exhaustive characterization of the nucleolar content. Centrifugation-based protocols are not adapted to isolation of nucleoli directly from a plant tissue because of copurification of cellular debris. We describe here a method that allows the purification of nucleoli using fluorescent-activated cell sorting from Arabidopsis thaliana leaves. This approach requires the expression of a specific nucleolar protein such as fibrillarin fused to green fluorescent protein in planta. PMID:27576720

  19. Arabidopsis CDS blastp result: AK071200 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK071200 J023086K07 At1g64200.1 vacuolar ATP synthase ... subunit E , putative ... / V-ATPase ... E ... subunit, ... putative ... / vacuolar proton pump E ... subunit, putative ... similar ... to SP|Q39258 Vacuolar ATP synthase ... subunit E ... (E C 3.6.3.14) (V-ATPase ... E ... subunit) (Vacu ... olar proton pump E ... subunit) {Arabidopsis thaliana}; contains Pfam pro ... file ... PF01991: ATP synthase ... (E /31 kDa) subunit 1e -86 ...

  20. Arabidopsis CDS blastp result: AK100850 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK100850 J023123I11 At4g11150.1 vacuolar ATP synthase ... subunit E ... / V-ATPase ... E ... subunit / vacuolar ... proton pump E ... subunit (VATE ) ide ntical to SP|Q39258 Vacuolar ATP ... synthase ... subunit E ... (E C 3.6.3.14) (V-ATPase ... E ... subunit) (Vacu ... olar proton pump E ... subunit) {Arabidopsis thaliana} 2e -79 ...

  1. Arabidopsis CDS blastp result: AK072778 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK072778 J023139P14 At4g11150.1 vacuolar ATP synthase ... subunit E ... / V-ATPase ... E ... subunit / vacuolar ... proton pump E ... subunit (VATE ) ide ntical to SP|Q39258 Vacuolar ATP ... synthase ... subunit E ... (E C 3.6.3.14) (V-ATPase ... E ... subunit) (Vacu ... olar proton pump E ... subunit) {Arabidopsis thaliana} 1e -72 ...

  2. Arabidopsis CDS blastp result: AK241580 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241580 J065181H03 At4g23640.1 68417.m03404 potassium transporter / tiny root hair ... 1 protein (T ... RH1) identical to tiny root hair ... 1 protein [Arabidopsis thaliana] gi|11181958|emb|C ... MID:11500563; identical to cDNA mRNA for tiny root hair ... 1 protein (trh1) GI:11181957 1e-139 ...

  3. Arabidopsis CDS blastp result: AK110331 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK110331 002-164-D12 At2g31510.1 IBR domain-containing protein / ARIADNE-like prote...in ARI7 (ARI7) identical to ARIADNE-like protein ARI7 [Arabidopsis thaliana] GI:29125028; contains similarit...y to Swiss-Prot:Q94981 ariadne-1 protein (Ari-1) [Drosophila melanogaster]; contains Pfam profile PF01485: IBR domain 3e-59 ...

  4. Arabidopsis CDS blastp result: AK242789 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242789 J090057B20 At2g31510.1 68415.m03850 IBR domain-containing protein / ARIADN...E-like protein ARI7 (ARI7) identical to ARIADNE-like protein ARI7 [Arabidopsis thaliana] GI:29125028; contai...ns similarity to Swiss-Prot:Q94981 ariadne-1 protein (Ari-1) [Drosophila melanogaster]; contains Pfam profile PF01485: IBR domain 8e-12 ...

  5. Arabidopsis CDS blastp result: AK065950 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065950 J013049M07 At3g11820.1 syntaxin 121 (SYP121) / syntaxin-related protein (SYR1) conta...ins Pfam profiles: PF00804 syntaxin and PF05739: SNARE domain; identical to cDNA syntaxin-related ...protein At-SYR1 (At-Syr1) GI:4206788, SP|Q9ZSD4 Syntaxin 121 (AtSYP121) (Syntaxin-related protein At-Syr1) {Arabidopsis thaliana} 5e-88 ...

  6. A Superfamily of Arabidopsis Thaliana Retrotransposons

    OpenAIRE

    Konieczny, A; Voytas, D. F.; Cummings, M. P.; Ausubel, F M

    1991-01-01

    We describe a superfamily of Arabidopsis thaliana retrotransposable elements that consists of at least ten related families designated Ta1-Ta10. The Ta1 family has been described previously. Two genomic clones representing the Ta2 and Ta3 elements were isolated from an A. thaliana (race Landsberg erecta) λ library using sequences derived from the reverse transcriptase region of Ta1 as hybridization probes. Nucleotide sequence analysis showed that the Ta1, Ta2 and Ta3 families share >75% amino...

  7. Arabidopsis CDS blastp result: AK243366 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK243366 J100062A03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-33 ...

  8. Arabidopsis CDS blastp result: AK241693 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241693 J065195J20 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-31 ...

  9. Arabidopsis CDS blastp result: AK240979 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240979 J065049G14 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-40 ...

  10. Arabidopsis CDS blastp result: AK242723 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242723 J090045G15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 7e-31 ...

  11. Arabidopsis CDS blastp result: AK241693 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241693 J065195J20 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-15 ...

  12. Arabidopsis CDS blastp result: AK289251 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK289251 J100081E23 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 9e-17 ...

  13. Arabidopsis CDS blastp result: AK318555 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK318555 J075159J07 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 8e-83 ...

  14. Arabidopsis CDS blastp result: AK288980 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288980 J090085N06 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-67 ...

  15. Arabidopsis CDS blastp result: AK288612 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288612 J090053J15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-34 ...

  16. Arabidopsis CDS blastp result: AK241656 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241656 J065191E22 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-44 ...

  17. Arabidopsis CDS blastp result: AK288115 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288115 J080036I11 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-15 ...

  18. Arabidopsis CDS blastp result: AK242521 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242521 J080313L24 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-27 ...

  19. Arabidopsis CDS blastp result: AK241784 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241784 J065206N09 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-16 ...

  20. Arabidopsis CDS blastp result: AK240965 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240965 J065046D15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-30 ...

  1. Arabidopsis CDS blastp result: AK243366 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK243366 J100062A03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-16 ...

  2. Arabidopsis CDS blastp result: AK288938 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288938 J090082P07 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-38 ...

  3. Arabidopsis CDS blastp result: AK242649 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242649 J090025M16 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-12 ...

  4. Arabidopsis CDS blastp result: AK287434 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK287434 J043012F24 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 4e-38 ...

  5. Arabidopsis CDS blastp result: AK240855 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240855 J065021H02 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-16 ...

  6. Arabidopsis CDS blastp result: AK241009 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241009 J065053H11 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-105 ...

  7. Arabidopsis CDS blastp result: AK243366 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK243366 J100062A03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 8e-45 ...

  8. Arabidopsis CDS blastp result: AK241102 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241102 J065078J20 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-13 ...

  9. Arabidopsis CDS blastp result: AK242649 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242649 J090025M16 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-20 ...

  10. Arabidopsis CDS blastp result: AK288338 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288338 J090023E14 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-26 ...

  11. Arabidopsis CDS blastp result: AK240965 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK240965 J065046D15 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-49 ...

  12. Arabidopsis CDS blastp result: AK288738 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288738 J090063N09 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-50 ...

  13. Arabidopsis CDS blastp result: AK288591 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK288591 J090050M07 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 9e-46 ...

  14. Arabidopsis CDS blastp result: AK242863 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242863 J090074J03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-15 ...

  15. Arabidopsis CDS blastp result: AK241944 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241944 J075089B01 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 8e-26 ...

  16. Arabidopsis CDS blastp result: AK287467 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK287467 J043021K18 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 1e-60 ...

  17. Arabidopsis CDS blastp result: AK242863 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242863 J090074J03 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 5e-31 ...

  18. Arabidopsis CDS blastp result: AK241009 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK241009 J065053H11 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 2e-53 ...

  19. Arabidopsis CDS blastp result: AK287735 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK287735 J065141O09 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 8e-64 ...

  20. Arabidopsis CDS blastp result: AK242649 [KOME

    Lifescience Database Archive (English)

    Full Text Available cal over 405 amino acids to DYW7 protein of unknown function GB:CAA06829 from [Arabidopsis thaliana] (Plant...AK242649 J090025M16 At1g19720.1 68414.m02463 pentatricopeptide (PPR) repeat-containing protein nearly identi... Mol. Biol. 42 (4), 603-613 (2000)); contains Pfam profile PF01535: PPR repeat 3e-55 ...