WorldWideScience

Sample records for ar isotopic chain

  1. Constraints on the evolution of the Japan Sea based on 40Ar-39Ar ages and Sr isotopic ratios for volcanic rocks of the Yamato Seamount chain in the Japan Sea

    International Nuclear Information System (INIS)

    40Ar-39Ar and Sr isotope analyses were performed on basalts and andesites dredged from the Yamato Seamount chain in the Japan Sea. The 40Ar-39Ar plateau ages range from about 11 to 17 Ma, though most samples show ages between 10 and 14 Ma. The seamounts seem to have formed within a period of a few million years, although some of them might have formed earlier. Based on the present results together with previously reported radiometric age data, it is thought that the Yamato Basin formed during some period prior to 17 Ma and probably later than around 25 Ma. Taking into account the radiometric age data on rocks from the Japan Basin, it is conjectured that the opening of the Japan Sea might have started almost at this time or a little earlier. The observed 87Sr/86Sr ratios range from 0.70357 to 0.70388, suggesting incorporation of some time-integrated components enriched in incompatible elements such as continental crustal materials. This may indicate that in the Japan Sea area, at least the Yamato Basin had not developed enough to show the characteristics of typical N-type MORB source materials without being affected by pre-existing continental crustal materials. (orig.)

  2. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Science.gov (United States)

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  3. Ar-Ar Isotopic age of lamproite dikes of the Chuisky complex, Gorny Altai

    International Nuclear Information System (INIS)

    The age of lamproite dikes of the Chuisky complex of the Gorny Altai was identified by the method of Ar-Ar isotope dating. The previously established Early-Middle Triassic age (236.5 ± 3.8 mln. years) of the dikes permits relating their formation and activities of the superplume, which dictated the development of the Permian-Triassic magmatism within vast territories in the Northern and Central Asia

  4. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Science.gov (United States)

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  5. Leading chiral three-nucleon forces along isotope chains in the calcium region

    CERN Document Server

    Somà, V; Barbieri, C; Navrátil, P; Duguet, T

    2013-01-01

    Three-nucleon forces (3NFs), and in particular terms of the Fujita-Miyazawa type, strongly influence the structure of neutron-rich exotic isotopes. Ab-initio calculations have shown that chiral two- and three-nucleon interactions correctly reproduce binding energy systematics and neutron driplines of oxygen and nearby isotopes. Exploiting the novel self-consistent Gorkov-Green's function approach, we present the first investigation of Ar, K, Ca, Sc and Ti isotopic chains. Leading chiral 3N interactions are mandatory to reproduce the trend of binding energies throughout these chains and to obtain a good description of two-neutron separation energies. At the same time, nuclei in this mass region are systematically overbound by about 40 MeV and the $N=20$ magic gap is significantly overestimated. We conclude that ab-initio many-body calculations of mid-mass isotopic chains challenge modern theories of elementary nuclear interactions.

  6. A re-examination of petrogenesis and 40Ar/39Ar systematics in the Chain of Ponds K-feldspar: "diffusion domain" archetype versus polyphase hygrochronology

    Science.gov (United States)

    Chafe, Alex N.; Villa, Igor M.; Hanchar, John M.; Wirth, Richard

    2014-05-01

    K-feldspar (Kfs) from the Chain of Ponds Pluton (CPP) is the archetypal reference material, upon which thermochronological modeling of Ar diffusion in discrete "domains" was founded. We re-examine the CPP Kfs using cathodoluminescence and back-scattered electron imaging, transmission electron microscopy, and electron probe microanalysis. 40Ar/39Ar stepwise heating experiments on different sieve fractions, and on handpicked and unpicked aliquots, are compared. Our results reproduce the staircase-shaped age spectrum and the Arrhenius trajectory of the literature sample, confirming that samples collected from the same locality have an identical Ar isotope record. Even the most pristine-looking Kfs from the CPP contains successive generations of secondary, metasomatic/retrograde mineral replacements that post-date magmatic crystallization. These chemically and chronologically distinct phases are responsible for its staircase-shaped age spectra, which are modified by handpicking. While genuine within-grain diffusion gradients are not ruled out by these data, this study demonstrates that the most important control on staircase-shaped age spectra is the simultaneous presence of heterochemical, diachronous post-magmatic mineral growth. At least five distinct mineral species were identified in the Kfs separate, three of which can be traced to external fluids interacting with the CPP in a chemically open system. Sieve fractions have size-shifted Arrhenius trajectories, negating the existence of the smallest "diffusion domains." Heterochemical phases also play an important role in producing nonlinear trajectories. In vacuo degassing rates recovered from Arrhenius plots are neither related to true Fick's Law diffusion nor to the staircase shape of the age spectra. The CPP Kfs used to define the "diffusion domain" model demonstrates the predominance of metasomatic alteration by hydrothermal fluids and recrystallization in establishing the natural Ar distribution among different

  7. Earth-atmosphere evolution based on new determination of Devonian atmosphere Ar isotopic composition

    Science.gov (United States)

    Stuart, Finlay M.; Mark, Darren F.; Gandanger, Pierre; McConville, Paul

    2016-07-01

    The isotopic composition of the noble gases, in particular Ar, in samples of ancient atmosphere trapped in rocks and minerals provides the strongest constraints on the timing and rate of Earth atmosphere formation by degassing of the Earth's interior. We have re-measured the isotopic composition of argon in the Rhynie chert from northeast Scotland using a high precision mass spectrometer in an effort to provide constraints on the composition of Devonian atmosphere. Irradiated chert samples yield 40Ar/36Ar ratios that are often below the modern atmosphere value. The data define a 40Ar/36Ar value of 289.5 ± 0.4 at K/36Ar = 0. Similarly low 40Ar/36Ar are measured in un-irradiated chert samples. The simplest explanation for the low 40Ar/36Ar is the preservation of Devonian atmosphere-derived Ar in the chert, with the intercept value in 40Ar-39Ar-36Ar space representing an upper limit. In this case the Earth's atmosphere has accumulated only 3% (5.1 ± 0.4 ×1016 mol) of the total 40Ar inventory since the Devonian. The average accumulation rate of 1.27 ± 0.09 ×108 mol40Ar/yr overlaps the rate over the last 800 kyr. This implies that there has been no resolvable temporal change in the outgassing rate of the Earth since the mid-Palaeozoic despite the likely episodicity of Ar degassing from the continental crust. Incorporating the new Devonian atmosphere 40Ar/36Ar into the Earth degassing model of Pujol et al. (2013) provides the most precise constraints on atmosphere formation so far. The atmosphere formed in the first ∼100 Ma after initial accretion during a catastrophic degassing episode. A significant volume of 40Ar did not start to accumulate in the atmosphere until after 4 Ga which implies that stable K-rich continental crust did not develop until this time.

  8. Combined oxygen, hydrogen, /sup 40/Ar//sup 39/Ar isotopic evaluation of molybdenite mineralization, east Pioneer Mountains, Montana

    Energy Technology Data Exchange (ETDEWEB)

    Chesley, J.T.; Snee, L.W.; O' Neil, J.R.

    1985-01-01

    The Pear Lake molybdenite (moly) prospect is in the Eastern Pioneer Wilderness Area, 30 km south of the Cannivan Gulch moly deposit. It lies on a NW-SE trend with other prospects that are contemporaneous. Mineralized veins outcrop sporadically over a 4 square mile area, with a major concentration in the center of the study area. Previous studies have suggested potential moly-mineralization at depth. /sup 40/Ar//sup 39/Ar age-spectra on hornblend (hb) from the granodiorite host rock indicate emplacement at 75.0 +/- 1 Ma, with biotite closure at 69.0 +/- .3 Ma, in the vicinity of Pear Lake. Hydrothermal muscovites from the moly-bearing veins have ages of 68.0 +/- .5 Ma. partial resetting of biotite cooling dates in the vicinity of mineralization are observed, but biotites on the outer portion of the mineralizing system are undisturbed. These relations suggest that mineralization occurred after the host pluton had cooled to below 280/sup 0/C. Quartz-magnetite isotopic temperatures are 380 to 420/sup 0/C for moly-veins. These data suggest that magmatic hydrothermal fluids operated in the upper portion of this molysystem. These isotopic data, combined with geologic mapping, suggest that the Pear Lake moly prospect resulted from a weak, short-lived magmatic hydrothermal event at depth, and is unlikely to contain economic levels of molybdenum. The combined /sup 40/Ar//sup 39/Ar-stable isotope approach should prove useful in evaluating other hydrothermal systems.

  9. Molecular modeling of the effects of 40Ar recoil in illite particles on their K-Ar isotope dating

    Science.gov (United States)

    Szczerba, Marek; Derkowski, Arkadiusz; Kalinichev, Andrey G.; Środoń, Jan

    2015-06-01

    The radioactive decay of 40K to 40Ar is the basis of isotope age determination of micaceous clay minerals formed during diagenesis. The difference in K-Ar ages between fine and coarse grained illite particles has been interpreted using detrital-authigenic components system, its crystallization history or post-crystallization diffusion. Yet another mechanism should also be considered: natural 40Ar recoil. Whether this recoil mechanism can result in a significant enough loss of 40Ar to provide observable decrease of K-Ar age of the finest illite crystallites at diagenetic temperatures - is the primary objective of this study which is based on molecular dynamics (MD) computer simulations. All the simulations were performed for the same kinetic energy (initial velocity) of the 40Ar atom, but for varying recoil angles that cover the entire range of their possible values. The results show that 40Ar recoil can lead to various deformations of the illite structure, often accompanied by the displacement of OH groups or breaking of the Si-O bonds. Depending on the recoil angle, there are four possible final positions of the 40Ar atom with respect to the 2:1 layer at the end of the simulation: it can remain in the interlayer space or end up in the closest tetrahedral, octahedral or the opposite tetrahedral sheet. No simulation angles were found for which the 40Ar atom after recoil passes completely through the 2:1 layer. The energy barrier for 40Ar passing through the hexagonal cavity from the tetrahedral sheet into the interlayer was calculated to be 17 kcal/mol. This reaction is strongly exothermic, therefore there is almost no possibility for 40Ar to remain in the tetrahedral sheet of the 2:1 layer over geological time periods. It will either leave the crystal, if close enough to the edge, or return to the interlayer space. On the other hand, if 40Ar ends up in the octahedral sheet after recoil, a substantially higher energy barrier of 55 kcal/mol prevents it from leaving

  10. Neutron-Proton Asymmetry Dependence of Spectroscopic Factors in Ar Isotopes

    International Nuclear Information System (INIS)

    Spectroscopic factors have been extracted for proton-rich 34Ar and neutron-rich 46Ar using the (p, d) neutron transfer reaction. The experimental results show little reduction of the ground state neutron spectroscopic factor of the proton-rich nucleus 34Ar compared to that of 46Ar. The results suggest that correlations, which generally reduce such spectroscopic factors, do not depend strongly on the neutron-proton asymmetry of the nucleus in this isotopic region as was reported in knockout reactions. The present results are consistent with results from systematic studies of transfer reactions but inconsistent with the trends observed in knockout reaction measurements.

  11. Hydrothermal fluids, argon isotopes and mineralization ages of the Fankou Pb-Zn deposit in south China: Insights from sphalerite 40Ar/39Ar progressive crushing

    Science.gov (United States)

    Jiang, Ying-De; Qiu, Hua-Ning; Xu, Yi-Gang

    2012-05-01

    Hydrothermal fluid geochemistry and mineralization timing are two important factors in the genesis of a hydrothermal deposit. 40Ar/39Ar analyses of fluid inclusions not only provide time constraints for the mineralization but also help to clarify the K-Ca-Cl-Ar characteristics for the ore-forming fluids. In this study, six sphalerite samples collected from the Fankou lead-zinc sulfide deposit are investigated by 40Ar/39Ar in vacuo crushing. Gases liberated from the early and late crushing steps exhibit distinct Ar isotopic compositions and 40Ar/39Ar apparent ages. Argon released in the early steps has much higher 40Ar and 38ArCl and lower 37ArCa contents than those in the late steps. The significant excess Ar (40ArE) extracted in the early crushing steps shows a strong correlation with 38ArCl with very high 40ArE/38ArCl ratios. In contrast, those of the late steps mainly consist of atmospheric Ar and K-correlated radiogenic Ar with a constant 40ArR/39ArK ratio and the atmospheric initial 40Ar/36Ar ratio. As a result, all samples yield similar declining age spectra: the fore segments with anomalously old apparent ages decline quickly in the early crushing steps and the rear ones are flat with concordant apparent ages in the late crushing steps. The data points of the early steps define linear correlations in plots of 40ArNA/39ArK vs. 38ArCl/39ArK and 38ArCl/40ArNA vs. 39ArK/40ArNA (NA for non-atmospheric) and most yield ages of 240-230 Ma. On the other hand, the data of the late steps always construct well-defined isochrons in the plots of 36ArA/40ArNA vs. 39ArK/40ArNA with consistent ages of ˜300 Ma. We interpret that gases released in the early steps were from the secondary fluid inclusions (SFIs) due to their distribution characteristics along cracks leading to be easily extracted, and those released in the later steps represented the contribution of the primary fluid inclusions (PFIs). The initial 40Ar/36Ar ratios of SFIs, much higher than the modern

  12. Constraining the alteration history of a Late Cretaceous Patagonian volcaniclastic bentonite-ash-mudstone sequence using K-Ar and 40Ar/39Ar isotopes

    Science.gov (United States)

    Warr, L. N.; Hofmann, H.; van der Pluijm, B. A.

    2016-03-01

    Smectite is typically considered unsuitable for radiometric dating, as argon (40Ar) produced from decay of exchangeable potassium (40K) located in the interlayer sites can be lost during fluid-rock interaction and/or during wet sample preparation in the laboratory. However, age analysis of Late Cretaceous Argentinian bentonites and associated volcaniclastic rocks from Lago Pellegrini, Northern Patagonia, indicates that, in the case of these very low-permeability rocks, the radioactive 40Ar was retained and thus can provide information on smectite age and the timing of rock alteration. This study presents isotopic results that indicate the ash-to-bentonite conversion and alteration of the overlying tuffaceous mudstones in Northern Patagonia was complete ~13-17 my after middle Campanian sedimentation when the system isotopically closed. The general absence of illite in these smectite-rich lithologies reflects the low activity of K and the low temperature (<60 °C) of the formation waters that altered the parent ash.

  13. Carbon isotope stratigraphy, magnetostratigraphy, and 40Ar/39Ar age of the Cretaceous South Atlantic coast, Namibe Basin, Angola

    Science.gov (United States)

    Strganac, Christopher; Salminen, Johanna; Jacobs, Louis L.; Polcyn, Michael J.; Ferguson, Kurt M.; Mateus, Octávio; Schulp, Anne S.; Morais, Maria Luísa; Tavares, Tatiana da Silva; Gonçalves, António Olímpio

    2014-11-01

    We present the δ13C and paleomagnetic stratigraphy for marine strata at the coast of southern Angola, anchored by an intercalated basalt with a whole rock 40Ar/39Ar radiometric age of 84.6 ± 1.5 Ma, being consistent with both invertebrate and vertebrate biostratigraphy. This is the first African stable carbon isotope record correlated to significant events in the global carbon record spanning the Late Cenomanian to Early Maastrichtian. A positive ∼3‰ excursion seen in bivalve shells below the basalt indicates the Cenomanian-Turonian Boundary Event at 93.9 Ma, during Oceanic Anoxic Event 2. Additional excursions above the basalt are correlated to patterns globally, including a negative ∼3‰ excursion near the top of the section interpreted as part of the Campanian-Maastrichtian Boundary Events. The age of the basalt ties the studied Bentiaba section to a pulse of Late Cretaceous magmatic activity around the South Atlantic and significant tectonic activity, including rotation, of the African continent.

  14. Iron, copper and zinc isotopic fractionation up mammal trophic chains

    Science.gov (United States)

    Jaouen, Klervia; Pons, Marie-Laure; Balter, Vincent

    2013-07-01

    There is a growing body of evidence that some non-traditional elements exhibit stable isotope compositions that are distinct in botanical and animal products, providing potential new tracers for diet reconstructions. Here, we present data for iron (Fe), copper (Cu) and zinc (Zn) stable isotope compositions in plants and bones of herbivores and carnivores. The samples come from trophic chains located in the Western Cape area and in the Kruger National Park in South Africa. The Fe, Cu and Zn isotope systematics are similar in both parks. However, local Cu, and possibly Zn, isotopic values of soils influence that of plants and of higher trophic levels. Between plants and bones of herbivores, the Zn isotope compositions are 66Zn-enriched by about 0.8‰ whereas no significant trophic enrichment is observed for Fe and Cu. Between bones of herbivores and bones of carnivores, the Fe isotope compositions are 56Fe-depleted by about 0.6‰, the Cu isotope compositions are 65Cu-enriched by about 1.0‰, and the Zn isotope compositions are slightly 66Zn-depleted by about 0.2‰. The isotopic distributions of the metals in the body partly explain the observed trophic isotopic systematics. However, it is also necessary to invoke differential intestinal metal absorption between herbivores and carnivores to account for the observed results. Further studies are necessary to fully understand how the Fe, Cu and Zn isotope values are regulated within the ecosystem's trophic levels, but the data already suggests significant potential as new paleodietary and paleoecological proxies.

  15. He and Ar isotopes in mantle megacryst minerals from Nushan and Yingfengling in Southeast China

    Institute of Scientific and Technical Information of China (English)

    XU Shijin; FANG Zhong; T. Matsumoto; J. Matsuda; M. Yasuda; YU Jinhai; WANG Rucheng; LIU Wenzhong

    2003-01-01

    He and Ar isotopic compositions of megacrystal minerals from mantle xenoliths were measured by the technique of vacuum crushing extraction. The used samples were clinopyroxene, garnet and ilmenite in Cenozoic alkaline basalts, which were from Nushan in Anhui Province and Yingfengling in Guangdong Province, respectively, and represented materials from the upper mantle in the continental margin of SE China. The results show 3He/4He ratios of 7.99 Ra to 8.58 Ra, consistent with the characteristic ratios of the MORB-type mantle. 40Ar/39Ar ratios vary from 313 to 909, suggesting a binary mixing between the MORB-type mantle and air argons. This may reflect the incorporation of the air argon absorbed in oceanic sediments into the mantle beneath the continental margin by subduction of oceanic plate. This study presents the first report that ilmenite megacrysts contain abundant fluid inclusions and noble gases in the mantle xenoliths.

  16. Relativistic Mean Field Study of the Z = 117 Isotopic Chain

    International Nuclear Information System (INIS)

    The properties of the Z = 117 isotopic chain are studied within the framework of the axially deformed relativistic mean field theory (RMFT) in the blocked BCS approximation. The ground-state properties, such as binging energies, deformations as well as the possible α decay energies and lifetimes are calculated with the parameter set of NL-Z2 and compared with results from the finite range droplet model. The analysis by RMFT shows that the isotopes in the range of mass number A = 291 ∼ 300 exhibit higher stability, which suggests that they may be promising nuclei to be hopefully synthesized in the lab among the nuclei Z = 117. (nuclear physics)

  17. Relativistic mean field study of the Z=117 isotopic chain

    International Nuclear Information System (INIS)

    The properties of the Z=117 isotopic chain are studied within the framework of the axially deformed relativistic mean field theory (RMFT) in the blocked BCS approximation. The ground-state properties, such as binding energies, deformations as well as the possible α decay energies and lifetimes are calculated with the parameter set of NL-Z2 and compared with results from the finite range droplet model. The analysis by RMFT shows that the isotopes in the range of mass number A=291-300 exhibit higher stability, which suggests that they may be promising nuclei to be hopefully synthesized in the lab among the nuclei Z-117. (authors)

  18. Magnetic isotope effect and oxygen enrichment by 17O isotope in chain oxidation reactions. Communication 1. Theory

    International Nuclear Information System (INIS)

    The theory of magnetic isotope effect and enrichment of molecular oxygen by 17O isotope in chain oxidation reactions of organic compounds is presented. Recombination probabilities of perioxide radicals differing by isotope composition by oxygen are calculated; the magnetic isotope effect and its dependence on diffusion and viscosity coefficients are determined. Some geochemical and space-chemical consequences of the magnetic isotope effect are discussed

  19. Charge-exchange and charge-conserving reactions on Mg, Ar, Zr, and Sn isotopes

    International Nuclear Information System (INIS)

    We investigate charge-exchange reactions (CEXRs) and charge-conserving reactions (CCORs) on Mg, Ar, Zr, and Sn isotopes by comparing our theoretical results to relevant experimental data on stable nuclei. As for CEXRs, first, we discuss nuclear beta decay because it may give more convincing input data on the network calculations for successive capture reactions by protons and neutrons. Second, we address the importance of the Gamow Teller (GT) states that are low-lying excited states well known in the conventional nuclear physics while high-lying excited states still remain to be studied. The third topic, which is viable through the CCORs, is the symmetry energy associated with the equation of state of nuclear matter. By using the CCORs, we can study the isoscalar giant dipole resonance (ISGDR) and the pigmy dipole resonance (PDR). We discuss theoretical results regarding these CEXRs and CCORs on 26Mg, 40Ar, 90,92Zr, and 112∼124Sn and compare them with available experimental data. Our calculations are carried out by using the proton-neutron quasi-particle random phase approximation (pnQRPA), the QRPA, the deformed QRPA (DQRPA), the shell model and a hybrid model. Our results are shown to agree with the data available. These nuclear reactions considered in this report will complement capture reactions by protons and neutrons which are of vital importance for understanding the element abundances in the cosmos.

  20. Isochronic K-Ar age and helium isotopes of hyperbasite dike, Mossel peninsula, New Frisland (Spitsbergen)

    International Nuclear Information System (INIS)

    The age of a series of ultrabasic rocks and minerals, forming a hyperbasite dike in Mossel peninsula, Spitsbergen, was estimated by the isochronous K-Ar method using 40Ar/36Ar-40K/36Ar coordinates. The age of three peridotite samples and one olivine sample is found to be 1870±52 Ma

  1. Basic magmatism in geological history of Elbrus neovolcanic area (Greater Caucasus): evidence from K-Ar and Sr-Nd isotope data

    International Nuclear Information System (INIS)

    The results of isotope-geochronological study of two samples of basites and two samples of basic lavas of Elbrus neovolcanic area are presented. According to K-Ar dating the lavas isotope age falls in the range of 3.85-3.65 mln. years. The results of studying Sr-Nd isotope systematization of Elbrus area basic lavas suggest that the rocks studied are characterized by different isotope parameters of strontium and neodymium

  2. C-14 and Ar-39 content in a ground water aquifer in the Saarland - comparison of two ground water isotope dating methods

    International Nuclear Information System (INIS)

    For the Ar-39 groundwater ages found an age comparison is made with ground waters investigated for C-14, Kr-85 and H-3 contents. The location of investigation is a sandstone aquifer of Southern Saarland. The underground production of Ar-39 the hydrological applicability. In granite, the average concentration of U, Th, K, and Cl with an average porosity of 1% and complete diffusion of the isotopes Ar-39 and Cl-36 produced underground can be as high as 105% for Ar-39 moderated and 16% Cl-36 moderated in the interstitial water. (DG)

  3. Heterogeneous lithospheric mantle metasomatism in the eastern North China Craton: He-Ar isotopes in peridotite xenoliths from Cenozoic basalts

    Science.gov (United States)

    Tang, Huayun; Matsumoto, Takuya; Zheng, Jianping; Czuppon, György; Yu, Chunmei; Miyakawa, Chie; Ping, Xianquan

    2014-02-01

    The abundances and isotopic compositions of Helium and Argon have been analyzed in a suite of fresh spinel peridotite xenoliths in Cenozoic basalts from the eastern North China Craton (NCC) by step-wise heating experiments, to investigate the nature of noble gas reservoirs in the subcontinental lithospheric mantle beneath this region. The xenoliths include one harzburgite collected from Hebi in the interior of the NCC, two lherzolites from Hannuoba at the northern margin of the craton, and three lherzolites from Shanwang and Nushan on the eastern margin. 3He/4He ratios in most of the xenoliths are similar to those of mid-ocean ridge basalts (MORB) or slightly lower (2-10.5 Ra, where Ra is the 3He/4He ratio of the atmosphere), suggesting mixing of MORB-like and radiogenic components. One olivine separate from Nushan has a helium value of 25.3 Ra, probably suggesting cosmogenic 3He addition. The 40Ar/36Ar ratios vary from atmospheric value (296) to 1625, significantly lower than the MORB value. Available data of the peridotite xenoliths indicate the He and Ar isotopic systematics of the mantle reservoirs beneath the NCC can be interpreted as mixtures of at least three end-members including MORB-like, radiogenic and atmospheric components. We suggest that the MORB-like noble gases were derived from the underlying asthenosphere during mantle upwelling, whereas the radiogenic and recycled components probably were incorporated into the lithospheric mantle during circum-craton subduction of oceanic crust. Available data suggest that the MORB-like fluids are better preserved in the interior of the NCC, whereas the radiogenic ones are more prevalent at the margins. The Paleo-Asian ocean subduction system probably was responsible for the enriched and recycled noble gas signatures on the northern margin of the craton, while the Pacific subduction system could account for the observed He-Ar isotopic signatures beneath the eastern part. Therefore, integration of helium and

  4. Quaternary geochronology of Aragats volcanic center (Armenia) by K-Ar isotope dating

    International Nuclear Information System (INIS)

    Age of certain vulcanites of the Aragats center, according to stratigraphic data referred to different stages of its volcanic activity, was determined by the method of K-Ar-dating. It was ascertained that the Aragats volcanic center manifested continuous activity in the course of 400 thousand years in the period from 900 to 500 thousand years ago, moreover, the values of K-Ar age obtained for the Aragats lavas are divided into three groups with narrow ranges of values: 0.97-0.89, 0.74-0.68 and 0.56-0.45 mln. years

  5. α-decay chains relevant with superheavy isotopes 270-318118

    International Nuclear Information System (INIS)

    Understanding the decay modes and knowing the involved half-lives are of prime importance to identify the decay chains of superheavy elements, which are the experimental signature of the formation of the elements in fusion reactions. In the present study α-decay half-lives are found out using coulomb and proximity potential model and spontaneous fission half-life are found out using the formula of Ren et al. The range of isotopes in which α-decay shall occur are found out by making use of the difference in α-decay half-life and the fission decay half- life as criterion. It is done in the case of 275 even-even isotopes of the isotopic chains from 270-318118 to 230-27898

  6. Plio-Pleistocene basanitic and melilititic series of the Bohemian Massif: K-Ar ages, major/trace element and Sr–Nd isotopic data

    Czech Academy of Sciences Publication Activity Database

    Ulrych, Jaromír; Ackerman, Lukáš; Balogh, K.; Hegner, E.; Jelínek, E.; Pécskay, Z.; Přichystal, A.; Upton, B. G. J.; Zimák, J.; Foltýnová, R.

    2013-01-01

    Roč. 73, č. 4 (2013), s. 429-450. ISSN 0009-2819 Institutional support: RVO:67985831 Keywords : Bohemian Massif * Plio-Pleistocene * Basanite * Melilitite * K-Ar age * Magmatism * Sr–Nd isotopes Subject RIV: DD - Geochemistry Impact factor: 1.397, year: 2013

  7. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  8. Tracking the provenance of Greenland-sourced, Holocene aged, individual sand-sized ice-rafted debris using the Pb-isotope compositions of feldspars and 40Ar/39Ar ages of hornblendes

    Science.gov (United States)

    White, Lee F.; Bailey, Ian; Foster, Gavin L.; Allen, Georgina; Kelley, Simon P.; Andrews, John T.; Hogan, Kelly; Dowdeswell, Julian A.; Storey, Craig D.

    2016-01-01

    The provenance of sand-sized ice-rafted debris (IRD) sourced from Greenland is currently difficult to determine. Such knowledge, if it could be ascertained with a high degree of certainty, could be applied to the Greenland-proximal marine records to improve both our understanding of modern-day spatial patterns of iceberg rafting and the past history of the Greenland Ice Sheet (GIS). Recent studies have highlighted the utility of the Pb-isotope composition of individual sand-sized feldspars and the 40Ar/39Ar ages of individual sand-sized hornblendes in this regard. However, before any such provenance toolkit can be applied to the palaeo-record, it is necessary first to determine whether this approach can be used to track the sources of known recent Greenland-proximal IRD deposition. To this end we present new records of the Pb-isotope composition and the 40Ar/39Ar ages of individual sand-sized grains of feldspars and hornblendes, respectively, from modern Greenland glacifluvial and fjord sands and Holocene to modern Greenland-proximal marine sediments. These new data demonstrate that sand-sized feldspars and hornblendes glacially eroded by the GIS exhibit distinct intra- and inter-tectonic terrane differences in their Pb-isotope compositions and ages and that these differences are clearly expressed in the geochemistry and geochronology of sand-sized IRD deposited in marine sediments around Greenland. Although overlap exists between some Greenland-proximal IRD 'source fields' defined by these data, our approach has the potential to both better understand spatial patterns of Greenland-derived IRD in the modern day as well as during past episodes of iceberg calving.

  9. A spectroscopic study of the cycling transition 4s[3/2]_2-4p[5/2]_3 at 811.8 nm in Ar-39: Hyperfine structure and isotope shift

    CERN Document Server

    Williams, W; Rudinger, K; Xu, C -Y; Yokochi, R; Mueller, P

    2010-01-01

    Doppler-free saturated absorption spectroscopy is performed on an enriched radioactive Ar-39 sample. The spectrum of the 3s^2 3p^5 4s [3/2]_2 - 3s^2 3p^5 4p [5/2]_3 cycling transition at 811.8 nm is recorded, and its isotope shift between Ar-39 and Ar-40 is derived. The hyperfine coupling constants A and B for both the 4s [3/2]_2 and 4p [5/2]_3 energy levels in Ar-39 are also determined. The results partially disagree with a recently published measurement of the same transition. Based on earlier measurements as well as the current work, the isotope shift and hyperfine structure of the corresponding transition in Ar-37 are also calculated. These spectroscopic data are essential for the realization of laser trapping and cooling of Ar-37 and Ar-39.

  10. An overview of noble gas (He, Ne, Ar, Xe) contents and isotope signals in terrestrial diamond

    Science.gov (United States)

    Basu, S.; Jones, A. P.; Verchovsky, A. B.; Kelley, S. P.; Stuart, F. M.

    2013-11-01

    high 21Ne/22Ne and 131,134,136Xe/132Xe ratios. In many diamonds, variations in both concentration and isotopic composition within samples from the same geographical location require complex diamond growth. For example, coated stones of Zaire trap noble gases from multiple sources and different generations of diamond growth. Thus noble gas studies have the potential to record major processes during the complex growth histories of natural diamond and also to provide valuable information about the sub-continental mantle. Noble gas signatures may be affected by diffusive losses, notably in some framesites.

  11. Petrology, isotope characteristics, and K-Ar ages of the Maranhão, northern Brazil, Mesozoic basalt province

    Science.gov (United States)

    Fodor, R.V.; Sial, A.N.; Mukasa, S.B.; McKee, E.H.

    1990-01-01

    Northern Brazil contains remnants of Mesozoic flood basalts and hypabyssal rocks that were apparently emplaced during tectonism related to opening of the Atlantic Ocean. Analyses and new K-Ar ages reveal that this ∼700x250 km Maranhão province (5°–8°S) has low-Ti basalts (∼1.1 wt% TiO2) in the western part that range about 160 to 190 Ma, and high-Ti basalts (3.4–4.4 wt% TiO2) in the eastern part about 115–122 Ma. Low-Ti basalt compositions are less evolved and have a smaller range, Mg# 62-56, than the high-Ti basalts, Mg# 44–33. General characteristics of the least evolved members of low- and high-Ti groups include, respectively, Zr 100 and 250 ppm, Sr 225 and 475 ppm, Ba 200 and 500 ppm, Nb 10 and 26 ppm, Y 29 and 36 ppm, La/Yb(n) 4.2 and 8.8, where La(n) is 30 and 90. Overall compositions resemble the low- and high-Ti basaltic rocks of the Mesozoic Serra Geral (Paraná) province in southern Brazil. The Maranhão low-Ti basalts have more radiogenic Sr and Pb and higher δ18O than the high-Ti basalts. Respectively, low- vs high-Ti: ɛSr26−54 vs 15−18; 206Pb/204Pb=18.25–.78 vs 18.22–.24; and δ18O 8.9–12.6 vs 6.5–8.6. Nd isotopes overlap: ɛNd−1.6 to −3.8 vs −2.1 to −3. Ages, compositions, and isotopes indicate that the low- and high-Ti groups had independent parentages from enriched subcontinental mantle. However, both groups can be modeled from one source composition if low-Ti basalt isotopes reflect crustal contamination, and if the parentages for each group were picritic liquids that represent either higher (for low-Ti) or lower (for high-Ti) percentages of melting of that single source. When comparing Pb isotopes of Maranhão and Serra Geral high-Ti basalts (uncontaminated) to evaluate the DUPAL anomaly, Maranhão has Pb Δ7/4=4.6–11, and Pb Δ8/4=72–87; Serra Geral has Pb Δ7/4=10–13, and Pb Δ8/4=95–125. The small difference is not enough to conform to DUPAL contours, and is inconsistent with large-scale isotopic

  12. Identification of the new isotope 107265Bh by α correlated decay chains

    International Nuclear Information System (INIS)

    The experimental set-up, methods and results on the synthesis and identification of the new isotope 107265Bh are presented. The new isotope was produced by the complete fusion-evaporation reaction of 243Am with 135 MeV 26Mg bombardment at the Sector Focus Cyclotron of Heavy Ion Research Facility Lanzhou. The reaction products were transported and collected using helium-jet technique and a set of rotating wheel system. the identification of the new isotope was made by observing of correlated α-particle decays chain between the new isotope 265Bh and its 261Db and 257Lr daughters. A total of 8 correlated decay events of 265Bh and 4 decay events of 264Bh were observed. The new nuclide 265Bh has a half-life of 0.94-0.31+0.70s and decays by alpha-particle emission with decay energy of Eα=(9.24 ± 0.05) MeV. The half-life and α decay energy of 265Bh from this experiment are consistent with theoretical predictions. (authors)

  13. Investigation of the impact of the $^{39}$Ar(n , $\\alpha)^{36}$S reaction on the nucleosynthesis of the rare isotope $^{36}$S

    CERN Multimedia

    Geltenbort, P

    2002-01-01

    The origin of the rare, neutron rich isotope $^{36}$S remains a debated question. One of the key reactions in the s-process nucleosynthesis network leading to $^{36}$S is $^{39}$Ar(n , $\\alpha) ^{36}\\!$S. This reaction has never been studied so far, which is due to the fact that $^{39}$Ar is a radioactive (T$_{1/2}$ = 269 y) gas, which is not commercially available. During a three days experimental campaign, an optimized $^{39}$Ar sample was prepared at ISOLDE. A dedicated titaniumoxide target (8 g/cm$^{2}$) was bombarded with 1 GeV protons from the PS Booster. In order to obtain a pure argon beam, a water-cooled transfer line was used to freeze-out less volatile isobars before they can reach the ion source. Adding stable argon with a calibrated leak to the ion source enabled to determine the ionization efficiency (3.5%). For the isotope separation, the low-mass side (GLM) of the General Purpose Separator was used. After magnetic separation, $^{39}$Ar ions (1+) were implanted at 60 keV in a 12 mm thick alumin...

  14. Spectroscopic study of the cycling transition 4s[3/2]2-4p[5/2]3 at 811.8 nm in 39Ar: Hyperfine structure and isotope shift

    International Nuclear Information System (INIS)

    Doppler-free saturated absorption spectroscopy is performed on an enriched radioactive 39Ar sample. The spectrum of the 3s23p54s[3/2]2-3s23p54p[5/2]3 cycling transition at 811.8 nm is recorded, and its isotope shift between 39Ar and 40Ar is derived. The hyperfine coupling constants A and B for both the 4s[3/2]2 and 4p[5/2]3 energy levels in 39Ar are also determined. The results partially disagree with a recently published measurement of the same transition. Based on earlier measurements as well as the current work, the isotope shift and hyperfine structure of the corresponding transition in 37Ar are also calculated. These spectroscopic data are essential for the realization of laser trapping and cooling of 37,39Ar.

  15. Rb, Sr and strontium isotopic composition, K/Ar age and large ion lithophile trace element abundances in rocks and glasses from the Wanapitei Lake impact structure

    International Nuclear Information System (INIS)

    Shock metamorphosed rocks and shock-produced melt glasses from the Wanapitei Lake impact structure have been examined petrographically and by electron microprobe. Eleven clasts exhibiting varying degrees of shock metamorphism and eight impact-produced glasses have been analyzed for Rb, Sr and Sr isotopic composition. Five clasts and one glass have also been analyzed for large ion lithophile (LIL) trace element abundances including Li, Rb, Sr, and Ba and the REE's. The impact event forming the Wanapitei Lake structure occurred 37 m.y. ago based on K/Ar dating of glass and glassy whole-rock samples. Rb/Sr isotopic dating failed to provide a meaningful whole-rock or internal isochron. The isotopic composition of the glasses can be explained by impact-produced mixing and melting of metasediments. Large ion lithophile trace element abundance patterns confirm the origin of the glasses by total shock melting of metasediments. (author)

  16. The effects of polymer side-chain structure on roughness formation of ArF photoresist in plasma etching processes

    International Nuclear Information System (INIS)

    Low etching resistance and roughness formation of ArF photoresist during plasma etching are serious problems. We have previously found that decisive factors affecting the plasma resistance and roughness formation in an ArF photoresist are determined by ultraviolet/vacuum ultraviolet radiation and roughness formation is dominated by chemical reactions. In this paper, on the basis of our previous findings on the interaction between radiation species from plasma and ArF photoresist polymers, we investigated the polymer structural dependence for the degradation mechanism of ArF photoresist in the plasma etching processes. The etching resistance of ArF photoresist was improved by controlling the elemental ratio of oxygen atoms and ring structures in photoresist polymer. Furthermore, lactone C=O bond is found to be a key factor for roughness formation during the etching process. We have revealed the importance of the molecular structure of ArF photoresist for improving the surface roughness and etching resistance during the plasma etching process. (paper)

  17. Source of ore-forming fluids of the Tianbaoshan Pb-Zn deposit, Southwest China: constrains from C-O, S, and He-Ar isotopes

    Science.gov (United States)

    Wang, Jian; Zhang, Jun; Zhong, Wenbin

    2016-04-01

    The Sichuan-Yunnan-Guizhou (SYG) metallogenic province is one of the most important areas for Pb-Zn resources in China. The metallogenic sources of these Pb-Zn deposits have long been debated. In this study, we provide integrated C-O-S-He-Ar isotopic data of the typical Tianbaoshan Pb-Zn deposit, with an aim to constrain the sources of ore-forming fluids. The Tianbaoshan deposit a large-sized Pb-Zn deposit in SYG metallogenic province, Southwest China. The proven resources include 2.6 Mt metals of Zn+Pb with average grades of 10.09% Zn and 1.50% Pb. The orebodies are hosted within the carbonates of the Ediacaran Dengying Formation. Ore minerals consist mainly of sphalerite, galena, chalcopyrite, and pyrite. Gangue minerals are dominated by calcite and dolomite. The calcite samples from the Tianbaoshan deposit yield homogeneous δ13CV ‑PDBvalues of -1.70‰ to -1.60‰ (average -1.63), with δ18OV ‑SMOW values ranging from 12.9‰ to 15.2‰ (average 14.4). The C-O isotopic data suggest the hydrothermal fluids may be originated from a mixed source involving both mantle and carbonate wall rocks. The δ34S values of the sphalerite, galena and chalcopyrite samples vary from 3.32‰ to 5.71‰ -0.36‰ to 1.31‰ and 4.5‰ to 4.7‰ respectively, indicating a magmatic source for sulfur. The 3He/4He ratios of chalcopyrite samples range from 0.01 to 0.32 Ra which is slightly higher than the crustal ratios (0.05 Ra), but obviously lower than that of mantle fluids (6 to 9 Ra). The 40Ar/36Ar ratios range from 345.0 to 669.1, which are slightly higher than that of air (298.5). The He-Ar isotopic compositions suggest that the ore-forming fluids are dominantly derived from the crust, with litter contamination from mantle-derived fluids. In combination with the C-O, S, and He-Ar isotopic data, we propose the ore-forming fluids of the Tianbaoshan deposit were derived by mixing of crustal and mantle fluids. And the metallogenic process may be genetically related to the

  18. Significance of mafic hornblende pegmatites intruding ultramafic rocks of the accreted oceanic plateau in Colombia: Ar-Ar and radiogenic isotope constraints

    Science.gov (United States)

    Kerr, A. C.; Tarney, J.; Kempton, P. D.; Pringle, M.

    2002-12-01

    The accreted remnants of the Cretaceous basaltic oceanic plateau in Colombia are tectonically interleaved with flysch metasediment. At Bolivar, in the Western Cordillera, ultramafic/gabbro parts of the plateau are exposed are intruded by spectacular coarse hornblende pegmatites. Some pegmatites are deformed along with the enclosing mafic/ultramafic rocks but others are cross-cutting with magnesio-hornblendes growing out from the margins of the veins. The leucocratic veins vary from hypersthene leucogabbro, through dominant hornblende anorthosite to (rarer) tonalites with biotite and quartz. Clearly, the hydrous pegmatites were generated while the host rocks were still undergoing deformation, but continued to be emplaced when deformation of the hot mantle rock ceased. There are two potential explanations: that water from the intercalated metasediments migrated into the imbricated hot mantle sequence during tectonic accretion to the South American margin; or that these hydrous late-stage processes are part of the initial plume and plateau formation. New step-heating Ar-Ar plateau-ages indicate that the pegmatites are 90.5\\pm0.9 Ma, and so are indistinguishable in age from the basalts and high-MgO rocks of the Colombian-Caribbean oceanic plateau. Geochemically, the pegmatites are low in incompatible trace elements and have generally chondritic trace element ratios. They possess initial epsilon Hf and epsilon Nd values, which range from +12 to +15 and from +6.5 to +7.5 respectively. These values overlap the range of basaltic and picritic plateau rocks of the Caribbean-Colombian plateau. Critically, the pegmatites possess little trace element evidence of a subduction-related signature, and so it is difficult to argue for an arc-related setting, or for sedimentary involvement in their petrogenesis. Alternatively, it would seem that these hydrous pegmatites are part of the oceanic plateau itself, and are unrelated to later obduction. This bears upon whether mantle plumes

  19. Petrology, 40Ar/39Ar age, Sr-Nd isotope systematics, and geodynamic significance of an ultrapotassic (lamproitic) dyke with affinities to kamafugite from the easternmost margin of the Bastar Craton, India

    Science.gov (United States)

    Rao, N. V. Chalapathi; Atiullah; Burgess, R.; Nanda, Purnendu; Choudhary, A. K.; Sahoo, Samarendra; Lehmann, B.; Chahong, Ngazipmi

    2016-04-01

    We report the mineralogy, bulk-rock geochemistry, 40Ar/39Ar (whole-rock) age and radiogenic (Sr and Nd) isotope composition of an ultrapotassic dyke from Sakri (Nuapada lamproite field) located at the tectonic contact between the easternmost margin of the Bastar craton and Eastern Ghats Mobile Belt, India. The Sakri dyke has a mineralogy which strongly resembles a lamproite sensu stricto (viz.,Ti-rich phlogopite, Na-poor diopside, Fe-rich sanidine, ulvospinel trend and Sr-rich apatite). However, its bulk-rock major element geochemical characteristics (viz., extreme silica-undersaturated nature) resemble sensu lato kamafugite from Toro Ankole, Uganda, East African Rift, and Alto Paranaiba Province, Brazil. The Sakri dyke also displays certain compositional peculiarities (viz., high degree of evolution of mica composition from phlogopite to biotite, elevated titanium and aluminum in clinopyroxene and significantly lower bulk Mg#) when compared to the ultrapotassic rocks from various Indian cratons. 40Ar/39Ar dating gave a plateau age of 1045 ± 9 Ma which is broadly similar to that of other Mesoproterozoic (i) lamproites from the Bastar and Bundelkhand cratons, and (ii) kimberlites from the Eastern Dharwar craton. Initial bulk-rock Sr (0.705865-0.709024) and Nd (0.511063-0.511154) isotopic ratios reveal involvement of an `enriched' source region with long-term incompatible element enrichment and a depleted mantle (TDM) Nd model age of 2.56 Ga straddling the Archaean-Proterozoic chronostratigraphic boundary. The bulk-rock incompatible trace element ratios (Ta/Yb, Th/Yb, Rb/Ba and Ce/Y) of the Sakri ultrapotassic dyke negate any significant influence of crustal contamination. Small-degree melting (1 to 1.5 %) of a mixed garnet-facies and spinel-facies phlogopite lherzolite can account for its observed REE concentrations. Whereas the emplacement of the Sakri ultrapotassic dyke is related to the amalgamation of the supercontinent of Rodinia, its overlapping geochemical

  20. On the Production of He, Ne, and AR Isotopes from Mg, Al, Si, Ca, Fe, and NI in an Artificially Irradiated Meteoroid

    Science.gov (United States)

    Wieler, R.; Signet, P.; Rosel, R.; Herpers, U.; Lupke, M.; Lange, H.-J.; Michel, R.

    1992-07-01

    The production of He, Ne, and Ar isotopes from their main target elements was investigated in an experiment (1) by irradiating a 50-cm-diameter gabbro sphere isotropically with 1.6 GeV protons. The model meteoroid contained, among a large number of other targets, pure element foils of Mg, Al, Si, Fe, and Ni at 10 different depths and wollastonite targets at 3 different depths in central bores. After the irradiation, radionuclide production in these targets was measured by gamma spectrometry. Stable He, Ne, and Ar isotopes were measured in statically operated mass spectrometers. Here, we report the results for stable He, Ne, and Ar isotopes and for ^22Na. The production depth profiles vary widely, ranging from profiles with near-surface production 15% higher than in the center (^22Na from Fe) to such profiles with production in the center 45% higher than near the surface (^20Ne from Mg). The isotope ratios ^3He/^4He and ^3He/^21Ne in Mg, Al, Si and ^22Ne/^21Ne in Mg all decrease significantly with increasing shielding. The production rates of He, Ne, and ^22Na from Mg, Al, and Si in the 1600-MeV simulation experiment are 1.5 to 3 times higher than in the model meteoroid of similar size but irradiated earlier with 600 MeV protons (2). This increase is attributed to the increase of the production of secondary neutrons with primary energies rising from 600 to 1600 MeV. This effect also causes the depth dependences of isotope ratios observed in the 1600-MeV simulation that was not seen in the 600-MeV experiment. Model calculations of the production of He, Ne, and Ar isotopes and of ^22Na were performed for the artificial meteorites of the 600- and 1600 MeV-exposures as well as for real meteoroids. Production rates were calculated from depth-dependent p- and n- spectra, which were derived by Monte Carlo techniques using the HERMES code system (3), and from cross sections for the relevant nuclear reactions as described earlier (4). The cross section database for p

  1. Argon, oxygen, and boron isotopic evidence documenting 40ArE accumulation in phengite during water-rich high-pressure subduction metasomatism of continental crust

    Science.gov (United States)

    Menold, Carrie A.; Grove, Marty; Sievers, Natalie E.; Manning, Craig E.; Yin, An; Young, Edward D.; Ziegler, Karen

    2016-07-01

    The Luliang Shan area of the North Qaidam high pressure (HP) to ultrahigh pressure (UHP) metamorphic terrane in northwestern China features thick, garnet- and phengite-rich metasomatic selvages that formed around gneiss-hosted mafic eclogite blocks during HP conditions. Here we present new 40Ar/39Ar, δ18 O, and δ11 B results from a previously studied 30 m, 18 sample traverse that extends from the host gneiss into a representative eclogite block. Previous thermobarometry and new mica-quartz oxygen isotope thermometry from the traverse reveal that the phengite-rich selvage formed at temperatures similar to those recorded by the eclogites at peak pressure. Quartz and white mica δ18 O data from the selvage cannot be explained by simple mixing of gneiss and eclogite, and indicate a fluid/rock ratio >1 during regional-scale infiltration of high δ18 O (ca. 14‰) fluids. Heavy δ18 O overgrowths of metamorphic zircon over lighter δ18 O detrital grains indicate that the gneiss was similarly affected. Starkly contrasting boron content and δ11 B compositions for the host gneiss and the selvage also cannot be explained by local-scale devolatilization of the gneiss to form the selvage. Instead, the boron systematics are best attributed to two distinct phases of fluid infiltration: (1) low-boron selvage phengite with δ11 B from -10 to -30‰ grew under HP conditions; and (2) tourmaline and boron-rich muscovite with generally positive δ11 B crystallized in the host gneiss under subsequent lower pressure epidote-amphibolite facies conditions as the Luliang Shan gneiss terrane was exhumed past shallower portions of the subduction channel. Consistent with observations made worldwide, we were able to identify uptake of excess argon (40ArE) in phengite as a high pressure phenomenon. Phengite 40Ar/39Ar ages from massive eclogite exceed the ca. 490 Ma zircon U-Pb age of eclogite metamorphism by a factor of 1.5. However, phengite ages from the more permeable schistose selvage

  2. The Bulong Gold Deposit-a Quartz-Barite Vein Type Gold Deposit in Xinjiang:Geological Characteristics and S, He and Ar Isotopic Compositions

    Institute of Scientific and Technical Information of China (English)

    YANG Fuquan; WANG Yitian; MAO Jingwen

    2004-01-01

    The Bulong gold deposit, located in the southwest Tianshan in China, occurs in the Upper Devonian finegrained clastic rocks. The gold orebodies are controlled by an gently inclined interlayer fractured zone. They are hosted only in quartz-barite veins though there are barite veins and quartz veins in the ore district. The δ34S values of pyrite in the ores range from 14.6‰ to 19.2‰ and those of barite from 35.0‰o to 39.6‰, indicating that the sulfur was derived from the strata. 3He/4He ratios of fluid inclusions in pyrite are 0.24-0.82 R/Ra, approximating to that of the crust. The 40Ar/36Ar ratios range from 338 to 471, slightly higher than that of the atmosphere. 40Ar/4He ratios of ore fluids range from 0.015 to 0.412 with a mean of 0.153. Helium and argon isotope compositions of fluid inclusions show that the ore fluids of the Bulong gold deposit were mainly derived from the crust.

  3. He, Ne and Ar isotope compositions of fluid inclusions in hy-drothermal sulfides from the TAG hydrothermal field, Mid-Atlantic Ridge

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Helium, neon and argon isotope compositions of fluid inclusionshave been measured in hydrothermal sulfide samples from the TAG hydrothermal field at the Mid-Atlantic Ridge. Fluid-inclusion 3He/4He ratios are 2.2-13.3 times the air value (Ra), and with a mean of 7.2 Ra. Com-parison with the local vent fluids (3He/4He=7.5-8.2 Ra) and mid-ocean ridge basalt values (3He/4He=6-11 Ra) shows that the variation range of 3He/4He ratios from sulfide-hosted fluid inclu-sions is significantly large. Values for 20Ne/22Ne are from 10.2 to 11.4, which are significantly higher than the atmospheric ratio (9.8). And fluid-inclusion 40Ar/36Ar ratios range from 287 to 359, which are close to the atmospheric values (295.5). These results indicate that the noble gases of fluid inclu-sions in hydrothermal sulfides are a mixture of mantle- and seawater-derived noble gases; the partial mantle-derived components of trapped hydrothermal fluids may be from the lower mantle; the helium of fluid inclusions is mainly from upper mantle; and the Ne and Ar components are mainly from seawater.

  4. 40Ar/39Ar Geochronology, Isotope Geochemistry (Sr, Nd, Pb), and petrology of alkaline lavas near Yampa, Colorado: migration of alkaline volcanism and evolution of the northern Rio Grande rift

    Science.gov (United States)

    Cosca, Michael A.; Thompson, Ren A.; Lee, John P.; Turner, Kenzie J.; Neymark, Leonid A.; Premo, Wayne R.

    2014-01-01

    Volcanic rocks near Yampa, Colorado (USA), represent one of several small late Miocene to Quaternary alkaline volcanic fields along the northeast margin of the Colorado Plateau. Basanite, trachybasalt, and basalt collected from six sites within the Yampa volcanic field were investigated to assess correlations with late Cenozoic extension and Rio Grande rifting. In this paper we report major and trace element rock and mineral compositions and Ar, Sr, Nd, and Pb isotope data for these volcanic rocks. High-precision 40Ar/39Ar geochronology indicates westward migration of volcanism within the Yampa volcanic field between 6 and 4.5 Ma, and the Sr, Nd, and Pb isotope values are consistent with a primary source in the Proterozoic subcontinental lithospheric mantle. Relict olivine phenocrysts have Mg- and Ni-rich cores, whereas unmelted clinopyroxene cores are Na and Si enriched with finely banded Ca-, Mg-, Al-, and Ti-enriched rims, thus tracing their crystallization history from a lithospheric mantle source region to one in contact with melt prior to eruption. A regional synthesis of Neogene and younger volcanism within the Rio Grande rift corridor, from northern New Mexico to southern Wyoming, supports a systematic overall southwest migration of alkaline volcanism. We interpret this Neogene to Quaternary migration of volcanism toward the northeast margin of the Colorado Plateau to record passage of melt through subvertical zones within the lithosphere weakened by late Cenozoic extension. If the locus of Quaternary alkaline magmatism defines the current location of the Rio Grande rift, it includes the Leucite Hills, Wyoming. We suggest that alkaline volcanism in the incipient northern Rio Grande rift, north of Leadville, Colorado, represents melting of the subcontinental lithospheric mantle in response to transient infiltration of asthenospheric mantle into deep, subvertical zones of dilational crustal weakness developed during late Cenozoic extension that have been

  5. Mineralogical, chemical and K-Ar isotopic changes in Kreyenhagen Shale whole rocks and pyrolysis experimental maturation

    Science.gov (United States)

    Clauer, Norbert; Lewan, Michael D.; Dolan, Michael P.; Chaudhuri, Sambhudas; Curtis, John B.

    2014-01-01

    Progressive maturation of the Eocene Kreyenhagen Shale from the San Joaquin Basin of California was studied by combining mineralogical and chemical analyses with K–Ar dating of whole rocks and pyrolysis of an immature outcrop sample. The K–Ar age decreases from 89.9 ± 3.9 and 72.4 ± 4.2 Ma for the outcrop whole rock and its <2 μm fraction, respectively, to 29.7 ± 1.5 and 21.0 ± 0.7 Ma for the equivalent materials buried to 5167 m. The natural maturation does not produce K–Ar ages in the historical sense, but rather K/Ar ratios of relative K and radiogenic 40Ar amounts resulting from a combined crystallization of authigenic and alteration of initial detrital K-bearing minerals of the rocks. The Al/K ratio of the naturally matured rocks is essentially constant for the entire depth sequence, indicating that there is no detectable variation in the crystallo-chemical organization of the K-bearing alumino-silicates with depth. No supply of K from outside of the rock volumes occurred, which indicates a closed-system behavior for it. Conversely, the content of the total organic carbon (TOC) content decreases significantly with burial, based on the progressive increasing Al/TOC ratio of the whole rocks. The initial varied mineralogy and chemistry of the rocks and their <2 μm fractions resulting from differences in detrital sources and depositional settings give scattered results that homogenize progressively during burial due to increased authigenesis, and concomitant increased alteration of the detrital material.

  6. Long chain n-alkanes and their carbon isotopes in lichen species from western Hubei Province: implication for geological records

    Institute of Scientific and Technical Information of China (English)

    Xianyu HUANG; Jiantao XUE; Shouyu GUO

    2012-01-01

    Five coticolous lichen samples were collected from western Hubei Province of China to analyze the long chain n-alkanes and their carbon isotope compositions.The n-alkanes range in carbon number from C17 to C33 with strong odd-over-even predominance between C21and C33.Lichens are dominated by n-C29 in the samples of Dajiuhu,Shennongjia Mountain,but by both n-C23 and n-C29 at Qizimei Mountain.This difference may result from the different environmental conditions in these two sites.The δ13C values of long chain n-alkanes in lichen samples show the signature of C3 plants.Based on compoundspecific carbon isotopic values and previous results,we state that alkane homologs > C23 mainly originate from the symbiotic fungi,while symbiotic algae only contribute trace amount of long chain alkanes.Of great interesting is the occurrence of long chain 3-methylalkanes in the Qizimei samples.These anteiso compounds range from C24 to C32,displaying obvious even-over-odd predominance.This study reveals that the association of long chain 3-methylalkanes with n-C23 alkane might be used as proxies to reconstruct the paleoecological implications of lichens in Earth history.

  7. New K-Ar ages for calculating end-of-shield extrusion rates at West Maui volcano, Hawaiian island chain

    Science.gov (United States)

    Sherrod, D.R.; Murai, T.; Tagami, Takahiro

    2007-01-01

    Thirty-seven new K-Ar ages from West Maui volcano, Hawai'i, are used to define the waning stages of shield growth and a brief episode of postshield volcanism. All but two samples from shield-stage strata have reversed polarity magnetization, so conceivably the exposed shield is not much older than the Olduvai Normal-Polarity subchron, or about 1.8 Ma. The oldest ages obtained are in the range 1.9-2.1 Ma but have large analytical error. Shield volcanism ended about 1.35 Ma, and postshield volcanism followed soon thereafter, persisting until about 1.2 Ma. Exposed shield-stage strata were emplaced at a rate of about 0.001 km3 per year, a rate smaller than historic Hawaiian magmatic rates by a factor of 100. Stratigraphic accumulation rates are similar to those measured previously at Wai'anae volcano (O'ahu) or the upper part of the Mauna Kea shield sequence (Hilo drill core, Hawai'i). These rates diminish sharply during the final 0.3-0.5 m.y. of the shield stage. Hawaiian shield volcanoes begin waning well before their last 0.5 m.y. of life, then end quickly, geologically speaking, if West Maui is representative. ?? Springer-Verlag 2006.

  8. Melt evolution beneath a rifted craton edge: 40Ar/39Ar geochronology and Sr-Nd-Hf-Pb isotope systematics of primitive alkaline basalts and lamprophyres from the SW Baltic Shield

    Science.gov (United States)

    Tappe, Sebastian; Smart, Katie A.; Stracke, Andreas; Romer, Rolf L.; Prelević, Dejan; van den Bogaard, Paul

    2016-01-01

    A new high-precision 40Ar/39Ar anorthoclase feldspar age of 176.7 ± 0.5 Ma (2-sigma) reveals that small-volume alkaline basaltic magmatism occurred at the rifted SW margin of the Baltic Shield in Scania (southern Sweden), at a time of global plate reorganization associated with the inception of Pangea supercontinent break-up. Our combined elemental and Sr-Nd-Hf-Pb isotope dataset for representative basanite and nephelinite samples (>8 wt.% MgO) from 16 subvolcanic necks of the 30 by 40 km large Jurassic volcanic field suggests magma derivation from a moderately depleted mantle source (87Sr/86Sri = 0.7034-0.7048; εNdi = +4.4 to +5.2; εHfi = +4.7 to +8.1; 206Pb/204Pbi = 18.8-19.5). The mafic alkaline melts segregated from mixed peridotite-pyroxenite mantle with a potential temperature of ∼1400 °C at 2.7-4.2 GPa (∼90-120 km depths), which places ultimate melt generation within the convecting upper mantle, provided that the lithosphere-asthenosphere boundary beneath the southern Baltic Shield margin was at ⩽100 km depth during Mesozoic-Cenozoic rifting. Isotopic shifts and incompatible element enrichment relative to Depleted Mantle reflect involvement of at least 20% recycled oceanic lithosphere component (i.e., pyroxenite) with some minor continent-derived sediment during partial melting of well-stirred convecting upper mantle peridotite. Although pargasitic amphibole-rich metasomatized lithospheric mantle is excluded as the main source of the Jurassic magmas from Scania, hydrous ultramafic veins (i.e., hornblendite) may have caused subtle modifications to the compositions of passing sublithospheric melts. For example, modeling suggests that the more radiogenic Hf (εHfi = +6.3 to +8.1) and Pb (206Pb/204Pbi = 18.9-19.5) isotopic compositions of the more sodic and H2O-rich nephelinites, compared with relatively homogenous basanites (εHfi = +4.7 to +6.1; 206Pb/204Pbi = 18.8-18.9), originate from minor interactions between rising asthenospheric melts and

  9. First K-Ar-data and Sr-isotopic composition of explosion pipe basanites of Chulimo-Yenisei depression

    International Nuclear Information System (INIS)

    The first data of K-Ar-determination of age and value of 87Sr/86Sr ratio in basanites of volcanic pipes of Chulimo-Yenisei depression are presented. The data testify to the formation of volcanic pipes in Paleogene beginning from the boundary with the upper Creataceous period and up to Oligocene inclusively (71-28 millions of years), in this case the maximum in diameter formation falls within Paleocene. 87Sr/86Sr ratio in basanites changes within narrow limits - from 0.7030 to 0.7036, underlining the closeness of formation conditions during 40 millions of years

  10. 40Ar/39Ar and U-Pb Ages and Isotopic Data for Oligocene Ignimbrites, Calderas, and Granitic Plutons, Southern Stillwater Range and Clan Alpine Mountains: Insights into the Volcanic-Plutonic Connection and Crustal Evolution in Western Nevada

    Science.gov (United States)

    John, D. A.; Watts, K. E.; Henry, C.; Colgan, J. P.; Cousens, B.

    2014-12-01

    Calderas in the southern Stillwater Range (SSR) and Clan Alpine Mountains (CAM) were formed during the mid-Tertiary ignimbrite flareup and subsequently tilted (40->90°) by large-magnitude extension. New geologic mapping, geochemistry, and 40Ar/39Ar and SHRIMP U-Pb zircon dating document 2 periods of magmatism resulting in 4 nested calderas and related granitoid plutons in sections up to 10 km thick. The first period included pre-caldera rhyolite lava domes (30(?) Ma), ~5 km of pre- and post-collapse intermediate lavas and rhyolite tuff that filled the Job Canyon caldera (~29.4 to 28.8 Ma), and the >4-5 km thick, geochemically similar IXL pluton (28.9±0.4 Ma) that intruded the Job Canyon caldera. The second period included pre-caldera rhyolite lava domes and dikes (~25.5 Ma) and 3 ignimbrite units in 3 calderas: tuff of the Louderback Mountains (low-silica rhyolite; ≥600 m thick; ~25.2 Ma); tuff of Poco Canyon (high-silica rhyolite; up to 4.3 km thick; 25.27±0.05 Ma); and ≥2000 km3 tuff of Elevenmile Canyon (trachydacite to rhyolite; up to 4.5 km thick; 25.12±0.01 Ma). The composite Freeman Creek pluton (granite, 24.8±0.4 Ma; granodiorite, 25.0±0.2 Ma) and Chalk Mountain rhyolite porphyry (25.2±0.2 Ma) and granite (24.8±0.3 Ma) plutons intruded the Poco Canyon and Elevenmile Canyon calderas. Early (30 Ma) rhyolites have the least radiogenic compositions (Sri~0.7040), whereas other units are relatively homogeneous (Sri~0.7050, ENd~0.0). Oxygen isotope compositions for SSR and CAM calderas are highly variable (d18Oquartz=5.6-8.2‰, d18Osanidine=5.5-7.0‰, d18Ozircon= 4.1-6.3‰), corresponding to a magmatic range of 5.7-7.9‰. U-Pb dating of zircons indicates homogeneous age populations and few/no xenocrysts and antecrysts. These data show that (1) thick plutons (>2-5 km) underlie compositionally and temporally related caldera-filling ignimbrites, (2) caldera-forming cycles are isotopically variable, requiring divergent magmatic sources in relatively

  11. He, Ar, N and C isotope compositions in Tatun Volcanic Group (TVG), Taiwan: Evidence for an important contribution of pelagic carbonates in the magmatic source

    Science.gov (United States)

    Roulleau, Emilie; Sano, Yuji; Takahata, Naoto; Yang, Frank T.; Takahashi, Hiroshi A.

    2015-09-01

    The Tatun Volcanic Group (TVG), Northeastern Taiwan, is considered to be the extension of the Ryukyu arc, and belongs to the post-collisional collapse Okinawa Trough. Strong hydrothermal activity is concentrated along the Chinshan fault, and Da-you-keng (DYK) represents the main fumarolic area where the most primitive isotopic and chemical composition is observed. In this study, we present chemical and He, Ar, C and N isotopic compositions of fumaroles, bubbling gas and water from hot springs sampled in 2012 and 2013. High 3He/4He ratios from DYK fumaroles (≈ 6.5 Ra) show a typical arc-like setting, whereas other sampling areas show a strong dependence of 3He/4He and CH4/3He ratios with the distance from the main active hydrothermal area (DYK). This could mean strong crustal contamination and thermal decomposition of organic matter from local sediments. Carbon isotope compositions of DYK range from - 6.67‰ to - 5.85‰, and indicate that carbon contribution comes mainly from pelagic carbonates from the slab (limestone, mantle and sediment contributions are 63%, 19% and 18%, respectively). This is consistent with the negative δ15N values (- 1.4 ± 0.5‰) observed for DYK, implying a strong nitrogen-mantle contribution, and an absence of contribution from nitrogen-pelagic carbonates. These results have important consequences related to the Ryukyu subducted slab. In fact, the Ryukyu margin presents little in off scraping the sedimentary cover to the subducting plate that does not permit any nitrogen contribution in magma from TVG.

  12. Formation and evolution of the Cigar Lake uranium deposit based on U-Pb and K-Ar isotope systematics

    International Nuclear Information System (INIS)

    A systematic geochronological study was conducted on the Cigar Lake uranium deposit. U-Pb and Pb-Pb systematics were applied to different types of uranium ore, and various associated sheet silicates were dated by the K-Ar method. These two approaches define a widespread retrograde metamorphic event in the basement, which occurred at about 1780 Ma during the Hudsonian orogeny, and a four-stage evolutionary model for the ore deposit. This model is compatible with the history of other unconformity-type uranium deposits in the Athabasca Basin. The first stage in the evolution of the Cigar Lake uranium deposit is marked by uraninite crystallization at 1341 ± 17 Ma, which, in association with arsenides and sulfarsenides, constitutes the mineralization of economic interest (main orebody). The second stage, characterized by a Fe-kaolinite and Fe-illite paragenesis, occurred locally at about 900 Ma. The third stage involved uranium mobilization at about 325 Ma and is characterized by (i) preferential loss of radiogenic lead from primary uraninite and crystallization of pitchblende at the rims of uraninite grains and (ii) formation of pitchblende associated with Fe sulfides or hematite in the main and perched orebodies. The last stage is characterized by recent alteration and coffinitization which have affected all ore types. 40 refs., 8 figs., 3 tabs

  13. Ars disyecta Ars disyecta

    Directory of Open Access Journals (Sweden)

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  14. Assessment of the effects of cage fish-farming on damselfish-associated food chains using stable-isotope analyses

    International Nuclear Information System (INIS)

    Highlights: • Damselfishes living at sites near a cage farm bore lower δ13C and higher δ15N. • Similar trends occurred in zooplankton and detritus, major foods for damselfishes. • δ15N enrichment in fish may have arisen from the uptake of excess feed and prey. • Farm wastes were documented entering the ecosystem through the pelagic food chain. • No clear evidence of the effects of cage farming on stable isotopes in macroalgae. - Abstract: To assess the effect of cage fish-farming on the coral reef ecosystem off Xiaoliuchiu Island, southern Taiwan, geographical differences in the food chain of each of two damselfishes, Pomacentrus vaiuli and Chromis margaritifer, were examined using a stable-isotope approach. For each damselfish, individuals were found to consume similar foods at all sites. However, specimens collected at sites near the cage farm (as the experimental sites) exhibited lower δ13C and higher δ15N signatures compared to those from reference sites. Similar trends also occurred in the zooplankton and detritus, two major food sources for both damselfishes. This finding indicates that particulate organic matter released by the farm may have entered the coral reef ecosystem through the pelagic food chain. Artificial reef emplacement is recommended to provide extra habitats under cage farms to support additional pelagic-feeding fish populations, thereby reducing environmental impacts of cage farming on coral reefs

  15. Natural variation of magnesium isotopes in mammal bones and teeth from two South African trophic chains

    Science.gov (United States)

    Martin, Jeremy E.; Vance, Derek; Balter, Vincent

    2014-04-01

    Isotopic fractionations accompanying element transfer through terrestrial ecosystems have the potential to shed light on ecological interactions between primary producers and consumers, but with the exception of carbon and nitrogen this potential has barely been exploited. Here, the magnesium stable isotope composition of bones and teeth of extant mammals from Kruger National Park (KNP) and Western Cape (WC), South Africa was measured for the first time. The nature of the geological substrate proves to be a major determinant of the ecosystem isotope baseline, as indicated by the lighter magnesium isotope ratios measured in WC mammals (ranging from -1.58‰ to -0.79‰) compared to those from KNP mammals (ranging from -1.01‰ to -0.04‰). Therefore, comparisons between the isotope signatures of taxa must be restricted to a pre-defined geographic area with a homogeneous substrate. In both parks, Mg shows slight enrichment in heavier isotopes from herbivores to carnivores. Plant remains trapped in the dentition of herbivores provide direct evidence of dietary source and, when available, were measured. In KNP only, δ26Mg of plant remains is systematically lighter than the values for herbivore teeth. These results invite further exploration of the variability of Mg isotopes in vertebrate ecosystems in order to test whether magnesium, a bio-essential element present in relatively large proportions in bone and teeth apatite, may serve as an additional trophic tracer to nitrogen, which is a constituent of collagen that rapidly degrades after burial.

  16. 40Ar/39Ar age calibration against counted annuallayers

    DEFF Research Database (Denmark)

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  17. Gas isotopic signatures (He, C, and Ar) in the Lake Kivu region (western branch of the East African rift system): Geodynamic and volcanological implications

    Science.gov (United States)

    Tedesco, D.; Tassi, F.; Vaselli, O.; Poreda, R. J.; Darrah, T.; Cuoco, E.; Yalire, M. M.

    2010-01-01

    On 17 January 2002, the city of Goma was partly destroyed by two of the several lava flows erupted from a roughly N-S oriented fracture system opened along the southern flank of Mount Nyiragongo (Democratic Republic of Congo), in the western branch of the East African rift system. A humanitarian and scientific response was promptly organized by international, governmental, and nongovernmental agencies coordinated by the United Nations and the European Union. Among the different scientific projects undertaken to study the mechanisms triggering this and possible future eruptions, we focused on the isotopic (He, C, and Ar) analysis of the magmatic-hydrothermal and cold gas discharges related to the Nyiragongo volcanic system, the Kivu and Virunga region. The studied area includes the Nyiragongo volcano, its surroundings, and peripheral areas inside and outside the rift. They have been subdivided into seven regions characterized by distinct 3He/4He (expressed as R/Rair) ratios and/or δ13C-CO2 values. The Nyiragongo summit crater fumaroles, whose R/Rair and δ13C-CO2 values are up to 8.73 and from -3.5‰ to -4.0‰ VPDB, respectively, show a clear mantle, mid-ocean ridge basalt (MORB)-like contribution. Similar mantle-like He isotopic values (6.5-8.3 R/Rair) are also found in CO2-rich gas emanations (mazukus) along the northern shoreline of Lake Kivu main basin, whereas the 13δC-CO2 values range from -5.3‰ to -6.8‰ VPDB. The mantle influence progressively decreases in (1) dissolved gases of Lake Kivu (2.6-5.5 R/Rair) and (2) the distal gas discharges within and outside the two sides of the rift (from 0.1 to 1.7 R/Rair). Similarly, δ13C-CO2 ratios of the peripheral gas emissions are lighter (from -5.9‰ to -11.6‰ VPDB) than those of the crater fumaroles. Therefore, the spatial distribution of He and C signatures in the Lake Kivu region is mainly produced by mixing of mantle-related (e.g., Nyiragongo crater fumaroles and/or mazukus gases) and crustal-related (e

  18. He, Ne and Ar isotope compositions of fluid inclusions in hy-drothermal sulfides from the TAG hydrothermal field, Mid-Atlantic Ridge

    Institute of Scientific and Technical Information of China (English)

    ZENG; Zhigang; (

    2001-01-01

    Elderfield, H. , Schultz, A. , Mid-ocean ridge hydrothermal fluxes and the chemical composition of the ocean, Annu. Rev. Earth Planet. Sci. , 1996, 24: 191.[12]Hou, Z. Q. , Li, Y. H. , Ai, Y. D. , The helium isotopic compositions of activity hydrothermal system in the Okinawa trough?/FONT>mantle-derived helium evidence, Science in China, Ser. D, 1999, 42(2): 155.[13]Herzig, P. M. , Petersen, S. , Hannington, M D. , Geochemistry and sulfur-isotopic composition of the TAG hydrothermal mound, Mid-Atlantic Ridge, 26°N, Proc ODP, Sci. Results, 1998, 158: 47.[14]Meyer, P. S. , Bryan, W. B. , Petrology of basaltic glasses from the TAG segment: Implications for a deep hydrothermal heat source, Geophysical Research Letters, 1996, 23: 3435.[15]Thompson, G. , Humphris, S. E. , Schroeder, B. et al. , Active vents and massive sulfides at 26°N (TAG) and 23°N (Snakepit) on the Mid-Atlantic Ridge, Canadian Mineralogist, 1988, 26: 697.[16]Lalou, C. , Reyss, J. L. , Brichet, E. et al. , Hydrothermal activity on a 105-year scale at a slow-spreading ridge, TAG hydrothermal field, Mid-Atlantic ridge 26°N, Journal of Geophysical Research, 1995, 100: 17855.[17]Stuart, F. M. , Turner, G. , Mantle-derived 40Ar in mid-ocean ridge hydrothermal fluids: implications for the source of volatiles and mantle degassing rates, Chemical Geology, 1998, 147: 77.[18]Lalou, C. , Reyss, J. L. , Brichet, E. et al. , New age data for Mid-Atlantic Ridge hydrothermal sites: TAG and Snakepit chronology revisited, Journal of Geophysical Research, 1993, 98: 9705.[19]Lalou, C. , Reyss, J. L. , Brichet, E. , Age of sub-bottom sulfide samples at the TAG active mound, Proc. ODP, Sci. Results, 1998, 158: 111.[20]You, C. F. , Bickle, M. J. , Evolution of an active sea-floor massive sulphide deposit, Nature, 1998, 394: 668.[21]Kurz, M. D. , Jenkins, W. J. , Schilling, J. G. et al. , Helium isotopic variations in the mantle beneath the central North Atlantic Ocean, Earth and Planetary

  19. 3He/4He isotopic ratio characterization of the Polynesian region. The society and upper cook-austral chains

    International Nuclear Information System (INIS)

    In this paper it is reported the result of a systematic survey of the helium isotopic composition for basaltic rocks from the Polynesian region. The database covering the Society chain lists 79 entries deriving from experiments carried out at SIO (Scripps Institution of Oceanography, University of California San Diego, CA, USA) following the procedure of crushing on-line with an 8 minute single step; data for the Cook-Austral islands are taken from the literature. The 3He/4He value distribution shows an intrinsic dispersion s between 1.1 and 1.4 times RA (RA=3He/4He in Air=1.39 x 10-6) and appears sensibly uniform over the area explored, clearly independent form the variation of age (0 to 20 My) along the dorsal of the island chains. The difference appearing between the mean value obtained for the Society (R/RA=6.3 plus or minus 1) and the Cook-Austral (R/RA=7.3 plus or minus 1.4) is not appreciable within the natural dispersion. The values obtained are substantially lower than the Pacific MORB (R/RA∼8.7 RA). No evident correlation appears in the general picture between the helium data and the other radiogenic isotopes interpreted as tracers for possible heterogeneity in the mantle

  20. Rainwater tracing using the stable isotopes in the Western Mediterranean (case of Rif Chain in the North of Morocco)

    International Nuclear Information System (INIS)

    Nine meteorological stations, distributed between 3 and 996 m of altitude, have been used as basis of an isotopic study of rainwater carried out in the Rif chain (Northern part of Morocco) during the hydrological cycles 2004 to 2006. This study allowed us to examine the isotopic variations during the year and to define the relationship between 18O and 2H. The altitude gradient established for 18O is: -0.27 per mille per 100 m. We have also used the relationship between emergence points altitudes of some studied springs and their 18O contents to calculate the regional 18O gradient. The selected springs are supposed to have nearest emergence altitudes to the ones of the neighbouring mountains. The 18O content variation in the springs corresponds to an altitudinal gradient: -0.27 per mille per 100 m. It is remarkable to note that this gradient is identical to that of the rainwater. Even if this isotopic study is reduced in time, it seems to be sustainable to establish a correct regional meteoric line. The constant difference associated to the regression (4.25 in groundwater and 4.87 in rainwater) remains to discuss. Before having a demonstrated value, we will use the gradient and the origin ordinate determined from the springs, gradient that takes in to account the rains evaporation before their infiltration. (author)

  1. Rainwater tracing using the stable isotope in the Western Mediterranean (case of Rif Chain in the North of Morocco)

    International Nuclear Information System (INIS)

    Nine meteorological stations, distributed between 3 and 996 m of altitude, have been used as basis of an isotopic study of rainwater carried out in the Rif Chain (Northern part of Morocco) during the hydrological cycles 2004 to 2006. This study allowed us to examine the isotopic variations during the year and to define the relationship between 18O and 2H.The altitudinal gradient established for 18O is: δ -0.27 per mille 100 m. We have also used the relationship between emergence points altitudes of some studied springs and their 18O contents to calculate the regional 18O gradient. The selected springs are supposed to have nearest emergence altitudes to the ones of the neighbouring mountains. The 18O content variation in the springs corresponds to an altitudinal gradient: δ -0.27 per mille per 100 m. It is remarkable to note that this gradient is identical to that of the rainwater. Even if this isotopic study is reduced in time, it seems to be sustainable to establish a correct regional meteoric line at least of the slope. The constant difference related to the regression (4.25 in groundwater and 4.87 in rainwater) has to be discussed. Before having a demonstrated value, we will use the gradient and the origin ordinate determined from springs, gradient that takes into account the rains evaporation before their infiltration. (author)

  2. Use of stable carbon and nitrogen isotopes to trace the larval striped bass food chain in the Sacramento-San Joaquin Estuary, California, April to September 1985

    Science.gov (United States)

    Rast, Walter; Sutton, J.E.

    1989-01-01

    To assess one potential cause for the decline of the striped bass fishery in the Sacramento-San Joaquin Estuary, stable carbon and nitrogen isotope ratios were used to examine the trophic structures of the larval striped bass food chain, and to trace the flux of these elements through the food chain components. Study results generally confirm a food chain consisting of the elements, phytoplankton/detritus-->zooplankton/Neomysis shrimp-->larval striped bass. The stable isotope ratios generally become more positive as one progresses from the lower to the higher trophic level food chain components, and no unusual trophic structure was found in the food chain. However, the data indicate an unidentified consumer organism occupying an intermediate position between the lower and higher trophic levels of the larval striped bass food chain. Based on expected trophic interactions, this unidentified consumer would have a stable carbon isotope ratio of about 28/mil and a stable nitrogen isotope ratio of about 8/mi. Three possible feeding stages for larval striped bass also were identified, based on their lengths. The smallest length fish seem to subsist on their yolk sac remnants, and the largest length fish subsist on Neomysis shrimp and zooplankton. The intermediate-length fish represent a transition stage between primary food sources and/or use of a mixture of food sources. (USGS)

  3. Dependence of the measured 38Ar/36Ar ratio on the total Ar amount and its implications

    International Nuclear Information System (INIS)

    The sensitivity of a mass spectrometer for different isotopes of an element usually is not the same and causes a systematic difference between measured and actual isotopic ratios and is defined as mass discrimination. In noble gas mass spectrometry, the correction factor for mass discrimination can be calculated using a reference gas (air in most cases) with known isotopic composition. The mass discrimination factor (mdf) is defined as the ratio of true isotopic ratio to the measured isotopic ratio. Usually, mdf values, determined using argon in air as standard, are nearly constant for a given element over long periods of time. Both mass discrimination and sensitivity remain the same over a certain range of total pressure in the mass spectrometer, during the measurement of a given gas. For the case of Xe, Kr and Ne, in general, the total gas pressure in the mass spectrometer during the analysis of a sample gas falls within this range and consequently, a fixed value of sensitivity and mdf are used. But in the case of argon and particularly in certain cases (like in ureilites), this may not be true as we deal with samples having a wide range of 40Ar/36Ar ratios (10-3 to 104). It was noticed that the values for 38Ar/36Ar in ureilites (having 40Ar/36Ar 40Ar/36Ar = 295.5. This was the motivation for investigating the pressure effect on the measured ratio of 38Ar/36Ar

  4. Nuclear structure studies on indium and tin isotope chains by means of laser spectroscopy

    International Nuclear Information System (INIS)

    In a collaboration with GSI in Darmstadt and ISOLDE in Geneva the hyperfine structure (HFS) and the isotope shift (IS) of the indium isotopes from 104In - 127In in their ground and isomeric states could be studied. Additionally the tin isotopes 109Sn and 111Sn could be measured. In tin the transition 5p21S0 → 5p6s 3P1 with λ = 563 nm was studied. In indium the transition 5p 2P1/2 → 6s 2S1/2 with λ = 410 nm and 5p 2P3/2 → 6s 2S1/2 with λ = 451 nm could be measured. The magnetic dipole moments and electric quadrupole moments determined from the measurements of the HFS can be sufficiently explained in the framework of the single-particle model. From the moments the configurations and spins of the studied nuclear states can be stated. In 109Sn the nuclear spin was determined to I = 5/2. The measurement of the IS in two lines in 108In allowed regarding the coupling rules for nuclear moments the determination of the nuclear spin. The spin of the 40 m isomers of the 108mIn can be stated to I = 2. The mean square nuclear charge radius exhibits a parabolic slope the quadratic part of which with a maximum in the shell center at N = 66 between the neutron numbers N = 50 and N = 82 can be understood as sum of contributions of a surface correlation, i.e. a quadrupole deformation as well as eventually present higher order terms or a change of the surface skin density. The deformation determinable by this description is both for tin and for indium essentially larger than the deformation from the B(E2) values of tin or from the intrinsic quadrupole moments in indium derived from the HFS. (orig./HSI)

  5. Stellar (n ,γ ) cross sections of neutron-rich nuclei: Completing the isotope chains of Yb, Os, Pt, and Hg

    Science.gov (United States)

    Marganiec, J.; Dillmann, I.; Domingo-Pardo, C.; Käppeler, F.

    2014-12-01

    The (n ,γ ) cross sections of the most neutron-rich stable isotopes of Yb, Os, Pt, and Hg have been determined in a series of activation measurements at the Karlsruhe 3.7 MV Van de Graaff accelerator, using the quasistellar neutron spectrum for k T =25 keV that can be produced with the 7Li(p ,n ) 7Be reaction. In this way, Maxwellian averaged cross sections could be directly obtained with only minor corrections. After irradiation the induced activities were counted with a HPGe detector via the strongest γ -ray lines. The stellar neutron capture cross sections of Yb,176174, Os,192190, Pt,198196, and Hg,204202, extrapolated to k T =30 keV, were found to be 157 ±6 mb, 114 ±8 mb, 278 ±11 mb, 160 ±7 mb, 171 ±19 mb, 94 ±4 mb, 62 ±2 mb, and 32 ±15 mb, respectively. In the case of 196Pt the partial cross section to the isomeric state at 399.5 keV could be determined as well. With these results the cross section data for long isotopic chains could be completed for a discussion of the predictive power of statistical model calculations towards the neutron-rich and proton-rich sides of the stability valley.

  6. 40Ar-39Ar geochronology and thermochronology: principles and potential

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  7. Molecular sieve isolation technique for use in stable carbon isotope analysis of individual long-chain n-alkanes in crude oil

    International Nuclear Information System (INIS)

    An isolation procedure of microgram amounts of long-chain n-alkanes from crude oil using molecular sieve was examined for its applicability to stable carbon isotope analysis by gas chromatography/isotope ratio mass spectrometry (GC/IRMS). The procedure examined is as follows: molecular sieve (type 5A, 200 mg) in 1 ml of isooctane solvent are mixed with a saturated hydrocarbon fraction extracted from an appropriate amount (approx. 20 mg) of crude oil and stayed at room temperatures for more than 3 hours. Long-chain n-alkanes are isolated by extraction with n-hexane after dissolution of the resulting molecular sieve with 47% hydrofluoric acid solution. The recoveries were 90±6% for C15-C34 n-alkanes when their total amounts applied do not exceed 1.4 mg. No effect of the isolation procedure on carbon isotope ratios of n-alkanes was observed. (author)

  8. Gem-bearing basaltic volcanism, Barrington, New South Wales: Cenozoic evolution, based on basalt K-Ar ages and zircon fission track and U-Pb isotope dating

    International Nuclear Information System (INIS)

    Based on basalt K-Ar and zircon fission track dating, Barrington shield volcano was active for 55 million years. Activity in the northeast, at 59 Ma, preceded more substantial activity between 55 and 51 Ma and more limited activity on western and southern flanks after 45 Ma. Eruptions brought up megacrystic gemstones (ruby, sapphire and zircon) throughout the volcanism, particularly during quieter eruptive periods. Zircon fission track dating (thermal reset ages) indicates gem-bearing eruptions at 57, 43, 38, 28 and 4-5 Ma, while U-Pb isotope SHRIMP dating suggests two main periods of zircon crystallisation between 60 and 50 Ma and 46-45 Ma. Zircons show growth and sector twinning typical of magmatic crystallisation and include low-U, moderate-U and high-U types. The 46 Ma high-U zircons exhibit trace and rare-earth element patterns that approach those of zircon inclusions in sapphires and may mark a sapphire formation time at Barrington. Two Barrington basaltic episodes include primary lavas with trace-element signatures suggesting amphibole/apatite-enriched lithospheric mantle sources. Other basalts less-enriched in Th, Sr, P and light rare-earth elements have trace-element ratios that overlap those of HIMU-related South Tasman basalts. Zircon and sapphire formation is attributed to crystallisation from minor felsic melts derived by incipient melting of amphibole-enriched mantle during lesser thermal activity. Ruby from Barrington volcano is a metamorphic type, and a metamorphic/metasomatic origin associated with basement ultramafic bodies is favoured. Migratory plate/plume paths constructed through Barrington basaltic episodes intersect approximately 80% of dated Palaeogene basaltic activity (65-30 Ma) along the Tasman margin (27-37 deg S) supporting a migratory plume-linked origin. Neogene Barrington activity dwindled to sporadic gem-bearing eruptions, the last possibly marking a minor plume trace. The present subdued thermal profile in northeastern New South

  9. Geological Dating by 40 Ar - 39 Ar method

    International Nuclear Information System (INIS)

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  10. Archean and proterozoic in the West-European Hercynian chain: isotopic geochemistry (Sr-Nd-Pb) and U-Pb geochronology on zircons

    International Nuclear Information System (INIS)

    The first part of this research thesis reports the study of isotopic (Sr-Nd-Pb) geochemistry and U-Pb geochronology on zircons in the immersed granulites of the Bay of Biscay: U-Pb geochronology on zircons, Nd isotopic geochemistry, Sr isotopic geochemistry, common Pb, Rb-Sr, Sm-Nd and rare earth data on minerals, comparison with other European granulites, comparison with West-Africa, study of Archean and proterozoic in the Hercynian chain. The second part reports the study of the U-Pb geochronology on zircon in the Cadomian, and the third part addresses the Sr-Nd isotopic geochemistry of some Cadomian granitoid, and the crust contamination in different regions

  11. He, Ne and Ar isotope signatures of mid-ocean ridge basalts and their implications for upper mantle structure: A case study from the Mid-Atlantic Ridge at 4-12°S

    Science.gov (United States)

    Stroncik, Nicole A.; Niedermann, Samuel

    2016-06-01

    The geochemical structure of the upper mantle in general and its noble gas isotopic structure in particular have been the subject of countless studies, as both provide important insights into mantle dynamic processes and are essential for the formulation of mantle geodynamic models. This contribution presents a noble gas study of basaltic glasses derived from the Mid-Atlantic Ridge (MAR) between 4° and 12°S, an area well known for its high degree of lithophile isotope heterogeneity and its anomalous crustal thickness. The Sr, Nd, Pb and Hf isotopic systematics along this segment of the MAR range from strongly depleted (i.e. more depleted than N-MORB) to highly enriched. Different concepts have been proposed to explain the observed isotopic signatures. Here we show that the high degree of heterogeneity is not confined to the isotopes of the lithophile elements, but is also shown by the noble gas isotopes and noble gas interelement ratios, such as 3He/22NeM or 4He/40Ar∗. Helium isotopic ratios (3He/4He), 21Ne/22Neextra and 40Ar/36Ar range from 7.34 ± 0.06 to 9.38 ± 0.08 RA, from 0.039 ± 0.020 to 0.075 ± 0.007, and from 346 ± 5 to 37,400 ± 1300, respectively. However, the majority of the Ne isotope data are clearly aligned along a single mixing line in the Ne three-isotope diagram, represented by the equation 20Ne/22Ne = 70.5 × 21Ne/22Ne + 7.782, with a slope distinctly less than that of the MORB line. This indicates that the strongly depleted material is characterised by a significantly more nucleogenic Ne isotopic composition than the normal depleted mantle. We show, based on covariations between 3He/4He and 21Ne/22Neextra with 206Pb/204Pb and 178Hf/177Hf that the strongly depleted material erupted at this MAR segment was most likely produced by an ancient melting event. This implies that isotopic heterogeneities in the upper mantle are not solely caused by the injection of enriched materials from deep-seated mantle plumes or by crustal recycling but may

  12. Stable isotope model for assessing production of short chain fatty acids from colon-derived sugar: application in pigs.

    Science.gov (United States)

    Kien, C L; Murray, R D; Ailabouni, A; Powers, P; Kepner, J; Powers, L; Brunengraber, H

    1996-12-01

    Sugar reaching the colon because of intestinal maldigestion or malabsorption may be fermented to acetate and other short-chain fatty acids, resulting in stimulation of colonic water absorption and cell proliferation. To explore this phenomenon in more detail, we have developed a stable isotope model for estimating the fraction of colon-derived glucose or lactose that is fermented to acetate, propionate and butyrate. In an initial application of the model, [d3]-acetate and either [1-(13)C]-glucose or [D-1-(13)C]-lactose were infused into the cecum or colon of piglets, and plateau plasma acetate enrichment was monitored in the carotid artery. In acutely anesthetized piglets, the fractions of glucose and lactose fermented to acetate were 17.0 and 20.0%, respectively. In a chronically catheterized piglet, fermentation was higher (34.2%). When conducted in chronically catheterized animals or via a colostomy or ileostomy in infants, this model may be used to determine how age, previous surgery or antibiotic therapy affects the efficiency of colonic assimilation of carbohydrate. PMID:9001376

  13. Isotopegeochemical investigations and dating on minerals and fossils from sedimentary rocks: 1. Glauconites from Jura, Molasse and Helveticum (K-Ar, Rb-Sr), 2. 87Sr/86Sr-Isotope stratigraphy on marine and limnetic micro- and macro-fossils, 3. Primary minerals from tertiary bentonites and tuffs (U-Pb, K-Ar)

    International Nuclear Information System (INIS)

    Glauconite investigations: the main problem in dating glauconites lies in the identification of authigenic minerals which have not been influenced by post-sedimentary processes. The age determination on glauconites from the three different tectonic units: the Jura mountains, the molasse basin and the Helvetic nappes, yield inconsistent results. Up to 35% too young K-Ar ''ages'' of glauconites from limestones from the Helvetic nappes can be traced to partial Ar loss caused by sediment-lithification and tectonic events. Sr-isotope stratigraphy: multiple analyses of recent samples from the Mediterranean Sea and from the North Atlantic show that the 87Sr/86Sr isotope ratios correspond well. In a stratigraphic ideal section from the Upper marine molasse a resolution of 206Pb/238U method zircons from the Fish Canyon Tuff were measured and yielded ages of 28.49±0.10, 24.46±0.11 and 28.46±0.13 Ma. These values correspond well with the published mean value of zircon and apatite fission track age of 28.4±0.7 Ma. Thus, the U-Pb method for dating young volcanic minerals seems to be suitable. However, the published mean value (''solid state age'') of Naeser et al. (1981) is higher than the published (''gas age'') mean value of 27.2±0.7 Ma based on biotite, sanidine, hornblende and plagioclase. (author) figs., tabs., refs

  14. Ars Electronica

    DEFF Research Database (Denmark)

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  15. Relativistic mean field study of the properties of Z=117 nucleus and the decay chains of $^{293,294}$117 isotopes

    CERN Document Server

    Bhuyan, M

    2010-01-01

    We have calculated the binding energy, root-mean-square radius and quadrupole deformation parameter for the recently synthesized superheavy element Z=117, using the axially deformed relativistic mean field (RMF) model. The calculation is extended to various isotopes of Z=117 element, strarting from A=286 till A=310. We predict almost spherical structures in the ground state for almost all the isotopes. A shape transition appears at about A=292 from prolate to a oblate shape structures of Z=117 nucleus in our mean field approach. The most stable isotope (largest binding energy per nucleon) is found to be the $^{288}$117 nucleus. Also, the Q-value of $\\alpha$-decay $Q_\\alpha$ and the half-lives $T_{\\alpha}$ are calculated for the $\\alpha$-decay chains of $^{293}$117 and $^{294}$117, supporting the magic numbers at N=172 and/ or 184.

  16. Diversity of Anaerobic Microorganisms Involved in Long-Chain Fatty Acid Degradation in Methanogenic Sludges as Revealed by RNA-Based Stable Isotope Probing▿

    OpenAIRE

    Hatamoto, Masashi; IMACHI, HIROYUKI; Yashiro, Yuto; Ohashi, Akiyoshi; Harada, Hideki

    2007-01-01

    Long-chain fatty acid (LCFA) degradation is a key step in methanogenic treatment of wastes/wastewaters containing high concentrations of lipids. However, despite the importance of LCFA-degrading bacteria, their natural diversity is little explored due to the limited availability of isolate information and the lack of appropriate molecular markers. We therefore investigated these microbes by using RNA-based stable isotope probing. We incubated four methanogenic sludges (mesophilic sludges MP a...

  17. Properties of Z=120 nuclei and the \\alpha-decay chains of the (292,304)120 isotopes using relativistic and non-relativistic formalisms

    CERN Document Server

    Ahamad, Shakeb; Patra, S K

    2012-01-01

    The ground state and first intrinsic excited state of superheavy nuclei with Z=120 and N=160-204 are investigated using both non-relativistic Skyrme-Hartree-Fock and the axially deformed Relativistic Mean Field formalisms. We employ a simple BCS pairing approach for calculating the energy contribution from pairing interaction. The results for isotopic chain of binding energy, quadrupole deformation parameter, two neutron separation energies and some other observables are compared with the FRDM and some recent macroscopic-microscopic calculations. We predict superdeformed ground state solutions for almost all the isotopes. Considering the possibility of magic neutron number, two different mode of \\alpha-decay chains (292)120 and (304)120 are also studied within these frameworks. The Q_{\\alpha}-values and the half-life T^{\\alpha}_{1/2} for these two different mode of decay chains are compared with FRDM and recent macroscopic-microscopic calculations. The calculation is extended for the \\alpha-decay chains of 29...

  18. Hofmann elimination of p-nitrophenylethyl-1-C-14-trimethylammonium bromide: a carbon-14 isotope effect study (Preprint no. AR-24)

    International Nuclear Information System (INIS)

    The alpha carbon isotope effects in the Hofmann elimination of p-nitrophenylethyl-1-C-14-trimethylammonium bromide compound have been measured under changing buffer concentrations with a view to correlate mechanistic change. Since there are alpha-carbon isotope effects and the effects are small it is quite likely that the reaction is of the ElcB type, predominately irreversible, with the incursion of slightly increasing fractions of reaction by the reversible mechanism as the buffer concentration is increased. (author). 4 refs., 2 tab

  19. Analyzing sites of OH radical attack (ring vs. side chain) in oxidation of substituted benzenes via dual stable isotope analysis (δ(13)C and δ(2)H).

    Science.gov (United States)

    Zhang, Ning; Geronimo, Inacrist; Paneth, Piotr; Schindelka, Janine; Schaefer, Thomas; Herrmann, Hartmut; Vogt, Carsten; Richnow, Hans H

    2016-01-15

    OH radicals generated by the photolysis of H2O2 can degrade aromatic contaminants by either attacking the aromatic ring to form phenolic products or oxidizing the substituent. We characterized these competing pathways by analyzing the carbon and hydrogen isotope fractionation (εC and εH) of various substituted benzenes. For benzene and halobenzenes that only undergo ring addition, low values of εC (-0.7‰ to -1.0‰) were observed compared with theoretical values (-7.2‰ to -8‰), possibly owing to masking effect caused by pre-equilibrium between the substrate and OH radical preceding the rate-limiting step. In contrast, the addition of OH radicals to nitrobenzene ring showed a higher εC (-3.9‰), probably due to the lower reactivity. Xylene isomers, anisole, aniline, N,N-dimethylaniline, and benzonitrile yielded normal εH values (-2.8‰ to -29‰) indicating the occurrence of side-chain reactions, in contrast to the inverse εH (11.7‰ to 30‰) observed for ring addition due to an sp(2) to sp(3) hybridization change at the reacting carbon. Inverse εH values for toluene (14‰) and ethylbenzene (30‰) were observed despite the formation of side-chain oxidation products, suggesting that ring addition has a larger contribution to isotope fractionation. Dual element isotope slopes (∆δ(2)H/∆δ(13)C) therefore allow identification of significant degradation pathways of aromatic compounds by photochemically induced OH radicals. Issues that should be addressed in future studies include quantitative determination of the contribution of each competing pathway to the observed isotope fractionation and characterization of physical processes preceding the reaction that could affect isotope fractionation. PMID:26520272

  20. Production yields of noble-gas isotopes from ISOLDE UCx/graphite targets

    International Nuclear Information System (INIS)

    Yields of He, Ne, Ar, Kr and Xe isotopic chains were measured from UCx/graphite and ThCx/graphite targets at the PSB-ISOLDE facility at CERN using isobaric selectivity achieved by the combination of a plasma-discharge ion source with a water-cooled transfer line. The delay times measured for a UCx/graphite target allow for an extrapolation to the expected yields of very neutron-rich noble gas isotopes, in particular for the 'NuPECC reference elements' Ar and Kr, at the next-generation radioactive ion-beam facility EURISOL

  1. Electron scattering from 36Ar and 40Ar

    International Nuclear Information System (INIS)

    The argon isotopes, 36Ar and 40Ar, have been investigated using electron scattering at the high-resolution Linac facilities of the National Bureau of Standards. Both elastic scattering and scattering to low-lying states have been observed. A high-pressure, low-volume gas target cell was designed and developed for this experiment. The cell features a transmission geometry and has resolution comparable to solid targets. Spectra were obtained at incident beam energies ranging from 65 to 115 MeV at scattering angles of 92.50 and 1100. Values obtained for the rms charge radii are 3.327 +- 0.015 and 3.393 +- 0.015 fm for 36Ar and 40Ar respectively. A sensitive measurement was made of the difference in the two radii yielding a value of Δ r = 0.079 +- 0.006 fm. The inelastic levels observed are the 1.97 (2+) and 4.18 MeV (3-) levels in 36Ar, and the 1.46 (2+), 2.52 (2+), 3.21 (2+), and 3.68 MeV (3-) levels in 40Ar. A Tassie model analysis was made of the inelastic transitions in the DWBA approximation and transition strengths of these levels were extracted

  2. Evaluation of on-line pyrolysis coupled to isotope ratio mass spectrometry for the determination of position-specific (13)C isotope composition of short chain n-alkanes (C6-C12).

    Science.gov (United States)

    Gilbert, Alexis; Yamada, Keita; Yoshida, Naohiro

    2016-06-01

    We measured (13)C intramolecular isotopic composition of commercially available short-chain hydrocarbons (n-C6-n-C12) using (13)C-NMR. Results show that the main variation is between the terminal and the sub-terminal C-atom positions. Site-preference (difference in δ(13)C values between terminal and sub-terminal C-atom positions) among all the samples varies between -12.2‰ and +8.4‰. Comparison of these results with those obtained using on-line pyrolysis coupled with GC-C-IRMS show that the thermal cracking of hydrocarbons occurs with a good isotopic fidelity between terminal and sub-terminal C-atom positions of the starting material and the related pyrolysis products (methane and ethylene). On-line pyrolysis coupled with GC-C-IRMS can thus be used for tracing hydrocarbons biogeochemical processes. PMID:27130103

  3. Efficient synthesis of D-branched-chain amino acids and their labeled compounds with stable isotopes using D-amino acid dehydrogenase.

    Science.gov (United States)

    Akita, Hironaga; Suzuki, Hirokazu; Doi, Katsumi; Ohshima, Toshihisa

    2014-02-01

    D-Branched-chain amino acids (D-BCAAs) such as D-leucine, D-isoleucine, and D-valine are known to be peptide antibiotic intermediates and to exhibit a variety of bioactivities. Consequently, much effort is going into achieving simple stereospecific synthesis of D-BCAAs, especially analogs labeled with stable isotopes. Up to now, however, no effective method has been reported. Here, we report the establishment of an efficient system for enantioselective synthesis of D-BCAAs and production of D-BCAAs labeled with stable isotopes. This system is based on two thermostable enzymes: D-amino acid dehydrogenase, catalyzing NADPH-dependent enantioselective amination of 2-oxo acids to produce the corresponding D-amino acids, and glucose dehydrogenase, catalyzing NADPH regeneration from NADP(+) and D-glucose. After incubation with the enzymes for 2 h at 65°C and pH 10.5, 2-oxo-4-methylvaleric acid was converted to D-leucine with an excellent yield (>99 %) and optical purity (>99 %). Using this system, we produced five different D-BCAAs labeled with stable isotopes: D-[1-(13)C,(15)N]leucine, D-[1-(13)C]leucine, D-[(15)N]leucine, D-[(15)N]isoleucine, and D-[(15)N]valine. The structure of each labeled D-amino acid was confirmed using time-of-flight mass spectrometry and nuclear magnetic resonance analysis. These analyses confirmed that the developed system was highly useful for production of D-BCAAs labeled with stable isotopes, making this the first reported enzymatic production of D-BCAAs labeled with stable isotopes. Our findings facilitate tracer studies investigating D-BCAAs and their derivatives. PMID:23661083

  4. Asynchronous evolution of the isotopic composition and amount of precipitation in north China during the Holocene revealed by a record of compound-specific carbon and hydrogen isotopes of long-chain n-alkanes from an alpine lake

    Science.gov (United States)

    Rao, Zhiguo; Jia, Guodong; Li, Yunxia; Chen, Jianhui; Xu, Qinghai; Chen, Fahu

    2016-07-01

    Both the timing of the maximum East Asian summer monsoon (EASM) intensity in monsoonal China and the environmental significance of the Chinese stalagmite oxygen isotopic record (δ18O) have been debated. Here, we present a ca. 120-year-resolution compound-specific carbon (δ13C) and hydrogen (δD) isotopes of terrestrial long-chain n-alkanes extracted from a well-dated sediment core from an alpine lake in north China. Our δ13C data, together with previously reported pollen data from a parallel core, demonstrate a humid mid-Holocene from ca. 8-5 ka BP. Assuming that the climatic humidity of north China is an indicator of the EASM intensity, then the maximum EASM intensity occurred in the mid-Holocene. Our δD data reveal a similar long-term trend to the δ18O record from nearby Lianhua Cave, indicating that the synchronous δD and δ18O records faithfully record the δD and δ18O of precipitation, respectively. The most negative δD and δ18O values occur in the early-mid Holocene, from ca. 11-5 ka BP. This contrast in the timing of isotopic variations demonstrates a complex relationship between the isotopic composition of precipitation and precipitation amount, or EASM intensity. Further comparisons indicate a possible linkage between the precipitation amount in north China and the west-east thermal gradient in the equatorial Pacific. In addition, the temperature of the moisture source area may play an important role in determining the isotopic composition of precipitation in monsoonal China.

  5. Ar-40/Ar-39 laser-probe dating of diamond inclusions from the Premier kimberlite

    Science.gov (United States)

    Phillips, D.; Onstott, T. C.; Harris, J. W.

    1989-01-01

    The results of Ar-40/Ar-39 laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds are reported which yield a mean age of 1198 + or - 14 Myr. This age agrees well with Sm-Nd and Ar-40/Ar-39 analyses on similar Premier inclusions and is indistinguishable from the inferred time of emplacement of the host kimberlite, which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated nonradiogenic Ar-40/Ar-36 ratio of 334 + or - 102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source. Preentrapment equilibration of the inclusions with an Ar-36-rich fluid is the most probable explanation for the low nonradiogenic composition.

  6. An isotope-labeled chemical derivatization method for the quantitation of short-chain fatty acids in human feces by liquid chromatography–tandem mass spectrometry

    International Nuclear Information System (INIS)

    Highlights: • 3-Nitrophenylhydrazine was used to derivatize short-chain fatty acids (SCFAs) for LC-MS/MS. • 13C6 analogues were produced for use as isotope-labeled internal standards. • Isotope-labeled standards compensate for ESI matrix effects in LC-MS/MS. • Femtomolar sensitivities and 93–108% quantitation accuracy were achieved for human fecal SCFAs. - Abstract: Short-chain fatty acids (SCFAs) are produced by anaerobic gut microbiota in the large bowel. Qualitative and quantitative measurements of SCFAs in the intestinal tract and the fecal samples are important to understand the complex interplay between diet, gut microbiota and host metabolism homeostasis. To develop a new LC-MS/MS method for sensitive and reliable analysis of SCFAs in human fecal samples, 3-nitrophenylhydrazine (3NPH) was employed for pre-analytical derivatization to convert ten C2–C6 SCFAs to their 3-nitrophenylhydrazones under a single set of optimized reaction conditions and without the need of reaction quenching. The derivatives showed excellent in-solution chemical stability. They were separated on a reversed-phase C18 column and quantitated by negative-ion electrospray ionization – multiple-reaction monitoring (MRM)/MS. To achieve accurate quantitation, the stable isotope-labeled versions of the derivatives were synthesized in a single reaction vessel from 13C6-3NPH, and were used as internal standard to compensate for the matrix effects in ESI. Method validation showed on-column limits of detection and quantitation over the range from low to high femtomoles for the ten SCFAs, and the intra-day and inter-day precision for determination of nine of the ten SCFAs in human fecal samples was ≤8.8% (n = 6). The quantitation accuracy ranged from 93.1% to 108.4% (CVs ≤ 4.6%, n = 6). This method was used to determine the SCFA concentrations and compositions in six human fecal samples. One of the six samples, which was collected from a clinically diagnosed type 2 diabetes

  7. An isotope-labeled chemical derivatization method for the quantitation of short-chain fatty acids in human feces by liquid chromatography–tandem mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Han, Jun; Lin, Karen; Sequeira, Carita [University of Victoria – Genome BC Proteomics Centre, University of Victoria, Vancouver Island Technology Park, 3101–4464 Markham Street, Victoria, BC V8Z 7X8 (Canada); Borchers, Christoph H., E-mail: christoph@proteincentre.com [University of Victoria – Genome BC Proteomics Centre, University of Victoria, Vancouver Island Technology Park, 3101–4464 Markham Street, Victoria, BC V8Z 7X8 (Canada); Department of Biochemistry and Microbiology, University of Victoria, Petch Building Room 207, 3800 Finnerty Road, Victoria, BC V8P 5C2 (Canada)

    2015-01-07

    Highlights: • 3-Nitrophenylhydrazine was used to derivatize short-chain fatty acids (SCFAs) for LC-MS/MS. • {sup 13}C{sub 6} analogues were produced for use as isotope-labeled internal standards. • Isotope-labeled standards compensate for ESI matrix effects in LC-MS/MS. • Femtomolar sensitivities and 93–108% quantitation accuracy were achieved for human fecal SCFAs. - Abstract: Short-chain fatty acids (SCFAs) are produced by anaerobic gut microbiota in the large bowel. Qualitative and quantitative measurements of SCFAs in the intestinal tract and the fecal samples are important to understand the complex interplay between diet, gut microbiota and host metabolism homeostasis. To develop a new LC-MS/MS method for sensitive and reliable analysis of SCFAs in human fecal samples, 3-nitrophenylhydrazine (3NPH) was employed for pre-analytical derivatization to convert ten C{sub 2}–C{sub 6} SCFAs to their 3-nitrophenylhydrazones under a single set of optimized reaction conditions and without the need of reaction quenching. The derivatives showed excellent in-solution chemical stability. They were separated on a reversed-phase C{sub 18} column and quantitated by negative-ion electrospray ionization – multiple-reaction monitoring (MRM)/MS. To achieve accurate quantitation, the stable isotope-labeled versions of the derivatives were synthesized in a single reaction vessel from {sup 13}C{sub 6}-3NPH, and were used as internal standard to compensate for the matrix effects in ESI. Method validation showed on-column limits of detection and quantitation over the range from low to high femtomoles for the ten SCFAs, and the intra-day and inter-day precision for determination of nine of the ten SCFAs in human fecal samples was ≤8.8% (n = 6). The quantitation accuracy ranged from 93.1% to 108.4% (CVs ≤ 4.6%, n = 6). This method was used to determine the SCFA concentrations and compositions in six human fecal samples. One of the six samples, which was collected from a

  8. Compound-specific carbon isotope compositions of individual long-chain n-alkanes in severe Asian dust episodes in the North China coast in 2002

    Institute of Scientific and Technical Information of China (English)

    GUO Zhigang; LI Juyuan; FENG Jialiang; FANG Ming; YANG Zuosheng

    2006-01-01

    The molecular compositions and compound-specific carbon isotope compositions of individual long-chain n-alkanes of atmospheric aerosols collected during two severe Asian dust episodes in Qingdao in spring of 2002 were analyzed using gas chromatography/mass spectrometry (GC/MS) and gas chromatography/isotope ratio mass spectrometry (GC/IRMS). Typical plant wax n-alkanes (C29 and C31) had lowerδ13C values than those from anthropogenic (engine exhaust) sources (C21―C23). The average δ13C value of plant wax n-alkane C29 in non-dust episode periods was -30.5‰ (-30.3‰― -31.9‰), while -31.3‰ (-31.1‰―-31.5‰) in dust episode periods; for C31, it was -31.4‰ (-31.1‰―-33.0‰) in non-dust episode periods, and -31.7‰ (-31.3‰―-32.6‰) in dust episode periods. Plant wax in the dust episode samples was mainly from herbaceous plants via long-range transport, while local plant wax was mainly from deciduous plants and woody plants. In North China coast, 83.3% of the plant wax in the severe dust episode samples was from C3 plants while 80.0% for the non-dust samples, indicating that plant wax transported to the northwestern Pacific Ocean by airborne dust from East Asia was mainly from C3 plants. The results suggest that the molecular and molecular-isotopic compositions of individual long-chain n-alkanes can, as an effective indicator, identify the terrestrial organic components in the dust from East Asia and sediments in the northwest Pacific Ocean.

  9. Geogenic lead isotope signatures from meat products in Great Britain: Potential for use in food authentication and supply chain traceability.

    Science.gov (United States)

    Evans, Jane A; Pashley, Vanessa; Richards, Gemma J; Brereton, Nicola; Knowles, Toby G

    2015-12-15

    This paper presents lead (Pb) isotope data from samples of farm livestock raised in three areas of Britain that have elevated natural Pb levels: Central Wales, the Mendips and the Derbyshire Peak District. This study highlights three important observations; that the Pb found in modern British meat from these three areas is geogenic and shows no clear evidence of modern tetraethyl anthropogenic Pb contribution; that the generally excellent match between the biological samples and the ore field data, particularly for the Mendip and Welsh data, suggests that this technique might be used to provenance biological products to specific ore sites, under favourable conditions; and that modern systems reflect the same process of biosphere averaging that is analogous to cultural focusing in human archaeological studies that is the process of biological averaging leading to an homogenised isotope signature with increasing Pb concentration. PMID:26282777

  10. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharge

    Directory of Open Access Journals (Sweden)

    Euclides Alexandre Bernardelli

    2011-12-01

    Full Text Available Stearic acid (CH3(CH216COOH was treated with Ar and Ar-O2 (10% pulsed DC discharges created by a cathode-anode confined system to elucidate the role of oxygen in plasma cleaning. The treatment time (5 to 120 minutes and plasma gas mixture (Ar and Ar-O2 were varied, and the results showed that the mass variation of stearic acid after Ar-O2 plasma exposure was greater than that of pure Ar plasma treatment. Thus, compared to Ar*, active oxygen species (O and O2, in all states enhance the etching process, regardless of their concentration. During the treatments, a liquid phase developed at the melting temperature of stearic acid, and differential thermal analyses showed that the formation of a liquid phase was associated with the breakage of bonds due to treatment with an Ar or Ar-O2 plasma. After treatment with Ar and Ar-O2 plasmas, the sample surface was significantly modified, especially when Ar-O2 was utilized. The role of oxygen in the treatment process is to break carbonaceous chains by forming oxidized products and/or to act as a barrier again ramification, which accelerates the etching of stearic acid.

  11. 40Ar/39Ar laser-probe dating of diamond inclusions from the Premier kimberlite

    International Nuclear Information System (INIS)

    Inclusions encapsulated by diamonds at the time of their formation provide a means for determining diamond crystallization ages and the chemistry of the surrounding upper mantle at that time. Sm-Nd studies of peridotitic inclusions, from Cretaceous-age kimberlites in southern Africa, suggest that the diamonds formed 3.3 Gyr ago. By contrast, eclogite-suite inclusions generally yield younger ages, sometimes approaching the time of kimberlite eruption. Here we report the results of 40Ar/39Ar laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds, which yield a mean age of 1,198±14 Myr. This age agrees well with Sm-Nd and 40Ar/39Ar analyses on similar Premier inclusions, and is indistinguishable from the inferred time of emplacement of the host kimberlite (1,150-1,230 Myr), which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated non-radiogenic 40Ar/36Ar ratio of 334±102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source (40Ar/36Ar>20,000). Pre-entrapment equilibration of the inclusions with an 36Ar-rich fluid is the most probable explanation for the low non-radiogenic (40Ar/36Ar) composition. (author)

  12. Chain-Length Distribution and Hydrogen Isotopic Fraction of n-alkyl Lipids in Aquatic and Terrestrial Plants: Implications for Paleoclimate Reconstructions

    Science.gov (United States)

    Gao, L.; Littlejohn, S.; Hou, J.; Toney, J.; Huang, Y.

    2008-12-01

    Recent studies demonstrate that in lacustrine sediments, aquatic plant lipids (e.g., C22-fatty acid) record lake water D/H ratio variation, while long-chain fatty acids (C26-C32, major components of terrestrial plant leaf waxes), record D/H ratios of precipitation (especially in arid regions). However, there are insufficient literature data for the distribution and hydrogen isotopic fractionation of n-alkyl lipids in aquatic and terrestrial plants. In this study, we determined the chain-length distributions and D/H ratios of n-alkyl lipids from 17 aquatic plant species (9 emergent, 4 floating and 4 submerge species) and 13 terrestrial plant species (7 grasses and 6 trees) from Blood Pond, Massachusetts. Our results are consistent with previous studies and provide a solid basis for the paleoclimatic reconstruction using D/H ratios of aquatic and terrestrial plant biomarkers. In addition, systematic hydrogen isotopic analyses on leaf waxes, leaf, stem and soil waters from trees and grasses significantly advance our understanding of our previously observed large D/H ratio difference between tree and grass leaf waxes. Our data indicate that the observed difference is not due to differences in leaf water D/H ratios. In comparison with grasses, trees use greater proportion of D-enriched residual or stored carbohydrates (as opposed to current photosynthetic carbohydrates) for leaf wax biosynthesis, resulting in higher leaf wax D/H ratios. The residual carbohydrates are enriched in deuterium because of the preferential consumption of light-hydrogen substrates during plant metabolism.

  13. Laser spectroscopic studies along the Al isotopic chain and the isomer-shift of the self-conjugate 26Al nucleus

    CERN Multimedia

    We propose to measure the isomer shift in the self-conjugate $^{26}$Al ($\\textit{N = Z}$ = 13) nucleus along with the isotope shifts of $^{24-33}$Al using bunched-beam collinear laser spectroscopy at the COLLAPS beam line at ISOLDE. These isomer and isotope shifts allow the extraction of precise mean-square charge radii, in particular the dierence in charge radius between the $\\textit{I}$ = 5$^{+}$; $\\textit{T}$ = 0 ground state and $\\textit{I}$= 0$^{+}$;$\\textit{T}$= 1 isomer in $^{26}$Al. This charge radius dierence, in comparison with the odd-even staggering in the Al-chain, is an excellent probe to study proton-neutron pairing correlations, as was previously illustrated for $\\overset{38}{19}$K$_{19}$ [1]. Furthermore, accurate knowledge of the mean-square charge radius in $^{26m}$Al is essential to reliably calculate its isospin-symmetry breaking correction which is important to extract the CKM matrix element V$_{ud}$ from the 0$^{+}$ $\\rightarrow$ 0$^{+}$ superallowed $\\beta$-decay data. Finally, the ch...

  14. Decay properties of 68,69,70Mn: Probing collectivity up to N = 44 in Fe isotopic chain

    Science.gov (United States)

    Benzoni, G.; Morales, A. I.; Watanabe, H.; Nishimura, S.; Coraggio, L.; Itaco, N.; Gargano, A.; Browne, F.; Daido, R.; Doornenbal, P.; Fang, Y.; Lorusso, G.; Patel, Z.; Rice, S.; Sinclair, L.; Söderström, P.-A.; Sumikama, T.; Wu, J.; Xu, Z. Y.; Yokoyama, R.; Baba, H.; Avigo, R.; Bello Garrote, F. L.; Blasi, N.; Bracco, A.; Camera, F.; Ceruti, S.; Crespi, F. C. L.; de Angelis, G.; Delattre, M.-C.; Dombradi, Zs.; Gottardo, A.; Isobe, T.; Kuti, I.; Matsui, K.; Melon, B.; Mengoni, D.; Miyazaki, T.; Modamio-Hoybjor, V.; Momiyama, S.; Napoli, D. R.; Niikura, M.; Orlandi, R.; Sakurai, H.; Sahin, E.; Sohler, D.; Taniuchi, R.; Taprogge, J.; Vajta, Zs.; Valiente-Dobón, J. J.; Wieland, O.; Yalcinkaya, M.

    2015-12-01

    The β decays 68Mn →68Fe, 69Mn →69Fe and 70Mn →70Fe have been measured at the RIBF facility at RIKEN using the EURICA γ spectrometer combined with an active stopper consisting of a stack of Si detectors. The nuclei were produced as fission fragments from a beam of 238U at a bombarding energy of 345 MeV/nucleon impinging on a Be target and selected using the BigRIPS separator. Half-lives and β-delayed neutron emission probabilities have been extracted for these decays, together with first experimental information on excited states populated in 69,70Fe. The data indicate a continuously increasing deformation for Fe isotopes up to A = 70. This is interpreted, as for Cr isotopes, in terms of the interplay between the quadrupole correlations of the ν 1d5/2 and ν 0g9/2 orbitals and the monopole component of the π 0f7/2- ν 0f5/2 interaction.

  15. Decay properties of 68,69,70Mn: Probing collectivity up to N=44 in Fe isotopic chain

    Directory of Open Access Journals (Sweden)

    G. Benzoni

    2015-12-01

    Full Text Available The β decays Mn68→Fe68, Mn69→Fe69 and Mn70→Fe70 have been measured at the RIBF facility at RIKEN using the EURICA γ spectrometer combined with an active stopper consisting of a stack of Si detectors. The nuclei were produced as fission fragments from a beam of 238U at a bombarding energy of 345 MeV/nucleon impinging on a Be target and selected using the BigRIPS separator. Half-lives and β-delayed neutron emission probabilities have been extracted for these decays, together with first experimental information on excited states populated in 69,70Fe. The data indicate a continuously increasing deformation for Fe isotopes up to A=70. This is interpreted, as for Cr isotopes, in terms of the interplay between the quadrupole correlations of the ν1d5/2 and ν0g9/2 orbitals and the monopole component of the π0f7/2–ν0f5/2 interaction.

  16. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    International Nuclear Information System (INIS)

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  17. Proton scattering from unstable nuclei 20O, 30S, 34Ar: experimental study and models

    International Nuclear Information System (INIS)

    Elastic and inelastic proton scattering from the unstable nuclei 20O, 30S and 34Ar were measured in inverse kinematics at the Grand Accelerateur National d'Ions Lourds. Secondary beams of 20O at 43 MeV/A, 30S at 53 MeV/A and 34Ar at 47 MeV/A impinged on a (CH2)n target. Recoiling protons were detected in the silicon strip array MUST. Energies and angular distributions of the first 2+ and 3- states were measured. A phenomenological analysis yields values of the deformation parameters β2 and β3 of 0.55 (6) and 0.35 (5) for 20O, 0.32 (3) and 0.22 (4) for 30S, 0.27 (2) and 0.39 (3) for 34Ar, respectively, and allows the extraction of the ratio of neutron to proton transition matrix elements (Mn/Mp)/(N/Z) for 2+ states: 2.35 (37) for 20O, 0.93 (20) for 30S and 1.35 (28) for 34Ar. Therefore the proton rich nuclei 30S and 34Ar show a 2+ excitation of isoscalar character whereas the excitation of 20O is of isovector character. In order to perform a microscopic analysis of the data, we have developed a QRPA model, using three Skyrme interaction: SIII, SG2, SLy4. This model reproduces measured B(EL) values for the oxygen, sulfur and argon isotopic chains, whereas RPA calculations, which do not take pairing into account, underestimate these values. In the case of the QRPA model the energies of the first 2+ state are overestimated by about 1 MeV, but the evolution along the isotopic chains is well reproduced. (Mn/Mp)/(N/Z) ratios for the first 2+ state deduced from the microscopic analysis using QRPA are 1.98 for 20O, 1.05 for 30S and 1.00 for 34Ar, in agreement with the conclusions of the phenomenological analysis. However important discrepancies are observed between the two types of analysis for other isotopes, in particular neutron rich argon and sulfur nuclei. (author)

  18. Eruption age of an approximately 100,000-year-old basalt from Ar-40/Ar-39 analysis of partially degassed xenoliths

    Science.gov (United States)

    Gillespie, A. R.; Huneke, J. C.; Wasserburg, G. J.

    1984-01-01

    Eleven samples from five partially degassed Mesozoic granitic xenoliths and two late Pleistocene host basalt samples from Sawmill Canyon in Sierra Nevada, California, have been analyzed using stepwise Ar-40/Ar-39 dating techniques. The petrography and analytic techniques are described and the results are presented. Isotopic compositions of Ar released from the xenoliths in several extraction steps at temperatures below about 900 C were colinear in Ar-36/Ar-40 versus Ar-39/Ar-40 diagrams and defined isochrons, giving a mean age of degassing of 119,000 + or - 7000 yr. Ar-40 extracted at higher temperatures included ancient radiogenic Ar-40 that never diffused from the xenoliths during immersion in the magma. This Ar-40 caused an increase in the apparent age for the high-temperature extractions. The high precision of the eruption age determined by this method is comparable to that obtained elsewhere by conventional K/Ar dating of sanidine.

  19. ``Smoking From The Same Pipe": Developement of an 40Ar/39Ar Datting Intercalibration PIpette System (Invited)

    Science.gov (United States)

    Turrin, B. D.; Swisher, C. C.; Deino, A.; Hemming, S. R.; Hodges, K.; Renne, P. R.

    2010-12-01

    The precision and accuracy of Ar isotope ratio measurements is one of the main limiting factors in the uncertainties of an 40Ar/39Ar age. Currently, it is relatively common to measure Ar isotopic ratios to a precision of 1-2‰ or better on an intralaboratory basis. This level of analytical precision equates to a comparable level of precision (1-3‰) in the calculated age, depending on the extent of atmospheric Ar contamination, importance of nucleogenic interference corrections, and other factors. However, it has become clear that improving the precision of mass spectrometry is not the only bottleneck towards improving the accuracy and precision of 40Ar/39Ar dating in general. Rather, the most urgent issue is interlaboratory reproducibility. This became obvious in a recent EARTHTIME initiative undertaken to intercalibrate two commonly used 40Ar/39Ar standards [the Fish Canyon sanidine (FCs) and the Alder Creek sanidine (ACs)]. This effort revealed variations amongst laboratories (at the 1-2% level), an order of magnitude greater than the internal analytical precisions. To address these issues, we have proposed (to NSF) to construct two identical pipette systems loaded to identical starting pressures and with identical isotopic compositions. One pipette system will travel between participating 40Ar/39Ar labs and the second system will not travel and serve as the “Master” system to test for any fractionation or undocumented depletion of the traveling pipette system. In order to ensure delivery of uniform amounts of homogenous gas, the pipette system will be computer-controlled with preprogrammed routines and lockouts to prevent compromising the reservoirs. The pipette systems will deliver three gas samples with different isotopic ratios at two different pressures/concentrations. One pipette bulb will be of atmospheric isotopic composition, and the other two pipette bulbs will have 40Ar*/39ArK ratios corresponding to co-irradiated ACs and FCs fixed by their

  20. Paleomagnetic and 40Ar/39Ar geochronologic data from late Proterozoic mafic dikes and sills, Montana and Wyoming

    Science.gov (United States)

    Harlan, Stephen S.; Geissman, John William; Snee, Lawrence W.

    1997-01-01

    Paleomagnetic and 40Ar/39Ar results from mafic dikes and sills in northwestern Wyoming and western Montana yield similar virtual geomagnetic poles and isotopic dates. In combination with paleomagnetic and geochronologic data from elsewhere in the western Cordillera, these data provide evidence for a regional mafic magnetic event at 780 to 770 Ma that affected a large area of western North America.

  1. Contributions to the 37Ar background by research reactor operations

    International Nuclear Information System (INIS)

    Radioargon has been identified as a useful nuclide for verifying compliance with the Comprehensive Nuclear-Test-Ban Treaty. Use of 37Ar to identify a nuclear explosion requires quantification of contributions to the 37Ar background at a potential measurement site. A method of estimating 37Ar release activities using isotopes of radioxenon and radioargon has been developed in this paper. Numerical solutions to the system of equations describing air-activation in a reactor were used to determine ratios of release activities for 135Xe/133Xe, 133mXe/131mXe, and 37Ar /41Ar as function of irradiation time and off-gas residence time prior to measurement and release. Published radioactive noble gas effluent data for the High Flux Isotope Reactor, HFIR (ORNL) from the year 1996 to 2010 were compiled as a test data set to predict the 37Ar release on a yearly basis. An average 37Ar release rate of 1.86 x 1010 Bq per year was calculated. The estimated release rate was used as a source term for atmospheric transport to run a test case for 37Ar release over a typical HFIR operation cycle. Results showed that ground-level concentrations of 37Ar did not exceed the minimum detectable concentration for a 37Ar field measurement system beyond the immediate vicinity of the release point. (author)

  2. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    Institute of Scientific and Technical Information of China (English)

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  3. Vaporization of the Ar+Ni system

    International Nuclear Information System (INIS)

    Using the 4π multidetector INDRA, collisions between 36Ar and 58Ni have been investigated over a broad bombarding energy range, from 32 to 95 AMeV. The onset for complete vaporization of the system into neutrons, H and He isotopes as well as the evolution with energy of the isotopic composition of the vaporization events were determined. Binary dissipative collisions are found to be the dominant mechanism producing the vaporization events. A statistical sequential decay of the two partners is a possible explanation for the vaporization events observed. (author) 18 refs.; 3 figs

  4. Proton scattering from unstable nuclei {sup 20}O, {sup 30}S, {sup 34}Ar: experimental study and models; Diffusion de protons sur les noyaux instables {sup 20}O, {sup 30}S, {sup 34}Ar: etude experimentale et developpement de modeles

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Elias [Institut de Physique Nucleaire, CNRS - IN2P3, Universite Paris - Sud, 91406 Orsay Cedex (France)

    2000-01-28

    Elastic and inelastic proton scattering from the unstable nuclei {sup 20}O, {sup 30}S and {sup 34}Ar were measured in inverse kinematics at the Grand Accelerateur National d'Ions Lourds. Secondary beams of {sup 20}O at 43 MeV/A, {sup 30}S at 53 MeV/A and {sup 34}Ar at 47 MeV/A impinged on a (CH{sub 2}){sub n} target. Recoiling protons were detected in the silicon strip array MUST. Energies and angular distributions of the first 2{sup +} and 3{sup -} states were measured. A phenomenological analysis yields values of the deformation parameters {beta}{sub 2} and {beta}{sub 3} of 0.55 (6) and 0.35 (5) for {sup 20}O, 0.32 (3) and 0.22 (4) for {sup 30}S, 0.27 (2) and 0.39 (3) for {sup 34}Ar, respectively, and allows the extraction of the ratio of neutron to proton transition matrix elements (M{sub n}/M{sub p})/(N/Z) for 2{sup +} states: 2.35 (37) for {sup 20}O, 0.93 (20) for {sup 30}S and 1.35 (28) for {sup 34}Ar. Therefore the proton rich nuclei {sup 30}S and {sup 34}Ar show a 2{sup +} excitation of isoscalar character whereas the excitation of {sup 20}O is of isovector character. In order to perform a microscopic analysis of the data, we have developed a QRPA model, using three Skyrme interaction: SIII, SG2, SLy4. This model reproduces measured B(EL) values for the oxygen, sulfur and argon isotopic chains, whereas RPA calculations, which do not take pairing into account, underestimate these values. In the case of the QRPA model the energies of the first 2{sup +} state are overestimated by about 1 MeV, but the evolution along the isotopic chains is well reproduced. (M{sub n}/M{sub p})/(N/Z) ratios for the first 2{sup +} state deduced from the microscopic analysis using QRPA are 1.98 for {sup 20}O, 1.05 for {sup 30}S and 1.00 for {sup 34}Ar, in agreement with the conclusions of the phenomenological analysis. However important discrepancies are observed between the two types of analysis for other isotopes, in particular neutron rich argon and sulfur nuclei. (author)

  5. Variation in the terrestrial isotopic composition and atomic weight of argon

    Science.gov (United States)

    Böhlke, John Karl

    2014-01-01

    The isotopic composition and atomic weight of argon (Ar) are variable in terrestrial materials. Those variations are a source of uncertainty in the assignment of standard properties for Ar, but they provide useful information in many areas of science. Variations in the stable isotopic composition and atomic weight of Ar are caused by several different processes, including (1) isotope production from other elements by radioactive decay (radiogenic isotopes) or other nuclear transformations (e.g., nucleogenic isotopes), and (2) isotopic fractionation by physical-chemical processes such as diffusion or phase equilibria. Physical-chemical processes cause correlated mass-dependent variations in the Ar isotope-amount ratios (40Ar/36Ar, 38Ar/36Ar), whereas nuclear transformation processes cause non-mass-dependent variations. While atmospheric Ar can serve as an abundant and homogeneous isotopic reference, deviations from the atmospheric isotopic ratios in other Ar occurrences limit the precision with which a standard atomic weight can be given for Ar. Published data indicate variation of Ar atomic weights in normal terrestrial materials between about 39.7931 and 39.9624. The upper bound of this interval is given by the atomic mass of 40Ar, as some samples contain almost pure radiogenic 40Ar. The lower bound is derived from analyses of pitchblende (uranium mineral) containing large amounts of nucleogenic 36Ar and 38Ar. Within this interval, measurements of different isotope ratios (40Ar/36Ar or 38Ar/36Ar) at various levels of precision are widely used for studies in geochronology, water–rock interaction, atmospheric evolution, and other fields.

  6. 40Ar/39Ar and cosmic ray exposure ages of plagioclase-rich lithic fragments from Apollo 17 regolith, 78461

    Science.gov (United States)

    Das, J. P.; Baldwin, S. L.; Delano, J. W.

    2016-01-01

    Argon isotopic data is used to assess the potential of low-mass samples collected by sample return missions on planetary objects (e.g., Moon, Mars, asteroids), to reveal planetary surface processes. We report the first 40Ar/39Ar ages and 38Ar cosmic ray exposure (CRE) ages, determined for eleven submillimeter-sized (ranging from 0.06 to 1.2 mg) plagioclase-rich lithic fragments from Apollo 17 regolith sample 78461 collected at the base of the Sculptured Hills. Total fusion analysis was used to outgas argon from the lithic fragments. Three different approaches were used to determine 40Ar/39Ar ages and illustrate the sensitivity of age determination to the choice of trapped (40Ar/36Ar)t. 40Ar/39Ar ages range from ~4.0 to 4.4 Ga with one exception (Plag#10). Surface CRE ages, based on 38Ar, range from ~1 to 24 Ma. The relatively young CRE ages suggest recent re-working of the upper few centimeters of the regolith. The CRE ages may result from the effect of downslope movement of materials to the base of the Sculptured Hills from higher elevations. The apparent 40Ar/39Ar age for Plag#10 is >5 Ga and yielded the oldest CRE age (i.e., ~24 Ma). We interpret this data to indicate the presence of parentless 40Ar in Plag#10, originating in the lunar atmosphere and implanted in lunar regolith by solar wind. Based on a chemical mixing model, plagioclase compositions, and 40Ar/39Ar ages, we conclude that lithic fragments originated from Mg-suite of highland rocks, and none were derived from the mare region.

  7. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    International Nuclear Information System (INIS)

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  8. Applications of 37Ar, 39Ar and 85Kr in hydrology, oceanography and atmospheric studies. Current state of the art

    International Nuclear Information System (INIS)

    Knowledge of the atmospheric concentrations of 37Ar, 39Ar and 85Kr is required to apply these isotopes in hydrology and oceanography; these concentrations are reported on in the paper. It is demonstrated in a general way, and for specific examples, how 39Ar and 85Kr results can be used for groundwater dating. The combination of these isotope results with 3H and 14C data is discussed. Subsurface production of 39Ar may limit its application in dating, but could yield information about underground processes, particularly if the results are combined with other isotope data such as 37Ar and 222Rn. Argon-39 is applied in oceanography as a steady state tracer and allows valuable conclusions to be reached on the formation and ventilation rates of deep ocean water. Examples from the deep North Atlantic and for a depth profile in the Pacific illustrate how conclusions on the mixing, ageing and flow rates can be drawn from 39Ar results. The origin of measured 37Ar activity values in tropospheric air is described, and selected time series are used to discuss atmospheric circulation processes. (author). 12 refs, 6 figs, 2 tabs

  9. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    International Nuclear Information System (INIS)

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  10. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharges

    International Nuclear Information System (INIS)

    Stearic acid (C18H36O2) was treated into Ar and Ar-O2(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O2 plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O2 in all states) strongly enhance the etching process with regards to A* species, regardless of their concentration. After treatment by Ar and Ar-O2 plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O2 plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  11. 40Ar/39Ar-Dating of deformation of transform-shear stage in evolution of the Early Caledonides in Western Sangilen (South-Eastern Tuva)

    International Nuclear Information System (INIS)

    Detail structural-metamorphic and isotopic investigations into borders of the Muguro-Chinchilig tectonic block are conducted. 40Ar/39Ar-isotope dating was conducted by the graduated warming-up with biotite for different zones. Carried studies demonstrate that in the boundary of 465 million years intensive shift disturbances entailing fragmentation of the Muguro-Chinchilig tectonic block and disturbances in entirety of its separate parts in borders of the Sangilen plateau (South-Eastern Tuva) were stated

  12. 40Ar/39Ar dating of exceptional concentration of metals by weathering of Precambrian rocks at the Precambrian–Cambrian boundary

    DEFF Research Database (Denmark)

    Parnell, John; Mark, Darren F.; Frei, Robert; Fallick, Anthony E.; Ellam, Rob M.

    2014-01-01

    peneplanation. An 40Ar/39Ar age of 542.62 ± 0.38 Ma (1 sigma, full external precision, Renne et al., 2011) for metalliferous alteration clays in Scotland shows that this event occurred immediately prior to the Precambrian–Cambrian boundary. A negative δ53Cr isotopic signature for the clay is consistent with...

  13. Superdeformation of Ar hypernuclei

    Science.gov (United States)

    Isaka, Masahiro; Kimura, Masaaki; Hiyama, Emiko; Sagawa, Hiroyuki

    2015-10-01

    We investigate the differences in the Λ separation energies (S_Λ ) of the ground and superdeformed (SD) states in {}^{37}_Λ Ar, ^{39}_Λ Ar, and ^{41}_Λ Ar within the framework of antisymmetrized molecular dynamics (AMD). In this study, we find that the calculated S_Λ values in the SD states are much smaller than those in the ground states, unlike the result using the relativistic mean-field (RMF) calculation [B.-N. Lu et al., Phys. Rev. C, 89, 044307 (2014)]. One of the reasons for this difference between the present work and the RMF calculation is the difference in the density profile of the SD states in the core nuclei. We also find that the property of the Λ N odd-parity interaction affects the S_Λ trend between the ground and SD states.

  14. A new approach to cosmogenic corrections in 40Ar/39Ar chronometry: Implications for the ages of Martian meteorites

    Science.gov (United States)

    Cassata, W. S.; Borg, L. E.

    2016-08-01

    Anomalously old 40Ar/39Ar ages are commonly obtained from Shergottites and are generally attributed to uncertainties regarding the isotopic composition of the trapped component and/or the presence of excess 40Ar. Old ages can also be obtained if inaccurate corrections for cosmogenic 36Ar are applied. Current methods for making the cosmogenic correction require simplifying assumptions regarding the spatial homogeneity of target elements for cosmogenic production and the distribution of cosmogenic nuclides relative to trapped and reactor-derived Ar isotopes. To mitigate uncertainties arising from these assumptions, a new cosmogenic correction approach utilizing the exposure age determined on an un-irradiated aliquot and step-wise production rate estimates that account for spatial variations in Ca and K is described. Data obtained from NWA 4468 and an unofficial pairing of NWA 2975, which yield anomalously old ages when corrected for cosmogenic 36Ar using conventional techniques, are used to illustrate the efficacy of this new approach. For these samples, anomalous age determinations are rectified solely by the improved cosmogenic correction technique described herein. Ages of 188 ± 17 and 184 ± 17 Ma are obtained for NWA 4468 and NWA 2975, respectively, both of which are indistinguishable from ages obtained by other radioisotopic systems. For other Shergottites that have multiple trapped components, have experienced diffusive loss of Ar, or contain excess Ar, more accurate cosmogenic corrections may aid in the interpretation of anomalous ages. The trapped 40Ar/36Ar ratios inferred from inverse isochron diagrams obtained from NWA 4468 and NWA 2975 are significantly lower than the Martian atmospheric value, and may represent upper mantle or crustal components.

  15. Combined U-Th/He and 40Ar/39Ar geochronology of post-shield lavas from the Mauna Kea and Kohala volcanoes, Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Aciego, S.M.; Jourdan, F.; DePaolo, D.J.; Kennedy, B.M.; Renne, P.R.; Sims, K.W.W.

    2009-10-01

    Late Quaternary, post-shield lavas from the Mauna Kea and Kohala volcanoes on the Big Island of Hawaii have been dated using the {sup 40}Ar/{sup 39}Ar and U-Th/He methods. The objective of the study is to compare the recently demonstrated U-Th/He age method, which uses basaltic olivine phenocrysts, with {sup 40}Ar/{sup 39}Ar ages measured on groundmass from the same samples. As a corollary, the age data also increase the precision of the chronology of volcanism on the Big Island. For the U-Th/He ages, U, Th and He concentrations and isotopes were measured to account for U-series disequilibrium and initial He. Single analyses U-Th/He ages for Hamakua lavas from Mauna Kea are 87 {+-} 40 ka to 119 {+-} 23 ka (2{sigma} uncertainties), which are in general equal to or younger than {sup 40}Ar/{sup 39}Ar ages. Basalt from the Polulu sequence on Kohala gives a U-Th/He age of 354 {+-} 54 ka and a {sup 40}Ar/{sup 39}Ar age of 450 {+-} 40 ka. All of the U-Th/He ages, and all but one spurious {sup 40}Ar/{sup 39}Ar ages conform to the previously proposed stratigraphy and published {sup 14}C and K-Ar ages. The ages also compare favorably to U-Th whole rock-olivine ages calculated from {sup 238}U - {sup 230}Th disequilibria. The U-Th/He and {sup 40}Ar/{sup 39}Ar results agree best where there is a relatively large amount of radiogenic {sup 40}Ar (>10%), and where the {sup 40}Ar/{sup 36}Ar intercept calculated from the Ar isochron diagram is close to the atmospheric value. In two cases, it is not clear why U-Th/He and {sup 40}Ar/{sup 39}Ar ages do not agree within uncertainty. U-Th/He and {sup 40}Ar/{sup 39}Ar results diverge the most on a low-K transitional tholeiitic basalt with abundant olivine. For the most alkalic basalts with negligible olivine phenocrysts, U-Th/He ages were unattainable while {sup 40}Ar/{sup 39}Ar results provide good precision even on ages as low as 19 {+-} 4 ka. Hence, the strengths and weaknesses of the U-Th/He and {sup 40}Ar/{sup 39}Ar methods are

  16. Possible algal origin of long chain odd n-alkanes in immature sediments as revealed by distributions and carbon isotope ratios

    OpenAIRE

    Lichtfouse, Eric; Derenne., Sylvie; Mariotti, André; Largeau, Claude

    1994-01-01

    A Pliocene oil shale (Pula, Hungary), a C3 plant Triticum aestivum and a C4 plant Zea mays were compared using isotopic composition of bulk organic matter, along with distributions and individual carbon isotope ratios of n-alkanes from organic extracts. The microalga Botryococcus braunii (A race) was thus shown to be the main source of the predominant 27, 29 and 31 n-alkanes of Pula sediment Therefore, the dominance of odd carbon-numbered n-alkanes in the range C25–35 in extracts from immatur...

  17. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Science.gov (United States)

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  18. ARS Biodiesel Research Initiatives

    Science.gov (United States)

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  19. ARS Culture Collection

    Science.gov (United States)

    The internationally recognized Agricultural Research Service (ARS) Culture Collection will be described to include the microorganisms maintained by the collection, preservation methods and worldwide distribution of cultures. The impact of the germplasm will be described to include discovery of the f...

  20. Equilibration of the N/Z collective degree in the deep inelastic interaction of 263 MeV 40Ar and 238U and several other similar systems

    International Nuclear Information System (INIS)

    Some recent data of isotopic distributions obtained in the bombardment of heavy targets by Ar and S projectiles are presented. A classical diffusion is shown to reproduce fairly well the first and the second moments of these isotopic distributions. (orig.)

  1. 40Ar/39Ar dating of the Late Cretaceous

    International Nuclear Information System (INIS)

    . Finally, using advances with terrestrial carbon isotope and planktonic foraminifera records within central Hokkaido, Northwest Pacific, sections from the Cretaceous Yezo group were correlated to that of European and North American counterparts. Datable ash layers throughout the Kotanbetsu and Shumarinai section were analysed using both 40Ar/39Ar and U-Pb methods. We successfully dated two ash tuff layers falling either side of the Turonian - Coniacian boundary, yielding an age range for the boundary between 89.31 ± 0.11 Ma and 89.57 ± 0.11 Ma or a boundary age of 89.44 ± 0.24 Ma. Combining these U-Pb ages with recent published ages we are able to reduce the age limit once more and propose an age for the Turonian - Coniacian boundary as 89.62 ± 0.04 Ma. (author)

  2. Ar-40/Ar-39 age constraints for the Jaramillo Normal Subchron and the Matuyama-Brunhes geomagnetic boundary

    Science.gov (United States)

    Izett, Glen A.; Obradovich, John D.

    1994-02-01

    Our mid-Pleistocene Ar-40/Ar-39 age recalibration of the geomagnetic polarity timescale is nearly in accord with the oxygen isotope, climate record calibration of the astronomical timescale proposed by Johnson (1982) and Shackleton et al. (1990). Ar-40/Ar-39 ages of a normally magnetized rhyolite dome in the Valles caldera, northern Mexico, yielded a weighted-mean age of 1.004 +/- 0.019 Ma. A K-Ar age of 0.909 +/- 0.019 Ma for this rock by Doell and Dalrymple (1966) was the linchpin for the recognition and calibration of the Jaramillo Normal Subchron (JNS). Other Ar-40/Ar-39 ages from the Valles caldera and Ar-40/Ar-39 ages of Ivory Coast tektites indicate that the JNS began at about 1.11 Ma and ended before 0.92 Ma, probably near 0.97 Ma. The Matuyama-Brunhes boundary occurred between 0.79 Ma and 0.76 Ma on the basis of Ar-40/Ar-39 sanidine ages from (1) three reversely magnetized rhyolite domes of the Valles caldera (0.793 +/- 0.018 Ma, 0.794 +/- 0.007 Ma, and 0.812 +/- 0.023 Ma) and pumice (0.789 +/- 0.006 Ma) from the reversely magnetized Oldest Toba Tuff of Sumatra and (2) pumice (0.764 +/- 0.005 Ma and 0.757 +/- 0.009 Ma) from the lower and upper units of the normally magnetized Bishop Tuff. The age of the boundary may be close to 0.77 Ma as deduced from rates of sedimentation in ancient Lake Bonneville, Utah.

  3. 39Ar measurements on samples extracted from ocean water. Final report

    International Nuclear Information System (INIS)

    The penetration into the ocean of disturbance at the atmosphere-ocean interface is studied by the analysis of transient tracers like bomb-produced 14C, 3H and anthropogenic 85Kr and freons, and of radioactive isotopes produced by cosmic radiation in the atmosphere, like pre-nuclear 14C and 39Ar. This paper discusses the use of 39Ar and gives examples of measurements of 39Ar taken in the Atlantic and Pacific Oceans

  4. Ars Electronica tulekul / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  5. ARABIC LIGHT STEMMER (ARS

    Directory of Open Access Journals (Sweden)

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  6. Nano-Mole Scale Side-Chain Signal Assignment by 1H-Detected Protein Solid-State NMR by Ultra-Fast Magic-Angle Spinning and Stereo-Array Isotope Labeling

    KAUST Repository

    Wang, Songlin

    2015-04-09

    We present a general approach in 1H-detected 13C solid-state NMR (SSNMR) for side-chain signal assignments of 10-50 nmol quantities of proteins using a combination of a high magnetic field, ultra-fast magic-angle spinning (MAS) at ~80 kHz, and stereo-array-isotope-labeled (SAIL) proteins [Kainosho M. et al., Nature 440, 52–57, 2006]. First, we demonstrate that 1H indirect detection improves the sensitivity and resolution of 13C SSNMR of SAIL proteins for side-chain assignments in the ultra-fast MAS condition. 1H-detected SSNMR was performed for micro-crystalline ubiquitin (~55 nmol or ~0.5mg) that was SAIL-labeled at seven isoleucine (Ile) residues. Sensitivity was dramatically improved by 1H-detected 2D 1H/13C SSNMR by factors of 5.4-9.7 and 2.1-5.0, respectively, over 13C-detected 2D 1H/13C SSNMR and 1D 13C CPMAS, demonstrating that 2D 1H-detected SSNMR offers not only additional resolution but also sensitivity advantage over 1D 13C detection for the first time. High 1H resolution for the SAIL-labeled side-chain residues offered reasonable resolution even in the 2D data. A 1H-detected 3D 13C/13C/1H experiment on SAIL-ubiquitin provided nearly complete 1H and 13C assignments for seven Ile residues only within ~2.5 h. The results demonstrate the feasibility of side-chain signal assignment in this approach for as little as 10 nmol of a protein sample within ~3 days. The approach is likely applicable to a variety of proteins of biological interest without any requirements of highly efficient protein expression systems.

  7. Dating of the Francevillian sedimentary series and mineralogic and isotopic (Sm, Nd, Rb, Sr, K, Ar, U, O and C) characterization of the gangue of the reactors 10 and 13. Preliminary report

    International Nuclear Information System (INIS)

    This paper summarizes the various ages reported for the diagenetic events in the Francevillian sedimentary series (Precambrian era) and the fission reactors of Oklo. Obviously, differences exist between the ages obtained on the silicate minerals and the ages obtained on the Uranium ores and on the reactors. Clay minerals which crystallized during the fission reactions yield younger ages than the reactors themselves. Similarly, the diagenetic clays (1870 Ma) show younger ages than the Uranium ores (2000 Ma). This is in contrast to mineralogical and field evidence indicating that Uranium mineralization occurred during diagenesis of the Francevillian sediments. These antithetical results give rise to several questions. Does the age obtained on the diagenetic clays date a late thermal event or does the age of the Uranium mineralization reflect a multistage U-Pb history. This work tries to bring answers with the help of new isotopic analysis and studies mineralogy of the gangue of reactors and isotopic compositions in Uranium ores. 8 refs., 4 figs

  8. Accurate and precise 40Ar/39Ar dating by high-resolution, multi-collection, mass spectrometry

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie

    -Instruments multi-collector Noblesse noble gas mass spectrometer configured with a faraday detector and three ion-counting electron multipliers. The instrument has the capability to measure several noble gas isotopes simultaneously and to change measurement configurations instantaneously by the use of QUAD lenses......New generation, high resolution, multi-collector noble gas mass spectrometers equipped with ion-counting electron multipliers provide opportunities for improved accuracy and precision in 40Ar/39Ar dating. Here we report analytical protocols and age cross-calibration studies using a NU...... (zoom optics). The Noblesse offer several advantages over previous generation noble gas mass spectrometers and is particularly suited for single crystal 40Ar/39Ar dating because of: (i) improved source sensitivity (ii) ion-counting electron multipliers, which have much lower signal to noise ratios than...

  9. Production yields of noble-gas isotopes from ISOLDE UC$_{x}$/graphite targets

    CERN Document Server

    Bergmann, U C; Catherall, R; Cederkäll, J; Diget, C A; Fraile-Prieto, L M; Franchoo, S; Fynbo, H O U; Gausemel, H; Georg, U; Giles, T; Hagebø, E; Jeppesen, H B; Jonsson, O C; Köster, U; Lettry, Jacques; Nilsson, T; Peräjärvi, K; Ravn, H L; Riisager, K; Weissman, L; Äystö, J

    2003-01-01

    Yields of He, Ne, Ar, Kr and Xe isotopic chains were measured from UC$_{x}$/graphite and ThC$_{x}$/graphite targets at the PSB-ISOLDE facility at CERN using isobaric selectivity achieved by the combination of a plasma-discharge ion source with a water-cooled transfer line. %The measured half-lives allowed %to calculate the decay losses of neutron-rich isotopes in the %target and ion-source system, and thus to obtain information on the in-target %productions from the measured yields. The delay times measured for a UC$_x$/graphite target allow for an extrapolation to the expected yields of very neutron-rich noble gas isotopes, in particular for the ``NuPECC reference elements'' Ar and Kr, at the next-generation radioactive ion-beam facility EURISOL. \\end{abstract} \\begin{keyword} % keywords here, in the form: keyword \\sep keyword radioactive ion beams \\sep release \\sep ion yields \\sep ISOL (Isotope Separation On-Line) \\sep uranium and thorium carbide targets. % PACS codes here, in the form: \\PACS code \\sep code...

  10. Spectroanalytical investigations on inductively coupled N2/Ar and Ar/Ar high frequency plasmas

    International Nuclear Information System (INIS)

    In order to improve the detection limits of trace elements in corrosion products of metallic materials, the inductively coupled plasma excitation source (ICP) was applied for spectroscopic analysis. Besides optimizing the working conditions for the mentioned materials, the fundamental research clearing the excitation processes in ICP was carried out. Basicly, two plasma systems were investigated: the nitrogen cooled N2/Ar- and pure Ar/Ar-plasma. The computed detection limits for 8 chosen elements are between 0.1 and 50 μg ml-1 in both plasmas. The advantage of ion lines was clearly present; in N2/Ar-plasma it was larger than in Ar/Ar-plasma. The excitation temperatures measured with help of ArI, FeI and ZnI lines rise with increasing power and decreasing distance from the induction coil. The distribution of Zn excitation temperature in N2/Ar-plasma as well as the measured N+2 rotational and CN vibrational temperatures indicate, that the toroidal structure of Ar/Ar-plasma is not analogue to the N2/Ar-plasma. The values of the various excitation temperatures (Ar, Fe, Zn) and the differences between the excitation, vibration, rotation and ionization temperatures (Tsub(i) > Tsub(n) = Tsub(vib) > Tsub(rot)) indicate an absence of thermal equilibrium in the concerned system. (orig.)

  11. Canada's medical isotope strategy

    International Nuclear Information System (INIS)

    This paper details Canada's medical isotope strategy and the role of the Canadian Government in the security of the isotope supply chain. The government's role is to promote health and safety of Canadians, establish appropriate regulatory framework, allow the markets to work, facilitate international collaboration, fund high-risk early stage research and development, encourage private sector investment in innovation and support and respect environmental and non-proliferation goals.

  12. A set of engineered Escherichia coli expression strains for selective isotope and reactivity labeling of amino acid side chains and flavin cofactors.

    Directory of Open Access Journals (Sweden)

    Jennifer Mehlhorn

    Full Text Available Biological reactions are facilitated by delicate molecular interactions between proteins, cofactors and substrates. To study and understand their dynamic interactions researchers have to take great care not to influence or distort the object of study. As a non-invasive alternative to a site-directed mutagenesis approach, selective isotope labeling in combination with vibrational spectroscopy may be employed to directly identify structural transitions in wild type proteins. Here we present a set of customized Escherichia coli expression strains, suitable for replacing both the flavin cofactor and/or selective amino acids with isotope enriched or chemically modified substrates. For flavin labeling we report optimized auxotrophic strains with significantly enhanced flavin uptake properties. Labeled protein biosynthesis using these strains was achieved in optimized cultivation procedures using high cell density fermentation. Finally, we demonstrate how this approach is used for a clear assignment of vibrational spectroscopic difference signals of apoprotein and cofactor of a flavin containing photoreceptor of the BLUF (Blue Light receptors Using FAD family.

  13. Origin of the Mile Tilek Tuff, South Andaman: evidence from 40Ar-39Ar chronology and geochemistry

    International Nuclear Information System (INIS)

    The Mile Tilek Tuff is one of several consolidated volcanic ash deposits in the Andaman and Nicobar Islands that has preserved evidence of a large-scale volcanic eruption in Southeast Asia. Assumed to be of Mio-Pliocene age (∼ 25-2 Ma), the tuff was thought to have been generated by the Andaman-Indonesia volcanic arc. Little was known about its source volcano because of absence of critical isotope data. To provide accurate age information and determine its source, we dated the tuff by 40Ar-39Ar method and measured its trace element contents and Sr-Nd isotopic ratios. The 40Ar-39Ar plateau age for the whole rock is 0.73 ± 0.16 (2σ) Ma, which suggests that the tuff got deposited much later than previously believed. Chemically, the tuff possesses typical characteristics of subduction zone magmatism. Its Sr-Nd isotopic compositions (87Sr/86Sr = 0.7073 and εNd ≤ 0.9) suggest substantial continental crustal contamination of its source magma, which points to a source volcano in Sumatra. Based on available age information on large-scale volcanic eruptions in Indonesia, we speculate that the Ranau volcano in south Sumatra could have been the source of the Mile Tilek Tuff. (author)

  14. Geochronology and thermochronology by the 40Ar/39Ar method

    International Nuclear Information System (INIS)

    This work is a response to the authors' belief that there is a need for a monograph on 40Ar/39Ar dating to provide concise knowledge concerning the application of this method to geological studies. They aim to provide a reasonably comprehensive but by no means exhaustive coverage of the principles and practices of 40Ar/39Ar dating, with emphasis on interpretation of results. In attempting to provide an overview of the current state of knowledge, they commonly cite examples from the available literature. They draw rather heavily upon their own work, because they feel comfortable with their own examples. (author)

  15. Biomagnification of organochlorine pollutants in farmed and wild gilthead sea bream (Sparus aurata) and stable isotope characterization of the trophic chains

    International Nuclear Information System (INIS)

    Organochlorine pollutants (pesticides and polychlorinated biphenyls) were analysed in farmed and wild gilthead sea bream (Sparus aurata) tissues (white muscle and liver) from the Western Mediterranean (Spain) and in their diets. Determination was carried out by gas chromatography coupled to tandem mass spectrometry after clean up of the fatty extracts by normal phase HPLC, with detection limits around 0.1 ng/g. Carbon and nitrogen stable isotope ratios were also determined in the samples. Organochlorine compounds concentration was found to be uniform throughout the year in farmed fish, in both white muscle and liver. In contrast, wild fish showed contamination profiles that reflect environmental factors and the biological cycle. Although biomagnification factors for white muscle and liver were found to be 2.4 and 3.0, respectively for farmed fish, and 0.15 and 0.54 for wild specimens, wild fish presented higher levels of organochlorine contaminants than farmed fish. Nitrogen stable isotopes determination in muscle from wild and farmed sea bream during the year gave us a profile related to the biological cycle. δ15N mean values from farmed fish were 2.0 per mille higher than from wild fish throughout the year that corresponding to close to one trophic step. δ13C values were stable during the year, and also more enriched in the case of farmed fish. The low levels of contaminants found in the feed supplied to farmed fish explain the organochlorine concentrations in their tissues which remain below wild fish, in spite of the intensive culture conditions and higher trophic level of cultured specimens

  16. Potential and opportunities for 40Ar-39Ar geochronology and thermochronology research in India. PD-3-4

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. For slowly cooled rocks, the K-Ar system yields ages that generally reflect the time elapsed since cooling below the closure temperature for argon of the mineral being analyzed and therefore becomes an extremely powerful tool for thermochronologic studies of orogenic systems. In recent years application of laser microprobe heating has enhanced the capabilities of this technique. Conventional 40Ar-39Ar step-heating experiments are designed to determine the bulk closure ages of aggregates of minerals like hornblende, muscovite, and biotite. The use of multidomain diffusion (MDD) modeling of K-feldspar developed by Lovera et al.,1989, has today become a very powerful tool for thermochronologic studies which provide constraints on the unroofing history of orogenic belts. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in polydeformed specimens

  17. Generalized Isoscaling of Isotopic Distributions

    CERN Document Server

    Shomin, R; Bjarki, O; Gelbke, C K; Kunde, G J; Lemmon, R C; Lynch, W G; Magestro, D; Popescu, R; Van der Molen, A; Verde, G; Westfall, G D; Xi Hong Fei; Friedman, W A; Imme, G; Maddalena, V; Nociforo, C; Raciti, G; Riccobene, G; Romano, F; Saija, A; Sfienti, C; Fritz, S; Gross, C; Odeh, T; Schwarz, C; Nadasen, A; Sisan, D R; Rao, K A G

    2002-01-01

    Generalized isoscaling relationships are proposed that may permit one to relate the isotopic distributions of systems that may not be at the same temperature. The proposed relationships are applied to multifragmentation excitation functions for central Kr+Nb and Ar+Sc collisions.

  18. Duration of formation of magmatic system of polyphase paleozoic alkaline complexes of the Central Kola: U-Pb, Rb-Sr, Ar-Ar data

    International Nuclear Information System (INIS)

    Attempt was made for the determination of duration of all abyssal system formation in the central part of the Kola peninsula. System of isotope methods inclosing Rb-Sr-isochronic dating, 40Ar/39Ar-age analysis of rocks as well as U-Th-Pb-dating is applied. Formation of the Khibiny-Lovozero-Kurga volcano-plutonic system is proposed to have a multiphase character. Summary scheme of the order of events is performed

  19. 40Ar/39Ar age of the Rotoiti Breccia and Rotoehu Ash, Okataina Volcanic Complex, New Zealand, and identification of heterogeneously distributed excess 40Ar in supercooled crystals

    DEFF Research Database (Denmark)

    Flude, Stephanie; Storey, Michael

    2016-01-01

    Co-magmatic granitoid clasts erupted as part of the Rotoiti Ignimbrite (Rotoehu Tephra) contain euhedral K-feldspar and biotite crystals that protrude into miarolytic cavities and show textural evidence for growth in super-cooled conditions and are thus interpreted as growing during eruption. 40Ar....../39Ar stepped heating experiments on single K-feldspar crystals reveal the presence of heterogeneously distributed excess 40Ar, preferentially released at lower temperature steps (most likely from fluid/melt inclusions), which cannot reliably be characterised by, or corrected for using isotope...... correlation diagrams due to mixing between three reservoirs of 40Ar (radiogenic, atmospheric and excess). This excess 40Ar component is common, but not ubiquitous, and an age population unmixing algorithm applied to single-crystal fusion data identifies a younger group of K-feldspar and biotite crystals that...

  20. Isotopes in aquaculture research

    International Nuclear Information System (INIS)

    The applications of isotopes in aquaculture research include areas like aquatic production process, nutrient cycles and food chain dynamics, fish nutrition, fish physiology, genetics and immunology. The radioisotopes commonly used are beta emitters. The use of different radioisotopes in aquaculture research are presented. 2 tabs

  1. Influence of deformation and fluids on Ar retention in white mica: Dating the Dover Fault, Newfoundland Appalachians

    Science.gov (United States)

    Kellett, Dawn A.; Warren, Clare; Larson, Kyle P.; Zwingmann, Horst; van Staal, Cees R.; Rogers, Neil

    2016-06-01

    White mica 40Ar/39Ar analyses may provide useful constraints on the timing of tectonic processes, but complex geological and thermal histories can perturb Ar systematics in a variety of ways. Ductile shear zones represent excellent case studies for exploring the link(s) between dynamic re-/neo-crystallization of white mica and coeval enhanced fluid flow, and their effect on 40Ar/39Ar dates. White mica 40Ar/39Ar dates were collected from compositionally similar granites that record different episodes of deformation with proximity to the Dover Fault, a terrane-bounding strike-slip shear zone in the Appalachian orogen, Newfoundland, Canada. 40Ar/39Ar data were collected in situ by laser ablation and by step heating single crystals. Results were compared to each other and against complementary U-Pb zircon and monazite, and K-Ar fault gouge analysis. Although step-heat 40Ar/39Ar is a widely applied method in orogenic settings, this dataset shows that relatively flat step-heat 40Ar/39Ar spectra are in contradiction with wide spreads in in-situ40Ar/39Ar dates from the same samples, and that plateau dates in some cases yielded mixed dates of equivocal geological significance. This result indicates that the step-wise release of Ar from white mica likely homogenizes and obscures spatially-controlled Ar isotope reservoirs in white mica from sheared rocks. In contrast, in situ laser ablation 40Ar/39Ar analysis preserves the spatial resolution of 40Ar reservoirs that have been variably reset by deformation and fluid interaction. This study therefore suggests that laser ablation is the best method for dating the timing of deformation recorded by white mica. Final interpretation of results should be guided by microstructural analysis, estimation of deformation temperature, chemical characterization of white mica, and complementary chronometers. Overall the dataset shows that granitic protoliths were emplaced between 430 and 422 Ma (U-Pb zircon). High strain deformation along the

  2. Review of the neutron data for Cl, Ar

    International Nuclear Information System (INIS)

    Many experimental data, such as the total cross section, (n,2n), (n,p), (n,α), (n,γ) cross section and so on have been published for Cl as well as its isotope 35Cl, 37Cl since 1966. All the experimental data up to 1988 were collected in present review. The data were carefully analysed, corrected and fitted with spline function to give the new evaluated cross sections. The neutron data for Ar is also evaluated

  3. Argon isotope fractionation induced by stepwise heating

    Science.gov (United States)

    Trieloff, Mario; Falter, Martina; Buikin, Alexei I.; Korochantseva, Ekaterina V.; Jessberger, Elmar K.; Altherr, Rainer

    2005-03-01

    Noble gas isotopes are widely used to elucidate the history of the rocks in which they have been trapped, either from distinct reservoirs or by accumulation following radioactive decay. To extract noble gases from their host rocks, stepwise heating is the most commonly used technique to deconvolve isotopically different components, e.g., atmospheric, in situ radiogenic, or excess radiogenic from mantle or crustal reservoirs. The accurate determination of the isotopic composition of these different components is of crucial importance, e.g., for ages obtained by 40Ar- 39Ar stepheating plateaus. However, diffusion theory-based model calculations predict that the stepwise thermal extraction process from mineral phases induces isotope fractionation and, hence, adulterates the original composition. Such effects are largely unconsidered, as they are small and a compelling experimental observation is lacking. We report the first unequivocal evidence for significant mass fractionation of argon isotopes during thermal extraction, observed on shungite, a carbon-rich Precambrian sedimentary rock. The degree of fractionation, as monitored by 38Ar/ 36Ar and 40Ar/ 36Ar ratios, very well agrees with theoretical predictions assuming an inverse square root dependence of diffusion coefficient and atomic mass, resulting in easier extraction of lighter isotopes. Hence, subatmospheric 40Ar/ 36Ar ratios obtained for argon extracted at low temperatures may not represent paleoatmospheric argon. Shungite argon resembles modern atmospheric composition, but constraints on the timing of trapping appear difficult to obtain, as shungites are multicomponent systems. In 40Ar- 39Ar stepwise heating, the isotope fractionation effect could cause systematic underestimations of plateau ages, between 0.15 and 0.4% depending on age, or considerably higher if samples contain appreciable atmospheric Ar. The magnitude of this effect is similar to the presently achieved uncertainties of this increasingly

  4. The 38Ar(p,d)37Ar reaction

    International Nuclear Information System (INIS)

    The 38Ar(p,d)37Ar reaction has been used to study the properties of the high-lying positive parity states in 37Ar. Angular distributions in the region thetasub(c.m.)=160-1320 have been analyzed using the DWBA code DWUCK to determine the spectroscopic properties of these states. The two lowest T=3/2 states have been identified at 4.98MeV (3/2+) and 6.65MeV (1/2+). The results are compared to recent shell-model calculations; their significance for the solar neutrino experiment is also discussed. (Auth.)

  5. Natural radioactivity in food chains

    International Nuclear Information System (INIS)

    A number of longliving and still being produced radioactive isotopes produces well measurable and not to be neglected radiation, by which, via the food chains, plant, animal and man receives a socalled natural radiation dose. Six of the most important isotopes are discussed here. The radioisotopes 14C and 40K form part of the most live-necessary elements; they pass without strong enrichment and discrimination through the food chains and form a practically constant part of the living organism. Yet by excessive fertilizing a rather higher content of potassium than necessary is present in plants. Also a higher radiation dose arises from exessive uptake of food. The isotopes of uranium 238U and radium, 226Ra, discussed here, occur everywhere in the soil, but locally in very high amounts. They migrate for a very small part into plant and animal, sometimes occur in vegetable food as part of soil particles. Other important isotopes of the uranium families are radioactive lead, 210Pb, and polonium, 210Po, which can be dispersed to a much greater amount than the other isotopes: in the form of the gaseous intermediate product radon, here the isotope 222Rn. 210Pb and 210Po are finally deposited upon plants and other food products. In the hydrosphere 210Po can be enriched in the food chain from plankton to fish. (author). 35 refs.; 2 figs.; 3 tabs

  6. Argon isotopes as tracers for martian atmospheric loss

    Science.gov (United States)

    Slipski, Marek; Jakosky, Bruce M.

    2016-07-01

    Recent measurements of the present-day Ar abundance and isotopic ratios in the martian atmosphere by the SAM instrument suite onboard the Curiosity rover can be used to constrain the atmospheric and volatile evolution. We have examined the role of volcanic outgassing, escape to space via sputtering, crustal erosion, impact delivery, and impact erosion in reproducing the Ar isotope ratios from an initial state 4.4 billion years ago. To investigate the effects of each of these processes, their timing, and their intensity we have modeled exchanges of Ar isotopes between various reservoirs (mantle, crust, atmosphere, etc.) throughout Mars' history. Furthermore, we use present-day atmospheric measurements to determine the parameter space consistent with observations. We find that significant loss to space (at least 48% of atmospheric 36Ar) is required to match the observed 36Ar/38Ar ratio. Our estimates of volcanic outgassing do not supply sufficient 40Ar to the atmosphere to match observations, so in our model at least 31% of 40Ar produced in the crust must have also been released to the atmosphere. Of the total 40Ar introduced into the atmosphere about 25% must have been lost to space. By adding the present-day isotopic abundances with our results of total integrated Ar loss we find a "restored" value of atmospheric 40Ar/36Ar, which represents what that ratio would be if the total integrated Ar loss had remained in the atmosphere. We determine the restored value to be ∼900-1500. This is below the present martian atmospheric value (1900 ± 300), but 3-5 times greater than the terrestrial value.

  7. Radiogenic age and isotopic studies

    International Nuclear Information System (INIS)

    This is one of an annual collection of reports presenting data from the Geochronology Section of the Continental Geoscience Division of the Geological Survey of Canada (GSC). The main purpose of this collection is to make geochronological and other radiogenic isotope data produced by the section available promptly to the geological community. Reports make full presentation of the data, relate these to field settings and make comparatively short interpretations. Other geochronological and isotope data produced in the laboratory but published in outside journals or separate GSC publications are summarized at the end of this report. Reports in this issue cover methods for Rb-Sr and Sm-Nd isotopic analyses; 40Ar-39Ar ages for the New Quebec Crater and for basaltic rocks; U-Pb ages for a differentiated mafic sill in the Ogilvie Mountains, plutonic rocks in the Contwoyto-Nose Lakes are, zircons from the Anton Complex, the Clinton-Colden gabbro-anorthosite intrusion, the Himag plutonic suite, the Campbell granite, the Central Gneiss Belt, Silurian granites, a metarhyolite, plagiogranite and gabbro, and the Wage shear zone; Rb-Sr ages for granitic rocks; K-Ar and Rb-Sr geochronology of granites; a compilation of K-Ar ages; ages of archean and proterozoic mylonites and pre-Misi granitoid domes; and reconnaissance geochronology of Baffin Island

  8. Study of the N=28 shell closure by one neutron transfer reaction: astrophysical application and {beta}-{gamma} spectroscopy of neutron rich nuclei around N=32/34 and N=40; Etude de la fermeture de couche N=28 autour du noyau {sub 18}{sup 46}Ar{sub 28} par reaction de transfert d'un neutron: application a l'astrophysique et Spectroscopie {beta}-{gamma} de noyaux riches en neutrons de N=32/34 et N=40

    Energy Technology Data Exchange (ETDEWEB)

    Gaudefroy, L

    2005-09-15

    The study of the N=28 shell closure has been presented as well as its astrophysical implications. Moreover the structure of neutron rich nuclei around N=32/34 and 40 was studied. The N=28 shell closure has been studied trough the one neutron transfer reaction on {sup 44,46}Ar nuclei. Excitation energies of states in {sup 45,47}Ar nuclei have been obtained, as well as their angular momenta and spectroscopic factors. These results were used to show that N=28 is still a good magic number in the argon isotopic chain. We interpreted the evolution of the spin-orbit partner gaps in terms of the tensor monopolar proton-neutron interaction. Thanks to this latter, we showed it is not necessary to summon up a reduction of the intensity of the spin-orbit force in order to explain this evolution in N=29 isotopes from calcium to argon chains. The neutron capture rates on {sup 44,46}Ar have been determined thanks to the results of the transfer reaction. Their influence on the nucleosynthesis of {sup 46,48}Ca was studied. We proposed stellar conditions to account for the abnormal isotopic ratio observed in the Allende meteorite concerning {sup 46,48}Ca isotopes. The beta decay and gamma spectroscopy of neutron rich nuclei in the scandium to cobalt region has been studied. We showed that beta decay process is dominated by the {nu}f{sub 5/2} {yields} {pi}f{sub 7/2} Gamow-Teller transition. Moreover, we demonstrated that the {nu}g{sub 9/2} hinders this process in the studied nuclei, and influences their structure, by implying the existence of isomers. Our results show that N=34 is not a magic number in the titanium chain and the superior ones. (author)

  9. Ars Poetica : [luuletused] / Mats Traat

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  10. Isotopic Biogeochemistry

    Science.gov (United States)

    Hayes, J. M.

    1985-01-01

    An overview is provided of the biogeochemical research. The funding, productivity, personnel and facilities are reviewed. Some of the technical areas covered are: carbon isotopic records; isotopic studies of banded iron formations; isotope effects in microbial systems; studies of organic compounds in ancient sediments; and development in isotopic geochemistry and analysis.

  11. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Science.gov (United States)

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  12. Guided-ion beam measurements of Ar+ + Ar symmetric charge-transfer cross sections at ion energies ranging from 0.2 to 300 eV

    International Nuclear Information System (INIS)

    Guided-ion beam (GIB) measurements of the Ar+ + Ar symmetric charge-transfer (SCT) system are presented for ion energies ranging from 0.2 to 300 eV. Two methods are applied to distinguish primary and secondary ions: (i) based on isotopic-labeling, (ii) based on significant laboratory velocity differences. The absolute cross sections measured with these methods are in excellent agreement at energies above 1 eV. The experimental results are compared with semi-classical calculations performed with various published Ar2+ potentials. The calculations including spin-orbit effects lie within 10% of the isotope-selected and attenuation measurements at all investigated ion energies. The present results lie significantly above the simple Rapp and Francis model. Important errors in the latter approach are pointed out and a correct one-electron model is proposed. First measurements of the differential cross section at 0.5 eV collision energy are briefly mentioned. (orig.)

  13. Molybdenite Re-Os and muscovite 40Ar/39Ar dating of the Xihuashan tungsten deposit, central Nanling district, South China

    Science.gov (United States)

    Hu, Rui-Zhong; Wei, Wen-Feng; Bi, Xian-Wu; Peng, Jian-Tang; Qi, You-Qiang; Wu, Li-Yan; Chen, You-Wei

    2012-10-01

    The Xihuashan tungsten deposit in the central Nanling region, South China, is an important vein-type ore deposit hosted in Cambrian strata and Mesozoic granitic intrusions. Wolframite and molybdenite are the principal ore minerals. The gangue minerals are mainly quartz and muscovite. Wolframite and molybdenite are products of the first stage hydrothermal activity, whereas muscovite formed dominantly at the second stage. Molybdenite Re-Os and muscovite 40Ar/39Ar dating have been carried out to investigate the age of mineralization. Re-Os isotopic dating for molybdenite associated with wolframite yield a precise, well-constrained isochron age of 157.8 ± 0.9 Ma (MSWD = 1.5). Ar-Ar isotopic analyses of muscovite yield a plateau age of 152.8 ± 1.6 Ma, in agreement with an inverse isochron age of 152.8 ± 1.6 Ma, which is ~ 5 mys younger than the Re-Os age. The molybdenite Re-Os age is interpreted as the age of tungsten mineralization. This age coincides well with the zircon U-Pb age of the host granitic intrusion reported previously. The ~ 5 mys difference between molybdenite Re-Os and muscovite 40Ar/39Ar ages probably represents the duration of hydrothermal activity. The results show that the Xihuashan tungsten deposit is one of many important tungsten-tin deposits formed during 150 to 160 Ma associated with large-scale lithospheric extension in South China.

  14. Effects of level inversion on the Coulomb displacement energies of the Ar-K isobaric analog state pairs

    CERN Document Server

    Wang, Zaijun; Xu, Renli

    2016-01-01

    The Coulomb displacement energies of the neutron-rich Ar-K isobaric analog state pairs with mass number $A=35-47$ are calculated within the relativistic mean field model and the effects of level inversion on the Coulomb displacement energies of the Ar-K isobaric analog state pairs are studied. The calculations are carried out in two cases, with and without consideration of the possible $2s_{1/2}$ and $1d_{3/2}$ proton level inversion of the neutron-rich Ar isotopes. Results show that the $2s_{1/2}$ and $1d_{3/2}$ level inversion of the neutron-rich Ar isotopes may reduce the Coulomb displacement energy by 0.06$\\sim$0.17 MeV for the Ar-K isobaric analog state pairs. The results may provide a reference for experimental investigations of nuclear level inversion and a new test of the relativistic mean field model.

  15. REGISTRATION OF BIRDSFOOT TREFOIL GERMPLASM ARS-2622

    Science.gov (United States)

    ARS-2622 broadleafed birdsfoot trefoil (Lotus corniculatus L.) germplasm was released by the USDA-ARS in cooperation with the Missouri Agricultural Experiment Station in August 2002. The merit of ARS-2622 is that it is a rhizome producing population with a broad genetic base. ARS-2622 was developed ...

  16. Analysis list: AR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  17. Analysis list: Ar [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscience

  18. 40Ar/39Ar Dating of the Brunhes-Matuyama Geomagnetic Field Reversal.

    Science.gov (United States)

    Baksi, A K; Hsu, V; McWilliams, M O; Farrar, E

    1992-04-17

    Magnetostratigraphic studies are widely used in conjunction with the geomagnetic polarity time scale (GPTS) to date events in the range 0 to 5 million years ago. A critical tie point on the GPTS is the potassium-argon age of the most recent (Brunhes-Matuyama) geomagnetic field reversal. Astronomical values for the forcing frequencies observed in the oxygen isotope record in Ocean Drilling Project site 677 suggest that the age of this last reversal is 780 ka (thousand years ago), whereas the potassium-argon-based estimate is 730 ka. Results from 4039; Ar incremental heating studies on a series of lavas from Maui that straddle the Brunhes-Matuyama reversal give an age of 783 + 11 ka, in agreement with the astronomically derived value. The astronomically based technique appears to be a viable tool for dating young sedimentary sequences. PMID:17743111

  19. Isotopic geology

    International Nuclear Information System (INIS)

    Born from the application to geology of nuclear physics techniques, the isotopic geology has revolutionized the Earth's sciences. Beyond the dating of rocks, the tracer techniques have permitted to reconstruct the Earth's dynamics, to measure the temperatures of the past (giving birth to paleoclimatology) and to understand the history of chemical elements thanks to the analysis of meteorites. Today, all domains of Earth sciences appeal more or less to the methods of isotopic geology. In this book, the author explains the principles, methods and recent advances of this science: 1 - isotopes and radioactivity; 2 - principles of isotope dating; 3 - radio-chronological methods; 4 - cosmogenic isotope chronologies; 5 - uncertainties and radio-chronological results; 6 - geochemistry of radiogenic isotopes; 7 - geochemistry of stable isotopes; 8 - isotopic geology and dynamical analysis of reservoirs. (J.S.)

  20. Isotopic clusters

    International Nuclear Information System (INIS)

    Spectra of isotopically mixed clusters (dimers of SF6) are calculated as well as transition frequencies. The result leads to speculations about the suitability of the laser-cluster fragmentation process for isotope separation. (Auth.)

  1. Whole-rock Ar-Ar dating for low-grade metavolcanics within the Dabie orogen and its geological significance

    Institute of Scientific and Technical Information of China (English)

    GAO Tianshan; TANG Jiafu; SANG Haiqing; HU Shiling; QIAN Cunchao

    2006-01-01

    The genetic relationship between low- grade and ultrahigh-pressure (UHP) metamorphic units in the interior of the Dabie orogen has been controversial with respect to preservation of volcanic texture during continental subduction to mantle depths. In order to resolve this issue, whole-rock Ar-Ar dating was carried out for greenschist-facies metatuff that is in contact with UHP eclogite in Yuexi County, Anhui Province. One sample gave a plateau age of 784.4±2.0 Ma and an isochron age of 785.0± 4.7 Ma, and the other sample a plateau age of 770.9± 2.0 Ma and an isochron age of 769.5±3.1 Ma. It appears that the Ar isotopic system was not disturbed since the volcanic eruption at the middle Neoproterozoic. Because of the low closure temperature of Ar diffusion in volcanic rocks, retention of the Neoproterozoic ages indicates that the low-grade metavolcanics did not experience high-grade metamorphism up to eclogite-facies conditions during the Triassic subduction of continental crust. Furthermore, the Neoproterozoic Ar-Ar ages are also in agreement with protolith ages of UHP metaigneous rocks in the Dabie orogen. Therefore, the metatuff is interpreted as a tectonic relict that was scraped off during the Triassic subduction and thus was not subducted to mantle depths like the adjacent eclogite. This lends support to the model for crustal detachment between cover and basement during continental collision. A tectonic mélange model is proposed to explain the occurrence of contrasting grades of metamorphic rock within the UHP metamorphic zone.

  2. Late Cretaceous remagnetization of Proterozoic mafic dikes, southern Highland Mountains, southwestern Montana: A paleomagnetic and 40Ar/39Ar study

    Science.gov (United States)

    Harlan, S.S.; Geissman, J.W.; Snee, L.W.; Reynolds, R.L.

    1996-01-01

    Paleomagnetic results from Early Proterozoic metabasite sills and Middle Proterozoic diabase dikes from the southern Highland Mountains of southwestern Montana give well-defined, dual-polarity magnetizations that are statistically identical to those from a small Late Cretaceous pluton that cuts the dikes. The concordance of paleomagnetic directions from rocks of three widely separated ages indicates that the Proterozoic rocks were remagnetized, probably during Late Cretaceous time. Paleomagnetic, rock magnetic, and petrographic observations from the metabasite and diabase samples indicate that remanence is carried primarily by low-Ti magnetite. Combining virtual geomagnetic poles from metabasite sills, diabase dikes, and the Late Cretaceous pluton, we obtain a paleomagnetic pole at 85.5??N, 310.7??E (K = 19.9, A95 = 9.1??, N = 14 sites) that is similar to a reference pole from the 74 Ma Adel Mountain Volcanics of western Montana. Biotite and hornblende 40Ar/39Ar isotopic dates from host basement geneiss and a hornblende from a remagnetized metabasite sill yield ages of ca. 1800 Ma; these dates probably record cooling of the southern Highland Mountains following high-grade metamorphism at 1.9-1.8 Ga. The gneiss and metabasite age spectra show virtually no evidence of disturbance, indicating that the basement rocks were never heated to temperatures sufficient to cause even partial resetting of their argon systems. Thus, the overprint magnetization of the Highland Mountains rocks is not a thermoremanent magnetization acquired during conductive cooling of nearby Late Cretaceous plutons. Remagnetization of the metabasite sills and diabase dikes was probably caused by localized thermochemical and thermoviscous effects during circulation of Late Cretaceous hydrothermal fluids related to epithermal mineralization. The absence of significant disturbance to the 40Ar/39Ar age spectrum from the remagnetized metabasite hornblende indicates that some secondary magnetizations may

  3. The effect of thermal resetting and recrystallisation on white mica 40Ar/39Ar ages during retrograde metamorphism on Syros, Greece

    Science.gov (United States)

    Uunk, Bertram; Wijbrans, Jan; Brouwer, Fraukje

    2015-04-01

    White mica 40Ar/39Ar dating is a proven powerful tool for constraining timing of metamorphism, deformation and exhumation. However, in high-pressure metamorphic rocks, dating often results in wide age ranges which are not in agreement with constraints from other isotopic systems, indicating that geological and chemical processes complicate straightforward 40Ar/39Ar dating. In this research project, white mica ages from rocks of the Cycladic Blueschist Unit on Syros, Greece with contrasting rheology and strain mechanisms are compared, in order to better understand the role of deformation, recrystallization and fluid flow on 40Ar/39Ar ages of white mica during retrograde metamorphism. Resulting ages vary along different sections on the island, inconsistent with other isotopic constraints on eclogite-blueschist metamorphism (55-50 Ma) and greenschist overprinting (41-30 Ma). Two end-member models are possible: 1) Results represent continuous crystallization of white mica while moving from blueschist to greenschist conditions in the metamorphic P-T loop, or 2) white mica equilibrated in eclogite-blueschist conditions and their diffusion systematics were progressively perturbed during greenschist overprinting. The single grain fusion analyses yielded contrasting age distributions, which indicate contrasts in degree of re-equilibration during retrograde metamorphism. Step wise heating of larger grain populations resulted in flat plateau shapes, providing no evidence for partial resetting. Electron microprobe measurements of Si per formula unit, as a proxy for pressure during crystallisation, do not explain age variation within sections or on the island scale. The previously unreported north-south age trend and age ranges per sample, as shown only in the 40Ar/39Ar system of the metapelitic and marble lithologies, contains key information that will allow us to test between different scenarios for age formation. Excess argon infiltration at this stage seems to have been of

  4. 40Ar-39Ar dating of Luna 16 and Luna 20 samples

    International Nuclear Information System (INIS)

    Two fragments of Luna 16 mare basalt and two Luna 20 samples (one metaclastic fragment and a group of five anorthositic particles) from the Royal Society allocation have been dated by using the 40Ar-39Ar technique. The Luna 16 ages confirm that mare lavas were extruded in Mare Fecunditatis 3.4 to 3.5 Ga ago. Similarly, the age of the Luna 20 metaclastic fragment provides further support for a 3.9 Ga age for the Crisium basin and for the widespread cataclysmic bombardment of the moon between 4.05 and 3.85 Ga. The presence of at least two isotopically distinct, non-radiogenic argon components in the Luna 20 anorthositic sample comprises an unequivocal age assignment but the simplest model leads to a plateau age of 4.40 +- 0.10 Ga and a minimum age of 4.30 +- 0.10 Ga. There are now several lunar highland samples which are significantly older than 4.0 Ga and which give rise to a secondary age grouping in the interval 4.2 to 4.3 Ga. Depending on whether highland ages were primarily reset during the excavation of a large number of medium-sized craters or a small number of large basins, this secondary grouping implies either a significant peak in the cratering rate at 4.0 Ga or statistical fluctuations in a monotonically decreasing cratering rate. (author)

  5. A compact isotope identification telescope with a wide dynamic range

    Institute of Scientific and Technical Information of China (English)

    徐瑚珊; 诸永泰; 等

    1996-01-01

    A compact ΔE-E telescope,used to complete the isotope identification for lighter projectile-like fragments in intermediate energy heavy ion collisions.is developed.By detecting the fragments emitted from 30MeV/u 40Ar induced reactions.it can identify isotopes of up to element aluminum(Z=13).

  6. A continuous flow isotope ratio mass spectrometry method for high precision determination of dissolved gas ratios and isotopic composition

    DEFF Research Database (Denmark)

    Charoenpong, C. N.; Bristow, L. A.; Altabet, M. A.

    2014-01-01

    Dissolved gas ratios and isotopic compositions provide essential information about the biological and physical mechanisms influencing N-2, O-2, and Ar in aquatic systems. Current methods available are either limited by overall cost, labor-intensive sample collection and analysis, or insufficient...... precision. Here, we present a new highly accurate and robust method for sample collection and subsequent simultaneous measurement of the dissolved gas ratios (N-2/Ar and O-2/Ar) and isotopic compositions (delta N-15(2) and delta O-18(2)) in seawater. The relatively simple sampling procedure using low cost...

  7. "Ars Electronica 2009" / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  8. 40Ar/39Ar dated climatic and hydrological variability between MIS20 and MIS18 at Sulmona Basin (central Italy)

    Science.gov (United States)

    Zanchetta, Giovanni; Giaccio, Biagio; Eleonora, Reagattieri; Nomade, Sebastien; Renne, Paul R.; Sprain, Courtney J.; Drysdale, Russell N.; Tzedakis, Polychronis C.; Messina, Paolo; Scardia, Giancarlo; Sposato, Andrea

    2015-04-01

    Understanding spatial-temporal variability, magnitude and different expressions of Quaternary millennial-scale palaeoclimatic changes is one of the frontier challenges of modern palaeoclimatology. Addressing this issue requires the acquisition of regionally representative, and ideally independently-dated, records of climatic variability. Multiproxy record (stable isotopes, XRF, MS, %CaCO3) from lacustrine succession of Sulmona basin (central Italy), highlights climatic and hydrological variability at orbital to millennial scales between MIS20 and MIS18. The record highlights the presence of interesting millennial scale variability within MIS19, considered to be the best orbital analogue of the current interglacial. The presence of several tephra layers precisely dated by 40Ar/39Ar technique, allow placement of the record within a robust time frame. Assembling a high-resolution paleoclimatic record for MIS19 anchored to a high-precision 40Ar/39Ar chronology, it is possible to show that the MIS 19c interglacial started shortly before the boreal summer insolation and obliquity maximum/precession minimum at 790-788 ka, and ended 11.6 ± 2.3 kyr later, when orbital parameters assumed a configuration similar to the present one.

  9. Generalized Coordinate Bethe Ansatz for open spin chains with non-diagonal boundaries

    International Nuclear Information System (INIS)

    We introduce a generalization of the original Coordinate Bethe Ansatz that allows to treat the case of open spin chains with non-diagonal boundary matrices. We illustrate it on two cases: the XXX and XXZ chains. Short review on a joint work with N. Crampe (L2C) and D. Simon (LPMA), see arXiv:1009.4119, arXiv:1105.4119 and arXiv:1106.3264.

  10. Polycyclic orogeny in Central Ogcheon metamorphic belt, Korea: evidence from 40Ar/39Ar hornblende ages

    International Nuclear Information System (INIS)

    Full text: The Ogcheon fold-thrust belt is one of the key Phanerozoic belts for delineating the regional correlation in East Asia including mainland China and Japan. This NE-trending belt consists of the Ogcheon metamorphic belt (OMB) in the southwest and the Taebaeksan sedimentary zone in the northeast. The OMB comprises Late (?) Proterozoic to Paleozoic metasedimentary and metavolcanic sequences intruded by Mesozoic granitoids. The age of initial intracontinental rifting is constrained to be earlier than 756 Ma by the U-Pb zircon age of a felsic metavolcanic rock (Lee et al., 1998, Precamb. Res. 89, 47-57). Polyphase tectonism in the OMB is characterised by the Middle Paleozoic Ogcheon orogeny responsible for the ductile stacking of thrust nappes and the Triassic Songrim orogeny occurring at shallower depths under the brittle-ductile transitional regime (Cluzel et al., 1990, Tectonophysics, 183, 41-56). Peak metamorphic conditions of the former are in the range of 5-8 kbar and 520-590 deg C, whereas those of the latter are 1-3 kbar and 350-500 deg C (Min and Cho, 1998, Lithos, 43, 31-51). Major ambiguity in the polycyclic model of the OMB results from the lack of isotopic age data. In order to determine the age of peak metamorphism, we analysed hornblende crystals of quartzose amphibole schists in central OMB, using the 40Ar/39Ar dating technique. Mineral assemblages of amphibole schists are represented by calcic amphiboles + plagioclase + epidote ± garnet + quartz + titanite + Fe-Ti oxide (magnetite or ilmenite). Amphibole separates commonly display discordant age spectra. Nevertheless, amphiboles of five analysed samples yield 40Ar/39Ar intercept dates ranging from 432±4 Ma to 499±10 Ma. Three of them yield plateau dates of 440-492 Ma, defined by more than three contiguous steps accounting for >50% of the total 39ArK released. Two of these plateau dates (465±4 Ma and 492±4 Ma) are from hornblende fractions of different grain size in a garnet

  11. Oldest human footprints dated by Ar/Ar

    Science.gov (United States)

    Scaillet, Stéphane; Vita-Scaillet, Grazia; Guillou, Hervé

    2008-11-01

    Fossilized human trackways are extremely rare in the geologic record. These bear indirect but invaluable testimony of human/hominid locomotion in open air settings and can provide critical information on biomechanical changes relating to bipedalism evolution throughout the primitive human lineage. Among these, the "Devil's footsteps" represent one of the best preserved human footprints suite recovered so far in a Pleistocene volcanic ash of the Roccamonfina volcano (southern Italy). Until recently, the age of these footprints remained speculative and indirectly correlated with a loosely dated caldera-forming eruption that produced the Brown Leucitic Tuff. Despite extensive hydrothermal alteration of the pyroclastic deposit and variable contamination with excess 40Ar, detailed and selective 40Ar/ 39Ar laser probe analysis of single leucite crystals recovered from the ash deposit shows that the pyroclastic layer and the footprints are 345 ± 6 kyr old (1 σ), confirming for the first time that these are the oldest human trackways ever dated, and that they were presumably left by the modern human predecessor, Homo heidelbergensis, close to Climatic Termination IV.

  12. Medical isotopes and emerging nuclear medicine technologies

    International Nuclear Information System (INIS)

    This presentation discusses medical isotopes and the emerging nuclear medicine technologies as well as the impact of Chalk River reactor shutdown on patient management and diseases. It outlines the chain of supply of isotopes across the globe and isotope shortage impact. It recommends the following mitigating strategies: modifications of scanning techniques, adjustment of patient scheduling, optimization of Tc-99m generator use, patient prioritization, alternate procedures and PET scanning.

  13. Further support for a Cretaceous age for the feathered-dinosaur beds of Liaoning,China:New 40Ar/39Ar dating of the Yixian and Tuchengzi Formations

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    We report new 40Ar/39Ar dating results obtained from total fusion and incremental-heating analyses of sanidine and biotite from three tuffs found interbedded within the fossil-bearing deposits of Liaoning, northeast China. The first is a new sample of the Bed 6 Sihetun tuff from the Yixian Formation, previously dated by our team as middle Early Cretaceous, and recently considered by Lo et al., partially reset due to metamorphism from a nearby basaltic sill. The second is the Yixian Bed 9 tuff from Hengdaozi considered by Lo et al. to be unaffected by metamorphism and whose age, based on total fusion 40Ar/39Ar dating of biotite, argues for a Jurassic age for the Yixian Formation.The third tuff is a previously undated tuff from the upper part of the underlying Tuchengzi Formation. Single crystal total fusion 40Ar/39Ar analyses of the Sihetun sanidine showed homogeneous radiogenic Ar, Ca/K ratios, excellent reproducibility and gave a mean age of 125.0 ± 0.18 (1SD) ±0.04 (SE) Ma. Single sanidine crystal total fusion 40Ar/39Aranalyses of the Hengdaozi tuff gave a mean age of 125.0 +0.19 (1SD) ± 0.04 (SE) Ma, which is indistinguishable from the Sihetun tuff. The Tuchengzi Formation tuff gave a mean age of 139.4 ± 0.19 (1SD) ± 0.05 (SE) Ma. Detailed laser incremental-heating analyses of biotite from Sihetun, Hengdaozi, and Tuchengzi tuffs show disturbed Ar release patterns and evidence of trapped argon components. We conclude from these analyses that the total fusion dates on biotite by Lo et al. are erroneously old and isotopic dating of both biotite and sanidine from tuffs of the Yixian Formation point to a middle Early Cretaceous age. The upper part of the Tuchengzi Formation can be referred to the Early Cretaceous.``

  14. AR DOC: Augmented reality documentaries

    DEFF Research Database (Denmark)

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler <= 125.000 DKK), der af haft som sit formål at afprøve et unikt samarbejde omkring udforskningen af nye teknikker til augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  15. ARS - Helsinki - 2006 / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  16. Ars Industrialis, arsindustrialis.org

    Directory of Open Access Journals (Sweden)

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  17. AR-39Ar-40 dating of basalts and rock breccias from Apollo 17 and the malvern achondrite

    Science.gov (United States)

    Kirsten, T.; Horn, P.

    1977-01-01

    The principles and the potential of the Ar-39/Ar-40 dating technique are illustrated by means of results obtained for 12 Apollo 17 rocks. Emphasis is given to methodical problems and the geological interpretation of lunar rock ages. Often it is ambigious to associate a given lunar breccia with a certain formation, or a formation with a basin. In addition, large-scale events on the Moon have not necessarily reset radiometric clocks completely. One rock fragment has a well-defined plateau age of 4.28 b.y., but the ages of two Apollo 17 breccias define an upper limit for the formation age of the Serenitatis basin at 4.05 b.y. Ages derived from five mare basalts indicate cessation of mare volcanism at Taurus-Littrow approximately 3.78 b.y. ago. Ca/Ar-37 exposure ages show that Camelot Crater was formed by an impact approximately 95 m.y. ago. After a short summary of the lunar timetable as it stands at the end of the Apollo program, we report about Ar-39/Ar-40 and rare gas studies on the Malvern meteorite. This achondrite resembles lunar highland breccias in texture as well as in rare-gas patterns. It was strongly annealed at some time between 3.4 and 3.8 b.y. ago. The results indicate that very similar processes have occurred on the Moon and on achondritic parent bodies at comparable times, leading to impact breccias with strikingly similar features, including the retention of rare-gas isotopes from various sources.

  18. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  19. 40Ar/39Ar laster fusion and K-Ar ages from Lathrop Wells, Nevada, and Cima, California: The age of the latest volcanic activity in the Yucca Mountain area

    International Nuclear Information System (INIS)

    K-Ar and 40Ar/39Ar ages from the Lathrop Wells volcanic center, Nevada, and from the Cima volcanic field, California, indicate that the recently reported 20-ka age estimate for the Lathrop Wells volcanic center is incorrect. Instead, an age of 119 ± 11 to 141 ± 10 ka is indicated for the Lathrop Wells volcanic center. This age corrected is concordant with the ages determined by two independent isotopic geochronometric techniques and with the stratigraphy of surficial deposits in the Yucca Mountain region. In addition, paleomagnetic data and radiometric age data indicate only two volcanic events at the Lathrop Wells volcanic center that are probably closely linked in time, not as many as five as recently reported. 32 refs., 2 figs., 2 tabs

  20. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Directory of Open Access Journals (Sweden)

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  1. Chronostratigraphy of Monte Vulture volcano (southern Italy): secondary mineral microtextures and 39Ar-40Ar systematics

    Science.gov (United States)

    Villa, Igor M.; Buettner, Annett

    2009-12-01

    The eruptive history of Monte Vulture has been the subject of several geochronological investigations during the past decades, which reliably dated only a small number of eruptions. Understanding the causes of sub-optimum data yield in the past requires an interdisciplinary approach. We re-analyzed samples from previous works and present new data on samples from the main volcano-stratigraphic units of Monte Vulture, so as to provide an improved, consistent chronostratigraphic database. Imaging of minerals by cathodoluminescence and backscattered electrons reveals that heterochemical, high-temperature deuteric reaction textures are ubiquitous. Such observations are common in metamorphic rocks but had not frequently been reported from volcanic rocks. In view of the mineralogical complexity, we base our chronological interpretation on isochemical steps, defined as steps for which the Cl/K and/or the Ca/K ratios are constant. Isochemical steps carry the isotopic signature of chemically homogeneous mineral phases and therefore allow a well-constrained age interpretation. Comparison of old and new 39Ar-40Ar data proves the reproducibility of age spectra and their shapes. This quantifies the analytical reliability of the irradiation and mass-spectrometric analyses. Anomalous age spectra are a reproducible property of some specific samples and correlate with mineralogical anomalies. The present data allow us to fine-tune the age of the volcanostratigraphic units of Monte Vulture during the known interval of main volcanic activity from ca. 740 to 610 ka. After a very long stasis, the volcanic activity in the Monte Vulture area resumed with diatremic eruptions, one of which (Lago Piccolo di Monticchio, the site of a palynological-paleoclimatological drilling) was dated at ca. 140 ka.

  2. Beta decay of 31Ar

    International Nuclear Information System (INIS)

    A complete study of 31Ar beta decay has been made by high-resolution charged-particle and gamma-ray spectroscopy. Beta-delayed radiation was detected by an array of three charged-particle detectors and a large-volume germanium detector. Fifteen new energy levels were discovered in 31Cl. The beta-strength distribution, measured to 14.5 MeV, is compared with a shell-model calculation in the full sd space. The quenching of the Gamow-Teller strength and the isospin impurity of the IAS in 31Cl are discussed. (orig.)

  3. Potash-rich volcanic rocks and lamprophyres in western Shandong Province: 40Ar39Ar dating and source tracing

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Highly precise 40Ar39Ar dating results demonstrate that the ages of potash-rich volcanic rocks in western Shandong Province are 114.7-124.3 Ma, and that of the lamprophyres is 119.6 Ma. The potash-rich volcanic rocks have relatively high (87Sr/86Sr)i ratios ( 0.708715-0.711418)and distinctly negative εNd values ( -11.47 - -17.54), and are enriched in radiogenic lead (206Pb/204pb=17.341-17.622,207pb/204Pb=15.525-15.538, 208Pb/204pb = 37.563-37.684).Similarly, the lamprophyres also have quite low εNd values ( -11.57 - -19.64). Based on the fact that the Sr, Nd and Pb isotopic compositions of potash-rich volcanic rocks are very consistent with that of the clinopyroxene separates, and by integrating comprehensive analyses of their tectonic settings,and extensive comparisons of the Sr, Nd isotopic compositions with that of the related simultaneous rocks, it is concluded that the potash-rich volcanic rocks and lamprophyres in western Shandong Province were most possibly derived from the partial melting of enriched mantle which was caused by source contamination and metasomatism of subducted continental crustal materials.``

  4. Chain Teleportation

    OpenAIRE

    Lee, Chien-er

    2004-01-01

    By means of the idea of measurements on the crossed space-time nonlocal observables, we extend the mechanism for the two-way quantum teleportation to the chain teleportation among N spatially separated spin-1/2 systems. Since in the process only the local interactions are used, the microcausality is automatically satisfied.

  5. Geology and 40Ar/39Ar Geochronology of Akutan Volcano, Eastern Aleutian Islands

    Science.gov (United States)

    Coombs, M. L.; Jicha, B. R.

    2013-12-01

    40Ar/39Ar dating and new whole-rock geochemical analyses are used to establish an eruptive chronology for Akutan volcano, Akutan Island, in the eastern Aleutian island arc. Akutan Island (166° W, 54.1° N) is the site of long-lived volcanism and the entire island comprises volcanic rocks as old as 3.3 Ma (Richter et al., 1998, USGS Open-File 98-135). Our current focus is on the 225 km2 western half of the island, which is home to the Holocene active cone, Holocene to latest Pleistocene satellite vents, and underlying middle Pleistocene volcanic basement rocks. Eruptive products span the tholeiitic-calc-alkaline boundary, are medium-K, and range from basalt to dacite. Furnace incremental heating experiments on groundmass separates of 38 samples resulted in 29 40Ar/39Ar ages. The remainder did not yield radiogenic 40Ar contents and are likely Holocene in age. The oldest ages (1251×10 and 1385×12 ka) are from a wedge of flat-lying dissected lavas north of the Holocene cone; these likely represent the upper part of the volcanic basement that underlies the entire island. Above a major unconformity lie basaltic andesite to dacite lavas that range from 765× 4 to 522×8 ka. The eroded remnants of the source volcano for these flows appears to crop out as a series of variably hydrothermally altered breccias and domes 5 km east-northeast of the current summit. A 625 m-tall eroded basaltic center, Lava Peak, sits 6 km northwest of the summit; its deeply incised western flank exposes lava flows and a plug. Two flows are dated at 598×16 and 602×15 ka. A high ridge 1.5 km south of the summit is made of oxidized, mostly andesitic lavas 284-249 ka old; these are presumably the remnants of an eruptive center located near the current cone. Flat Top Peak, 3.5 km southwest of the summit, produced almost exclusively basalts and six dated lavas range from 155×8 to 98×18 ka. Lavas from Flat Top (1065 m asl) are deeply eroded suggesting extensive ice cover during marine isotope

  6. Radiogenic age and isotopic studies: report 9. Current research 1995-F

    International Nuclear Information System (INIS)

    'Radiogenic Age and Isotopic Studies' is an annual collection of research presentations containing U-Pb, Sm-Nd, Rb-Sr, and 40Ar-39Ar data generated by the Geochronology Laboratory under the auspices of the Continental Geoscience Division, Geological Survey of Canada. Report 9 contains 5 papers from regions across Canada, followed by a compilation of 40Ar-39Ar and K-Ar ages. Authors herein present data, relate results to field settings, and make brief interpretations. Readers are thus reminded that much of the research encompassed represents 'work-in-progress' and that more extensive publications may follow at a later date

  7. Ars discendi, ars docendi : programme Pascal

    OpenAIRE

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  8. Isotopic fractionation of argon during stepwise release from shungite

    International Nuclear Information System (INIS)

    In previous attempts to determine the 40Ar/36Ar ratio in the ancient atmosphere, the only direct measurement yielding a value below the atmospheric value of today is for argon released at low temperatures from a pre-Cambrian shungite, an amorphous carbon mineral The present work confirms a low value for 40Ar/36Ar in gas released from a type I shungite at low temperatures. But quantitative scrutiny of the accompanying 38AR/36Ar ratios and the enhanced ratio of 40Ar/36Ar for the fractions released at high temperatures shows convincingly that the effect seen here is an artifact of the stepwise heating and the argon diffusion mobilized thereby. The low 40Ar/36Ar previously obtained is very likely from the same cause rather than reflecting the isotopic composition of the pre-Cambrian atmosphere. The vitreous character of and the sharp, conchoidal fractures seen in the specimens of type I shungite suggest that the substance may exhibit simple volume diffusion over macroscopic dimensions as glasses do. If so, the diffusion parameters (D infinitely = 3 x 10-4 cm2/s and E = 11 kcal/mole) obtained from the data imply rapid exchange with the atmosphere for any argon initially trapped in centimenter-thick veins of the material. (orig.)

  9. Reaction mechanisms and production of exotic nuclei using 200 MeV/n 40Ar

    International Nuclear Information System (INIS)

    Experiments using the fragmentation of 40Ar at 200 MeV/n have proved to be a powerful new tool for the investigation of both the dynamics of nuclear interactions at high energies and the limits of nuclear stability. In order to study the reaction mechanism, C and Th targets were bombarded by 213 MeV/n 40Ar. Energy spectra were measured at lab angles from 00 to 40 in a telescope. Isotope production cross sections were obtained by integrating the energy spectra and angular distributions. (orig./AH)

  10. Volcano Pectusan: composition of rocks, chronology of eruption (K-Ar) and evolution (87Sr/86Sr and δ18O)

    International Nuclear Information System (INIS)

    Paper presents the results of the isotope study of the Pectusan volcano northeast and western slopes located at the North Korea and China boundary. Fresh data on the K-Ar-isotope geochronology, on the rock mass composition enabled to trace the stages and the cycles in the evolution of the mentioned volcano. On the basis of the isotope study (87Sr/86Sr and δ18O) data one analyzed some problems dealing with the genesis of the alkali-sialic rocks

  11. Catch Chain

    OpenAIRE

    Talbert, Robert

    2010-01-01

    Catch Chain is a book of poems that traces the journey of a Corrections Officer who attempts to combat issues of isolation, inhumane treatment of inmates and societal rejection in jails by embarking upon a cross-country road trip. However, the same issues the officer initially wrestled with begin cropping up in different cities, on various highways and in a multitude of states. The excitement and adventure of the open road runs parallel to the recurring imprisonment of the guard's mind.

  12. Dating blueschist metamorphism: a combined 40Ar/39Ar and electron microprobe approach

    International Nuclear Information System (INIS)

    40Ar/39Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of 40Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (3140 to 4500C), however, is close to the estimated peak metamorphic temperatures (3250 +- 500C), suggesting that phengite 40Ar/39Ar plateau dates may coincide closely with the time of blueschist metamorphism. (author)

  13. Leatherback Isotopes

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — SWFSC is currently working on a project identifying global marine isotopes using leatherback turtles (Dermochelys coriacea) as the indicator species. We currently...

  14. Isotopic chirality

    Energy Technology Data Exchange (ETDEWEB)

    Floss, H.G. [Univ. of Washington, Seattle, WA (United States)

    1994-12-01

    This paper deals with compounds that are chiral-at least in part, due to isotope substitution-and their use in tracing the steric course of enzyme reaction in vitro and in vivo. There are other applications of isotopically chiral compounds (for example, in analyzing the steric course of nonenzymatic reactions and in probing the conformation of biomolecules) that are important but they will not be discussed in this context.

  15. Triaxial superdeformation in $^{40}$Ar

    CERN Document Server

    Taniguchi, Yasutaka; Kimura, Masaaki; Ikeda, Kiyomi; Horiuchi, Hisashi; Ideguchi, Eiji

    2010-01-01

    Superdeformed (SD) states in $^{40}$Ar have been studied using the deformed-basis antisymmetrized molecular dynamics. Low energy states were calculated by the parity and angular momentum projection (AMP) and the generator coordinate method (GCM). Basis wave functions were obtained by the energy variation with a constraint on the quadrupole deformation parameter $\\beta$, while other quantities such as triaxiality $\\gamma$ were optimized by the energy variation. By the GCM calculation, an SD band is obtained just above the ground state band. The SD band involves a $K^\\pi = 2^+$ side band due to the triaxiality. The calculated quadrupole electric transition strengths of the SD band reproduce well the experimental values. Triaxiality is significantly important to understand low-lying states.

  16. Ars grammatica de Dionisio Tracio

    Directory of Open Access Journals (Sweden)

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  17. K/Ar radiometric dating of basaltic rocks in Transdanubia, Hungary

    International Nuclear Information System (INIS)

    K/Ar datings were made on 39 types of Pliocene-Pleistocene basaltic rocks from Transdanubia, Hungary. The isotopic tracer technique and the isochron method for dating are presented. The radiometric data were evaluated in view of the geological position and petrographic type and character of the samples. In addition to the conventional K/Ar dates, the 40Ar/36Ar-K/36Ar isochron dates were also calculated for presumably cogenetic samples. According to the present determinations, the age of basalts erupted near Pula at the end of the middle part of the Upper Pannonian Formation is 4.15+-0.17 m.y. The basalts of some hills in the area could be assigned to the upper part of the Upper Pannonian Formation. The average K/Ar age of the Pleistocene basic volcanic rock at village Bar is 2.02+-0.14 m.y., and its isochron age is 2.11+-0.17 m.y. (author)

  18. Geometry behind chordal Loewner chains

    CERN Document Server

    Contreras, Manuel D; Gumenyuk, Pavel

    2010-01-01

    Loewner Theory is a deep technique in Complex Analysis affording a basis for many further important developments such as the proof of famous Bieberbach's conjecture and well-celebrated Schramm's Stochastic Loewner Evolution (SLE). It provides analytic description of expanding domains dynamics in the plane. Two cases have been developed in the classical theory, namely the {\\it radial} and the {\\it chordal} Loewner evolutions, referring to the associated families of holomorphic self-mappings being normalized at an internal or boundary point of the reference domain, respectively. Recently there has been introduced a new approach [arXiv:0807.1594v1, arXiv:0807.1715v1, arXiv:0902.3116v1] bringing together, and containing as quite special cases, radial and chordal variants of Loewner Theory. In the framework of this approach we address the question what kind of systems of simply connected domains can be described by means of Loewner chains of chordal type. As an answer to this question we establish a necessary and ...

  19. Calibration of cosmogenic noble gas production in ordinary chondrites based on 36Cl-36Ar ages. Part 1: Refined produced rates for cosmogenic 21Ne and 38Ar

    Science.gov (United States)

    Dalcher, N.; Caffee, M. W.; Nishiizumi, K.; Welten, K. C.; Vogel, N.; Wieler, R.; Leya, I.

    2013-10-01

    We measured the concentrations and isotopic compositions of He, Ne, and Ar in bulk samples and metal separates of 14 ordinary chondrite falls with long exposure ages and high metamorphic grades. In addition, we measured concentrations of the cosmogenic radionuclides 10Be, 26Al, and 36Cl in metal separates and in the nonmagnetic fractions of the selected meteorites. Using cosmogenic 36Cl and 36Ar measured in the metal separates, we determined 36Cl-36Ar cosmic-ray exposure (CRE) ages, which are shielding-independent and therefore particularly reliable. Using the cosmogenic noble gases and radionuclides, we are able to decipher the CRE history for the studied objects. Based on the correlation 3He/21Ne versus 22Ne/21Ne, we demonstrate that, among the meteorites studied, only one suffered significant diffusive losses (about 35%). The data confirm that the linear correlation 3He/21Ne versus 22Ne/21Ne breaks down at high shielding. Using 36Cl-36Ar exposure ages and measured noble gas concentrations, we determine 21Ne and 38Ar production rates as a function of 22Ne/21Ne. The new data agree with recent model calculations for the relationship between 21Ne and 38Ar production rates and the 22Ne/21Ne ratio, which does not always provide unique shielding information. Based on the model calculations, we determine a new correlation line for 21Ne and 38Ar production rates as a function of the shielding indicator 22Ne/21Ne for H, L, and LL chondrites with preatmospheric radii less than about 65 cm. We also calculated the 10Be/21Ne and 26Al/21Ne production rate ratios for the investigated samples, which show good agreement with recent model calculations.

  20. Radiogenic age and isotopic studies

    International Nuclear Information System (INIS)

    This is one of an annual collection of reports presenting data from the Geochronology Section of the Continental Geoscience Division of the Geological Survey of Canada (GSC). The main purpose of this collection is to make geochronological and other radiogenic isotope data produced by the section available promptly to the geological community. Reports make full presentation of the data, relate these to field settings and make comparatively short interpretations. Other geochronological and isotope data produced in the laboratory but published in outside journals or separate GSC publications are summarized at the end of this report. Report 5 contains 24 papers from most regions of Canada, but particularly from British Columbia. The Geochronology Laboratory has, over the years, provided substantial U-Pb dating for the Cordilleran Division of the Geological Survey of Canada in Vancouver, and the results of a number of these studies are presented this year. A compilation of K-Ar ages is given. (figs., tabs., refs.)

  1. Radiogenic age and isotopic studies

    International Nuclear Information System (INIS)

    This is one of an annual collection of reports presenting data from the Geochronology Section of the Continental Geoscience Division of the Geological Survey of Canada (GSC). The main purpose of this collection is to make geochronological and other radiogenic isotope data produced by the section available promptly to the geological community. Reports make full presentation of the data, relate these to field settings and make comparatively short interpretations. Other geochronological and isotope data produced in the laboratory but published in outside journals or separate GSC publications are summarized at the end of this report. Reports in this issue give U-Pb zircon ages for rocks in Newfoundland, Yukon Territory, Manitoba, Ontario, and the Northwest Territories; present a compilation of K-Ar ages; and discuss Precambrian activity in New Brunswick, the geochronology of rock from the Northwest Territories, and reconnaissance Nd studies of rocks from the Northwest Territories. (figs., tabs., refs.)

  2. Early paleozoic granitoid magmatism and metamorphism in Derbina microcontinent of East Sayan: new isotopic-geochronological data

    International Nuclear Information System (INIS)

    The results of of complex U-Pb, Ar-Ar and Sm-Nd geochronological and isotopic-geochemical studies of granitoids from the Derbina microcontinent located in the central part of the East Sayan are presented. The results of U-Pb dating of magmatic zircon (498 ± 5 mln. years) agree well with data of Ar-Ar dating for amphibole (507 ± 7 mln. years). The totality of the isotopic-geochronological data suggests repeated manifestations of the Early Paleozoic metamorphism and collision granite formation within the Derbina microcontinent

  3. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  4. IR multiphoton absorption of SF6 in flow with Ar at moderate energy fluences

    Science.gov (United States)

    Makarov, G. N.; Ronander, E.; van Heerden, S. P.; Gouws, M.; van der Merwe, K.

    1997-10-01

    IR multiple photon absorption (MPA) of SF6 in flow with Ar (SF6: Ar=1:100) in conditions of a large vibrational/rotational temperature difference (TV𪒮 K, TR䏐 K) was studied at moderate energy fluences from ۂ.1 to 𪐬 mJ/cm2, which are of interest for isotope selective two-step dissociation of molecules. A 50 cm Laval-type slit nozzle for the flow cooling, and a TEA CO2-laser for excitation of molecules were used in the experiments. The laser energy fluence dependences of the SF6 MPA were studied for several CO2-laser lines which are in a good resonance with the linear absorption spectrum of the Ƚ vibration of SF6 at low temperature. The effect of the laser pulse duration (intensity) on MPA of flow cooled SF6 with Ar was also studied. The results are compared with those obtained in earlier studies.

  5. Isotopic age determination in Bergslagen, Sweden. 1

    International Nuclear Information System (INIS)

    This paper is an introduction to a series of short communications 'Isotopic age determinations in Bergslagen, Sweden', which will be submitted to this journal. An earlier paper on K-Ar ages of hornblendes in skarns and metabasites in the Hjulsjoe area has been published elsewhere (Moorman et al., 1982). This joint research project of the ZWO-Laboratory of Isotope Geology and the Geological Institute University of Amsterdam forms part of the research program of the 'Stichting voor Isotopen-Geologisch Onderzoek', supported by the Netherlands Organization for the Advancement of Pure Research (Z.W.O.). (Auth.)

  6. Precision Mass Measurement of Argon Isotopes

    CERN Multimedia

    Lunney, D

    2002-01-01

    % IS388\\\\ \\\\ A precision mass measurement of the neutron-deficient isotopes $^{32,33,34}$Ar is proposed. Mass values of these isotopes are of importance for: a) a stringent test of the Isobaric-Multiplet- Mass-Equation, b) a verification of the correctness of calculated charge-dependent corrections as used in super-allowed $\\beta$- decay studies aiming at a test of the CVC hypothesis, and c) the determination of the kinematics in electron-neutrino correlation experiments searching for scalar currents in weak interaction. The measurements will be carried out with the ISOLTRAP Penning trap mass spectrometer.

  7. Spectroscopy of element 115 decay chains

    Energy Technology Data Exchange (ETDEWEB)

    Rudolph, Dirk [Lund University, Sweden; Forsberg, U. [Lund University, Sweden; Golubev, P. [Lund University, Sweden; Sarmiento, L. G. [Lund University, Sweden; Yakushev, A. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Andersson, L.-L. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Di Nitto, A. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Duehllmann, Ch. E. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Gates, J. M. [Lawrence Berkeley National Laboratory (LBNL); Gregorich, K. E. [Lawrence Berkeley National Laboratory (LBNL); Gross, Carl J [ORNL; Hessberger, F. P. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Herzberg, R.-D [University of Liverpool; Khuyagbaatar, J. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Kratz, J. V. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Rykaczewski, Krzysztof Piotr [ORNL; Schaedel, M. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Aberg, S. [Lund University, Sweden; Ackermann, D. [GSI-Hemholtzzentrum fur Schwerionenforschung, Darmstadt, Germany; Block, M. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Brand, H. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Carlsson, B. G. [Lund University, Sweden; Cox, D. [University of Liverpool; Derkx, X. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Eberhardt, K. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Even, J. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Fahlander, C. [Lund University, Sweden; Gerl, J. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Jaeger, E. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Kindler, B. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Krier, J. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Kojouharov, I. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Kurz, N. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Lommel, B. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Mistry, A. [University of Liverpool; Mokry, C. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Nitsche, H. [Lawrence Berkeley National Laboratory (LBNL); Omtvedt, J. P. [Paul Scherrer Institut, Villigen, Switzerland; Papadakis, P. [University of Liverpool; Ragnarsson, I. [Lund University, Sweden; Runke, J. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Schaffner, H. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Schausten, B. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Thoerle-Pospiech, P. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Torres, T. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Traut, T. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Trautmann, N. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Tuerler, A. [Paul Scherrer Institut, Villigen, Switzerland; Ward, A. [University of Liverpool; Ward, D. E. [Lund University, Sweden; Wiehl, N. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany

    2013-01-01

    A high-resolution a, X-ray and -ray coincidence spectroscopy experiment was conducted at the GSI Helmholtzzentrum fu r Schwerionenforschung. Thirty correlated a-decay chains were detected following the fusion-evaporation reaction 48Ca + 243Am. The observations are consistent with previous assignments of similar decay chains to originate from element Z = 115. The data includes first candidates of fingerprinting the decay step Mt --> Bh with characteristic X rays. For the first time, precise spectroscopy allows the derivation of excitation schemes of isotopes along the decay chains starting with elements Z > 112. Comprehensive Monte-Carlo simulations accompany the data analysis. Nuclear structure models provide a first level interpretation.

  8. The Coronae of AR Lac

    CERN Document Server

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  9. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    CERN Document Server

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  10. Calibration of Nu-Instruments Noblesse multicollector mass spectrometers for argon isotopic measurements using a newly developed reference gas

    Science.gov (United States)

    Coble, M.A.; Grove, M.; Calvert, A.T.

    2011-01-01

    ACs-2, FCs-2, and TCs-2 demonstrate that calculated 40Ar*/39ArK can be accurately corrected to yield model 40Ar/39Ar ages consistent with those reported by Earthtime 40Ar/39Ar laboratories. Replicate analyses of 8-12 single-crystal sanidine ages are reproduced to within 1-2??? (2?? standard error) under optimal analytical conditions. This calibration technique is applicable over a wide range of isotopic ratios and signal sizes. Finally, the reference gas has the added advantage of facilitating straightforward characterization of electron multiplier dead time over a wide dynamic range. ?? 2011 Elsevier B.V.

  11. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Science.gov (United States)

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  12. 39Ar-40Ar systematics of two millimeter-sized rock fragments from Mare Crisium

    International Nuclear Information System (INIS)

    Two small fragments, L24B, a glass-rich agglutinate (1.9mg) and L24A, a fine-grained lithic fragment (9.4mg), from the Luna 24 landing site have been neutron irradiated for the purpose of 39Ar-40Ar dating. A fairly well-defined 39Ar-40Ar plateau age of 3.65+-0.12 AE was found for the larger fragment. After appropriate corrections the composition of the trapped and spallogenic Ar could be deciphered. The evolution of 38Arsub(sp)/37Ar showed that 660 m.y. and 500 m.y. were the most reliable exposure ages for L24A and L24B, respectively. The Ti contents of <=0.6% determined by gamma-counting prior to the Ar analysis indicate both fragments being associated with the group of low-Ti or even very low-Ti basalts. (Auth.)

  13. 39Ar/Ar measurements using ultra-low background proportional counters

    Energy Technology Data Exchange (ETDEWEB)

    Hall, Jeter C.; Aalseth, Craig E.; Bonicalzi, Ricco; Brandenberger, Jill M.; Day, Anthony R.; Humble, Paul H.; Mace, Emily K.; Panisko, Mark E.; Seifert, Allen

    2016-01-08

    Age dating groundwater and seawater using 39Ar/Ar ratios is an important tool to understand water mass flow rates and mean residence time. For modern or contemporary argon, the 39Ar activity is 1.8 mBq per liter of argon. Radiation measurements at these activity levels require ultra low-background detectors. Low-background proportional counters have been developed at Pacific Northwest National Laboratory. These detectors use traditional mixtures of argon and methane as counting gas, and the residual 39Ar from commercial argon has become a predominant source of background activity in these detectors. We demonstrated sensitivity to 39Ar by using geological or ancient argon from gas wells in place of commercial argon. The low level counting performance of these proportional counters is then demonstrated for sensitivities to 39Ar/Ar ratios sufficient to date water masses as old as 1000 years.

  14. COX7AR is a Stress-inducible Mitochondrial COX Subunit that Promotes Breast Cancer Malignancy

    Science.gov (United States)

    Zhang, Kezhong; Wang, Guohui; Zhang, Xuebao; Hüttemann, Philipp P.; Qiu, Yining; Liu, Jenney; Mitchell, Allison; Lee, Icksoo; Zhang, Chao; Lee, Jin-sook; Pecina, Petr; Wu, Guojun; Yang, Zeng-quan; Hüttemann, Maik; Grossman, Lawrence I.

    2016-01-01

    Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, plays a key role in regulating mitochondrial energy production and cell survival. COX subunit VIIa polypeptide 2-like protein (COX7AR) is a novel COX subunit that was recently found to be involved in mitochondrial supercomplex assembly and mitochondrial respiration activity. Here, we report that COX7AR is expressed in high energy-demanding tissues, such as brain, heart, liver, and aggressive forms of human breast cancer cells. Under cellular stress that stimulates energy metabolism, COX7AR is induced and incorporated into the mitochondrial COX complex. Functionally, COX7AR promotes cellular energy production in human mammary epithelial cells. Gain- and loss-of-function analysis demonstrates that COX7AR is required for human breast cancer cells to maintain higher rates of proliferation, clone formation, and invasion. In summary, our study revealed that COX7AR is a stress-inducible mitochondrial COX subunit that facilitates human breast cancer malignancy. These findings have important implications in the understanding and treatment of human breast cancer and the diseases associated with mitochondrial energy metabolism. PMID:27550821

  15. A late Miocene-early Pliocene chain of lakes fed by the Colorado River: Evidence from Sr, C, and O isotopes of the Bouse Formation and related units between Grand Canyon and the Gulf of California

    Science.gov (United States)

    Roskowski, J.A.; Patchett, P.J.; Spencer, J.E.; Pearthree, P.A.; Dettman, D.L.; Faulds, J.E.; Reynolds, A.C.

    2010-01-01

    We report strontium isotopic results for the late Miocene Hualapai Limestone of the Lake Mead area (Arizona-Nevada) and the latest Miocene to early Pliocene Bouse Formation and related units of the lower Colorado River trough (Arizona-California-Nevada), together with parallel oxygen and carbon isotopic analyses of Bouse samples, to constrain the lake-overflow model for integration of the Colorado River. Sr iso topic analyses on the basal 1-5 cm of marl, in particular along a transect over a range of altitude in the lowest-altitude basin that contains freshwater, brackish, and marine fossils, document the 87Sr/86Sr of first-arriving Bouse waters. Results reinforce the similarity between the 87Sr/86Sr of Bouse Formation carbonates and present-day Colorado River water, and the systematic distinction of these values from Neogene marine Sr. Basal Bouse samples show that 87Sr/86Sr decreased from 0.7111 to values in the range 0.7107-0.7109 during early basin filling. 87Sr/86Sr values from a recently identified marl in the Las Vegas area are within the range of Bouse Sr ratios. 87Sr/86Sr values from the Hualapai Limestone decrease upsection from 0.7195 to 0.7137, in the approach to a time soon after 6 Ma when Hualapai deposition ceased and the Colorado River became established through the Lake Mead area. Bouse Formation ??18O values range from -12.9??? to +1.0??? Vienna Pee Dee belemnite (VPDB), and ??13C between -6.5??? and +3.4??? VPDB. Negative ??18O values appear to require a continental origin for waters, and the trend to higher ??18O suggests evaporation in lake waters. Sr and stable isotopic results for sectioned barnacle shells and from bedding planes of the marine fish fossil Colpichthys regis demonstrate that these animals lived in saline freshwater, and that there is no evidence for incursions of marine water, either long-lived or brief in duration. Lack of correlation of Sr and O isotopic variations in the same samples also argue strongly against systematic

  16. The readout system for the ArTeMis camera

    Science.gov (United States)

    Doumayrou, E.; Lortholary, M.; Dumaye, L.; Hamon, G.

    2014-07-01

    During ArTeMiS observations at the APEX telescope (Chajnantor, Chile), 5760 bolometric pixels from 20 arrays at 300mK, corresponding to 3 submillimeter focal planes at 450μm, 350μm and 200μm, have to be read out simultaneously at 40Hz. The read out system, made of electronics and software, is the full chain from the cryostat to the telescope. The readout electronics consists of cryogenic buffers at 4K (NABU), based on CMOS technology, and of warm electronic acquisition systems called BOLERO. The bolometric signal given by each pixel has to be amplified, sampled, converted, time stamped and formatted in data packets by the BOLERO electronics. The time stamping is obtained by the decoding of an IRIG-B signal given by APEX and is key to ensure the synchronization of the data with the telescope. Specifically developed for ArTeMiS, BOLERO is an assembly of analogue and digital FPGA boards connected directly on the top of the cryostat. Two detectors arrays (18*16 pixels), one NABU and one BOLERO interconnected by ribbon cables constitute the unit of the electronic architecture of ArTeMiS. In total, the 20 detectors for the tree focal planes are read by 10 BOLEROs. The software is working on a Linux operating system, it runs on 2 back-end computers (called BEAR) which are small and robust PCs with solid state disks. They gather the 10 BOLEROs data fluxes, and reconstruct the focal planes images. When the telescope scans the sky, the acquisitions are triggered thanks to a specific network protocol. This interface with APEX enables to synchronize the acquisition with the observations on sky: the time stamped data packets are sent during the scans to the APEX software that builds the observation FITS files. A graphical user interface enables the setting of the camera and the real time display of the focal plane images, which is essential in laboratory and commissioning phases. The software is a set of C++, Labview and Python, the qualities of which are respectively used

  17. Isotope Spectroscopy

    CERN Document Server

    Caffau, E; Bonifacio, P; Ludwig, H -G; Monaco, L; Curto, G Lo; Kamp, I

    2013-01-01

    The measurement of isotopic ratios provides a privileged insight both into nucleosynthesis and into the mechanisms operating in stellar envelopes, such as gravitational settling. In this article, we give a few examples of how isotopic ratios can be determined from high-resolution, high-quality stellar spectra. We consider examples of the lightest elements, H and He, for which the isotopic shifts are very large and easily measurable, and examples of heavier elements for which the determination of isotopic ratios is more difficult. The presence of 6Li in the stellar atmospheres causes a subtle extra depression in the red wing of the 7Li 670.7 nm doublet which can only be detected in spectra of the highest quality. But even with the best spectra, the derived $^6$Li abundance can only be as good as the synthetic spectra used for their interpretation. It is now known that 3D non-LTE modelling of the lithium spectral line profiles is necessary to account properly for the intrinsic line asymmetry, which is produced ...

  18. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  19. On mechanism of Ar(3p54p) states excitation in low-energy Ar-Ar collisions

    International Nuclear Information System (INIS)

    The present work is devoted to study of Ar(3p54p) states excitation in binary low-energy Ar-Ar collisions. The results of the experimental investigation of excitation cross sections of Ar I 4p'[l/2]1, 4p'[3/2]1, 4p'[3/2]2 and 4p[3/2]2 levels in the collision energy range from threshold up to 500 eV (cm) and degree of polarization for 4s[3/2]20-4p'[l/2]1 and 4s[3/2]20-4p[3/2]2 transitions in this energy range are represented.

  20. 40Ar/ 39Ar mineral ages from basement rocks in the Eastern Kunlun Mountains, NW China, and their tectonic implications

    Science.gov (United States)

    Liu, Yongjiang; Genser, Johann; Neubauer, Franz; Jin, Wei; Ge, Xiaohong; Handler, Robert; Takasu, Akira

    2005-04-01

    40Ar/ 39Ar dating and estimates of regional metamorphic P- T conditions were carried out on the basement rocks of the Eastern Kunlun Mountains, Western China. Samples from the Jinshuikou, Xiaomiao, Kuhai, Wanbaogou, and Nachitai groups revealed distinct metamorphic events and four age groups. The age group in the range from 363 to 439 Ma is interpreted to represent cooling after Middle Silurian-Late Devonian granulite(?) and amphibolite facies metamorphism, which is dominated by low-middle pressure/high temperature conditions. This tectono-thermal event is related to the closure of an oceanic basin or marginal sea. An age group of 212-242 Ma represents cooling after Triassic metamorphic overprint, which is probably associated with magmatic intrusions. This thermal event, together with the Permo-Triassic ophiolite zone along the South Kunlun Fault, relates to the closure of a major ocean (between India and Eurasia) and the eventual N-ward accretion of the Qiangtang block in Permo-Triassic times. The significance of the age group of 104-172 Ma may be related to the ductile deformation along the Xidatan fault due to the northward-directed accretion of the Lhasa block. Biotites from Nachitai record a partial isotopic resetting at ca. 32 Ma that is interpreted to represent a late-stage exhumation caused by further crustal shortening.

  1. Droplet Digital PCR Based Androgen Receptor Variant 7 (AR-V7) Detection from Prostate Cancer Patient Blood Biopsies

    Science.gov (United States)

    Ma, Yafeng; Luk, Alison; Young, Francis P.; Lynch, David; Chua, Wei; Balakrishnar, Bavanthi; de Souza, Paul; Becker, Therese M.

    2016-01-01

    Androgen receptor splice variant V7 (AR-V7) was recently identified as a valuable predictive biomarker in metastatic castrate-resistant prostate cancer. Here, we report a new, sensitive and accurate screen for AR-V7 mRNA expression directly from circulating tumor cells (CTCs): We combined EpCAM-based immunomagnetic CTC isolation using the IsoFlux microfluidic platform with droplet digital polymerase chain reaction (ddPCR) to analyze total AR and AR-V7 expression from prostate cancer patients CTCs. We demonstrate that AR-V7 is reliably detectable in enriched CTC samples with as little as five CTCs, even considering tumor heterogeneity, and confirm detection of AR-V7 in CTC samples from advanced prostate cancer (PCa) patients with AR-V7 detection limited to castrate resistant disease status in our sample set. Sensitive molecular analyses of circulating tumor cells (CTCs) or circulating tumor nucleic acids present exciting strategies to detect biomarkers, such as AR-V7 from non-invasive blood samples, so-called blood biopsies. PMID:27527157

  2. Droplet Digital PCR Based Androgen Receptor Variant 7 (AR-V7 Detection from Prostate Cancer Patient Blood Biopsies

    Directory of Open Access Journals (Sweden)

    Yafeng Ma

    2016-08-01

    Full Text Available Androgen receptor splice variant V7 (AR-V7 was recently identified as a valuable predictive biomarker in metastatic castrate-resistant prostate cancer. Here, we report a new, sensitive and accurate screen for AR-V7 mRNA expression directly from circulating tumor cells (CTCs: We combined EpCAM-based immunomagnetic CTC isolation using the IsoFlux microfluidic platform with droplet digital polymerase chain reaction (ddPCR to analyze total AR and AR-V7 expression from prostate cancer patients CTCs. We demonstrate that AR-V7 is reliably detectable in enriched CTC samples with as little as five CTCs, even considering tumor heterogeneity, and confirm detection of AR-V7 in CTC samples from advanced prostate cancer (PCa patients with AR-V7 detection limited to castrate resistant disease status in our sample set. Sensitive molecular analyses of circulating tumor cells (CTCs or circulating tumor nucleic acids present exciting strategies to detect biomarkers, such as AR-V7 from non-invasive blood samples, so-called blood biopsies.

  3. Chain reaction

    International Nuclear Information System (INIS)

    Chain Reaction is a work of recent American political history. It seeks to explain how and why America came to depend so heavily on its experts after World War II, how those experts translated that authority into political clout, and why that authority and political discretion declined in the 1970s. The author's research into the internal memoranda of the Atomic Energy Commission substantiates his argument in historical detail. It was not the ravages of American anti-intellectualism, as so many scholars have argued, that brought the experts back down to earth. Rather, their decline can be traced to the very roots of their success after World War II. The need to over-state anticipated results in order to garner public support, incessant professional and bureaucratic specialization, and the sheer proliferation of expertise pushed arcane and insulated debates between experts into public forums at the same time that a broad cross section of political participants found it easier to gain access to their own expertise. These tendencies ultimately undermined the political influence of all experts. (author)

  4. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    Index Scriptorium Estoniae

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  5. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Science.gov (United States)

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  6. Geochronology (40Ar/39Ar, K-Ar and He-exposure ages of Cenozoic magmatic rocks from Northern Chile (18-22°S: implications for magmatism and tectonic evolution of the central Andes

    Directory of Open Access Journals (Sweden)

    Gerhard Wörner

    2000-12-01

    Full Text Available K-Ar and Ar/Ar ages from magmatic rocks of northern Chile (18-22°S describe duration and extent of the Tertiary and Quaternary magmatic evolution and date major tectonic events in northernmost Chile. This paper summarizes new K-Ar and Ar-Ar mineral and whole rock ages for intrusive rocks from the Precordillera, Tertiary ignimbrites and andesitic stratovolcanoes from the Western Andean Escarpment at 18°S (WARP and the volcanic front. Intrusive rocks of the Precordillera (Quebrada Paguana, Quebrada Blanca, Quebrada Choja, Quebrada Guatacondo, Cerro Chandacolla represent the Cretaceous to Eocene magmatic arc system and gave ages between 45 and 35 Ma. Younger ages on intrusive rocks are invariably caused by deuteric alteration. Ignimbrites of the Putani and Oxaya formations gave Ar-Ar sanidine ages around 24.2 to 24.8 Ma and 22.8 to 19.4 Ma, respectively. Andesitic stratovolcanoes, which directly overlie Oxaya ignimbrites east of the Western Cordillera gave ages of 20.3 Ma (Cordon Quevilque to 9.0 Ma (Cerro Margarita. Samples from the Miocene to Pleistocene arc system on the Chilean Altiplano underlying the volcanoes of the active volcanic front have been dated between 10.5 to ~3 Ma. A widespread ignimbrite can be correlated from the Lauca basin to the Pacific coast and to the east to occurrences of near Pérez. Repeated Ar-Ar sanidine dating of the Lauca-Pérez-ignimbrite resulted in highly concordant ages of 2.71±0.25 Ma, 2.72 Ma±0.01 Ma, and 2.73±0.11 Ma. Rocks from the active chain (Volcanic Cordillera gave ages younger than 0.9 Ma (Volcán Irruputuncu, Volcán Olca, Volcán Aucanquilcha, Volcán Ollagüe, Volcán Poruñita. These new data are used to constrain Miocene stratigraphy and tectonic movements as well as the timing of uplift and sedimentary response at the Western Andean Escarpment within the framework of the tectonic evolution of the Central AndesGeocronología (49Ar/39Ar, K-Ar y edades He de exposición de rocas cenozoicas del

  7. 40Ar-39Ar Age of K-feldspar from K- feldspar Granite in the Qiaohuote Copper Deposit, Bayanbulak, Xinjiang, and Its Geological Significance

    Institute of Scientific and Technical Information of China (English)

    WANG Zhiliang; MAO Jingwen; YANG Jianmin; CHEN Wen; ZHANG Zuoheng

    2004-01-01

    By using the 40Ar-39Ar chronological method to date K-feldspar from K-feldspar granite in the Qiaohuote copper district, the authors obtained a plateau age of 274.78±0.44 Ma and an isochron age of 272.7±3.0 Ma. Because there is no tectonic deformation overprinted or hydrothermal alteration in the K-feldspar granite intrusion after its emplacement, the 40Ar-39Ar age represents the crystallization age of K-feldspar in K-feldspar granite, i.e. the late crystallization age of the K-feldspar granite intrusion, which indicates that the K-feldspar granite formed in the intraplate extensional stage during the Early Permian. Moreover, based on the spatial relationship between the K-feldspar granite intrusion and copper orebodies, variations of copper ore grade, REE characteristics of K-feldspar granite and copper ores, and H and O isotopic compositions of fluid inclusions in copper ores, the metallogenesis of the Qiaohuote copper deposit is directly related to intrusive activities of the K-feldspar granite, and thus the crystallization age of K-feldspar in the granite approximately approaches the metallogenic epoch of the Qiaohuote copper deposit.

  8. Ars ornata / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  9. "Ars Ornata" Mediterrania / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  10. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Index Scriptorium Estoniae

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  11. Petrogenesis of Miocene alkaline volcanic suites from western Bohemia. Whole rock geochemistry and Sr-Nd-Pb isotopic signatures.

    Czech Academy of Sciences Publication Activity Database

    Ulrych, Jaromír; Krmíček, Lukáš; Tomek, Č.; Lloyd, F. E.; Ladenberger, A.; Ackerman, Lukáš; Balogh, K.

    2106-01-01

    Roč. 76, č. 1 (2106), s. 77-93. ISSN 0009-2819 Institutional support: RVO:67985831 Keywords : Bohemian Massif * Cenozoic alkaline volcanism * Geochemistry * K-Ar ages * Sr-Nd-Pb isotopes Subject RIV: DD - Geochemistry

  12. Noble gas isotopic composi-tions of deep carbonate rocks from the Tarim Basin

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Abundances and isotopic compositions of noble gases (He, Ne, Ar, Kr) with various existence states in carbonate rocks from the Tacanl Well have been investigated by means of the stepwise heating technique. The elemental abundance patterns of noble gases in the samples show the enrichment of heavy noble gases and depletion of 20Ne relative to the atmosphere, which are designated as type- I and are similar to that observed in water, natural gases and sedimentary rocks. The 3He/4He ratios of deep carbonate samples at lower and medium temperature (300-700℃) and a majority of samples at higher temperature (1100-1500℃) steps are very similar to those of natural gases in the same strata in this area, this feature of radiogenic crustal helium shows that the Tazhong Uplift is relatively stable.However, significant helium and argon isotopic anomalies are found at the 1100℃ step in the Middle-Upper Ordoviclan carbonate rock, suggesting the incorporation of manfie-derived volatiles, this may be due to minor igneous minerals contained in sedimentary carbonate rocks. The 40Ar/36Ar ratios in the Cambrian carbonate rock are slightly higher than those in Ordovician carbonate rocks, which may reflect the influence of the chronologic accumulation effect of crust radiogenic 40Ar. Argon isotopes of various existence states in source rocks are much more different, both 38Ar/36Ar and 40Ar/36Ar ratios at the higher temperature steps are higher than those at the lower temperature steps.``

  13. Crater Chains

    Science.gov (United States)

    2003-01-01

    [figure removed for brevity, see original site] The large crater at the top of this THEMIS visible image has several other craters inside of it. Most noticeable are the craters that form a 'chain' on the southern wall of the large crater. These craters are a wonderful example of secondary impacts. They were formed when large blocks of ejecta from an impact crashed back down onto the surface of Mars. Secondaries often form radial patterns around the impact crater that generated them, allowing researchers to trace them back to their origin.Note: this THEMIS visual image has not been radiometrically nor geometrically calibrated for this preliminary release. An empirical correction has been performed to remove instrumental effects. A linear shift has been applied in the cross-track and down-track direction to approximate spacecraft and planetary motion. Fully calibrated and geometrically projected images will be released through the Planetary Data System in accordance with Project policies at a later time.NASA's Jet Propulsion Laboratory manages the 2001 Mars Odyssey mission for NASA's Office of Space Science, Washington, D.C. The Thermal Emission Imaging System (THEMIS) was developed by Arizona State University, Tempe, in collaboration with Raytheon Santa Barbara Remote Sensing. The THEMIS investigation is led by Dr. Philip Christensen at Arizona State University. Lockheed Martin Astronautics, Denver, is the prime contractor for the Odyssey project, and developed and built the orbiter. Mission operations are conducted jointly from Lockheed Martin and from JPL, a division of the California Institute of Technology in Pasadena.Image information: VIS instrument. Latitude 19.3, Longitude 347.5 East (12.5 West). 19 meter/pixel resolution.

  14. The mass of 32Ar and 33Ar for fundamental tests

    International Nuclear Information System (INIS)

    Masses of the short-lived radionuclides 32Ar (T1/2 = 98 ms) 33Ar (T1/2 = 173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10-8 (δm = 1.8 keV) and 1.4 x 10-8 (δm = 0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaricmultiplet mass equation IMME. Furthermore, the improved accuracy for the mass of 32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for 44Ar and 45Ar, and a 20σ deviation for 44Ar from the literature value was found and interpreted. (orig.)

  15. Dating blueschist metamorphism: a combined /sup 40/Ar//sup 39/Ar and electron microprobe approach

    Energy Technology Data Exchange (ETDEWEB)

    Sisson, V.B.; Onstott, T.C.

    1986-09-01

    /sup 40/Ar//sup 39/Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of /sup 40/Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (314/sup 0/ to 450/sup 0/C), however, is close to the estimated peak metamorphic temperatures (325/sup 0/ +- 50/sup 0/C), suggesting that phengite /sup 40/Ar//sup 39/Ar plateau dates may coincide closely with the time of blueschist metamorphism.

  16. The rare gases isotopes used in geophysical studies

    International Nuclear Information System (INIS)

    Rare gas isotopes are largely used in many studies regarding the different aspects of the geophysical and geochemical processes happening at geological and cosmological time scale. In the Herculane Spa area (southwestern part of Romania) there is a long and deep fissure following the Cerna river canyon as well as many transversal fissures. The geothermal water sources (springs), always accompanied by large amounts of gases, are met where these fissures cross. The presence of granite rocks at the surface is another remarkable characteristic of this area. Between 1980-1990 a series of measurements were made especially regarding the helium concentration in the gases released from these geothermal sources. Nitrogen and methane are the main components of released gases, and high helium and radon concentrations were also found. The composition of the gases was determined by using a Dempster mass spectrometer, and the radon from gases (together with the rate of exhalation from the ground) was determined by gamma spectrometry. The argon isotopes were analyzed by means of quadrupole mass spectrometer (AMP-4). Near transversal fissures, the radon exhalation rates have higher values compared to the other measurements in this area. The ratio 4 He/20 Ne > 400 is a very good indicator of the fact that these gases are pure (they do not contain atmospheric air) and they come from depth. The ratios 4 He/40 Ar and 40 Ar/36 Ar suggest that the helium in these sources may have a not negligible part of primordial helium arising from the earth mantle. Still, only the ratio 3 He/4 He can make difference. A table is given containing the ratios 4 He/20 Ne, 4 He/N2, 4 He/40 Ar, 40 Ar/N2, 40 Ar/36 Ar and 38 Ar/36 Ar as measured in four places from Cerna and Mehadica Valleys. (authors)

  17. Isotope chromato-spectral determination of carbon monoxide in pure inorganic gases

    International Nuclear Information System (INIS)

    Application of isotope-chromato-spectral method for determination of carbon monoxide impurities in pure He, Ne, Ar, N2 and H2 is considered. Isotopic dilution of a sample of the gas under analysis is performed using carbon monoxide enriched by 13C with source relative isotope concentration 12C/13C=0.39. Limits of determining CO in gases by the method indicated make up nx(10-7-10-6) %

  18. Isotope uptake dynamics in the Ostwald ripening model of recrystallization

    OpenAIRE

    Lakshtanov, Evgeny; Lakshtanov, Leonid

    2011-01-01

    The article is withdrawn since we decided not to publish it in the present form but to divide it in two parts. One of these parts concerns the mathematical aspects of Return Radius calculation and the rewritten article is already available arXiv:1201.4492 The second part will discuss the modelling of the Isotope Uptake and is still in preparation

  19. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    DEFF Research Database (Denmark)

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian...... retrograde chlorite formation. We conclude that even very minor chloritisation of biotite is apparently a more effective parameter than temperature in resetting the Ar clock, as is the formation of plagioclase from paragonite decomposition. Multi-equilibrium thermobarometry is necessary to ensure that...

  20. 40Ar/39Ar age and thermal history of the Kirin chondrite

    International Nuclear Information System (INIS)

    The Kirin meteorite, a large (> 2800 kg) H5 chondrite, fell in Kirin Province, China in 1976. A sample from each of the two largest fragments (K-1. K-2) yield 40Ar/39Ar total fusion ages of 3.63 +- 0.02 b.y. and 2.78 +- 0.02 b.y. respectively. 40Ar/40Ar age spectra show typical diffusional argon loss profiles. Maximum apparent ages of 4.36 b.y. (K-1) and approx. 4.0 b.y. (K-2) are interpreted as possible minimum estimates for the age of crystallization of the parent body. (orig./ME)

  1. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  2. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    International Nuclear Information System (INIS)

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  3. Graphs: Associated Markov Chains

    OpenAIRE

    Murthy, Garimella Rama

    2012-01-01

    In this research paper, weighted / unweighted, directed / undirected graphs are associated with interesting Discrete Time Markov Chains (DTMCs) as well as Continuous Time Markov Chains (CTMCs). The equilibrium / transient behaviour of such Markov chains is studied. Also entropy dynamics (Shannon entropy) of certain structured Markov chains is investigated. Finally certain structured graphs and the associated Markov chains are studied.

  4. The thermal significance of potassium feldspar K-Ar ages inferred from 40Ar/39Ar age spectrum results

    International Nuclear Information System (INIS)

    40Ar/39Ar age spectrum analyses of three microcline separates from the Separation Point Batholith, northwest Nelson, New Zealand, which cooled slowly through the temperature zone of partial radiogenic 40Ar accumulation are characterized by a linear age increase over the first 65 percent of gas release with the lowest ages corresponding to the time that the samples cooled below about 1000C. The last 35 percent of 39Ar released from the microclines yields plateau ages which reflect the different bulk mineral ages, and correspond to cooling temperatures between about 130 to 1600C. Theoretical calculations confirm the likelihood of diffusion gradients in feldspars cooling at rates =0C-Ma-1. Diffusion parameters calculated from the 39Ar release yield an activation energy, E = 28.8 +- 1.9 kcal-mol-1, and a frequency factor/grain size parameter, D0/l2 = 5.6sub(-3.9)sup(+14) sec-1. This Arrhenius relationship corresponds to a closure temperature of 132 +- 130C which is very similar to the independently estimated temperature. From the observed diffusion compensation correlation, this D0/l2 implies an average diffusion half-width of about 3 μm, similar to the half-width of the perthite lamellae in the feldspars. The results are discussed. (author)

  5. 40Ar/ 39Ar mineral ages within metamorphic clasts from the Kuma Group (Eocene), central Shikoku, Japan: Implications for tectonic development of the Sambagawa accretionary prism

    Science.gov (United States)

    Takasu, A.; Dallmeyer, R. D.

    1992-06-01

    The Sambagawa metamorphic belt exposed in central Shikoku records a high- P/T metamorphism. It is comprised by the Oboke nappe and the structurally overlying, internally imbricated Besshi nappe complex. The Besshi nappe complex locally is unconformably overlain by the Kuma Group (Eocene) which consists of conglomerates and subordinate sandstones and mudstones. Clasts within Kuma conglomerates exposed in the Kamegamori district include low-grade schists (derived from the unconformably underlying Sambagawa complex) and high-grade metamorphic rocks of uncertain provenance (including garnet-amphibolite and oligoclase-bearing pelitic schist). 36Ar/ 40Ar vs. 39Ar/ 40Ar isotope correlation ages recorded by hornblende from two amphibolite clasts are 131.1 ± 4.9 Ma and 156.8 ± 4.3 Ma. These are interpreted to date post-metamorphic cooling through temperatures required for intracrystalline retention of argon, and are older than cooling ages previously reported from any presently exposed segments of the Sambagawa terrane. Plateau ages of 108.8 ± 0.7 Ma and 115.7 ± 0.6 Ma are recorded by muscovite from two clasts of schist. Muscovite within a proximal basement exposure of unconformably underlying Sambagawa pelitic schist records a plateau age of 78.7 ± 0.5 Ma. Combined with isotopic ages previously reported for the Sambagawa terrane, 40Ar/ 39Ar data from clasts in the Kuma Group suggest that metamorphic culmination within a high-grade source terrane occured at c. 185-145 Ma. Sectors of this complex cooled through c. 500°C at c. 150 Ma. Other portions cooled through c. 500°C at c. 130 Ma. Contrasts in the cooling ages likely reflect internal imbrication within the source terrane. The Besshi nappe complex reached peak metamorphic conditions at c. 100-90 Ma and experienced relatively rapid uplift and cooling at c. 85-75 Ma. The Besshi nappe complex was structurally emplaced onto the Oboke nappe which attained peak metamorphic conditions at c. 75 Ma. Subsequently, the

  6. ORIP-21 computer programs for isotope transmutation simulations

    International Nuclear Information System (INIS)

    ORIP-XXI software suite is developed for the study of radioactive and stable isotope transmutation chains, i.e. nuclide networks with possible feedbacks. Using the programs from this suite it is possible to estimate various quantitative characteristics of a nuclide transmutation chain, both undergoing irradiation in neutron fluxes and in case of spontaneous radioactive decays. The main programs of ORIP-XXI software are: the electronic nuclide chart NKE, the program for finding chains of nuclear transmutations ChainFinder, and the program for full simulation of nuclide production in a nuclear reactor ChainSolver. Only the open-source subprograms and licensed software products were used in the coding. NKE, ChainFinder, and ChainSolver codes are accessible via NEA OECD Computer Program Service. All programs use a common data file, which contains nuclear constants and decay data for more than 2800 nuclides with atomic weights from 1 up to 293 (nuclear charge from 1 up to 118) and characteristics of chemical elements. The file also includes data on fission product yields for thermal and fast neutron induced fission of 22 heavy isotopes. ChainSolver allows users to take into account neutron flux depression and self-shielding factors. Self-shielding factor calculations in the intermediate resonance approximation are based on additional data from the resolved resonance parameters file. All data are obtained from freely available public nuclear data libraries. The data may be edited as necessary for carrying out isotope concentration calculations. After calculations are finished, various characteristics are calculated based on the estimated isotope densities: isotope masses, element masses, isotope activities, isotope parts, mass yields, depression coefficients, self-shielding factors, and fission energy deposition estimates at all time steps. (authors)

  7. Measurement of 37Ar to support technology for On-site Inspection under the Comprehensive Nuclear-Test-Ban Treaty

    OpenAIRE

    Aalseth, C. E.; Day, A R; Haas, D A; Hoppe, E. W.; Hyronimus, B. J.; Keillor, M. E.; Mace, E. K.; Orrell, J. L.; A. Seifert; Woods, V. T.

    2010-01-01

    On-Site Inspection (OSI) is a key component of the verification regime for the Comprehensive Nuclear-Test-Ban Treaty (CTBT). Measurements of radionuclide isotopes created by an underground nuclear explosion are a valuable signature of a Treaty violation. Argon-37 is produced from neutron interaction with calcium in soil, 40Ca(n,{\\alpha})37Ar. For OSI, the 35-day half-life of 37Ar provides both high specific activity and sufficient time for completion of an inspection before decay limits sensi...

  8. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    OpenAIRE

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  9. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian; Hilgen, Frederik; Kuiper, Klaudia

    sanidine age of 0.7674±0.0022 Ma (2σ, external errors) is indistinguishable from the ID-TIMS U/Pb zircon age (0.7671±0.0019 Ma). The consistency between the astronomically calibrated 40Ar/39Ar sanidine age and U/Pb zircon age for this Quaternary unit suggests that agreement between these two radio...

  10. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    International Nuclear Information System (INIS)

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  11. 胶东金青顶金矿床成矿流体来源的黄铁矿微量元素及He-Ar同位素证据%Trace element and He-Ar isotopic evidence of pyrite for the source of oreforming fluids in the Jinqingding gold deposit, eastern Shandong Province

    Institute of Scientific and Technical Information of China (English)

    张运强; 李胜荣; 陈海燕; 张秀宝; 周起凤; 崔举超; 宋玉波; 郭杰

    2012-01-01

    The Jinqingding gold deposit with identified reserves of more than 50t is currently the largest lode gold deposit in terms of single vein gold resources and is also a superlarge gold deposit located in the middle part of the Muping- Rushan gold belt in Jiaodong; nevertheless, the genetic type and source of ore-forming fluids in the gold deposit constitute a problem that needs urgent solution. A study of trace elements and REE compositions and features of gold-bearing pyrite from No. II ore body of the Jinqingding gold deposit reveals that the pyrite displays hydrothermal characteristics with Co/Ni ratios from 2.317 to 11.734 (7.17 on average). The HFSE indicates that the ore-forming fluid originally belonged to the F-rich system and generally evolved into the Cl- rich system at the chief metallogenic stage, and the distribution patterns of REE shows that the source of matallogenic materials was not mainly from Mesozoic Kunyunshan monzonitic granite. According to an analysis of the characteristic parameters (3He/4He =0.1-2.2 Ra (0.60 Ra on average)),40Ar/36Ar =462.7-1507.5 (831 on average), it is considered that the source of matallogenic materials was mainly derived from the lower crust and was contaminated by meteoric water during the intrusion, and the mantle fluids were involved in the metallogenic process.%金青顶金矿床是目前国内最大的石英单脉型金矿,其金储量超过50 t,规模为大型.对该矿床成矿流体性质和来源的研究十分必要.笔者通过Ⅱ号矿体主要载金矿物黄铁矿微量元素的研究发现,其Co/Ni为2.317~11.734(平均7.17),显示主要为热液成因;高场强元素(HFSE)特征显示,成矿早期以富F流体为主,主成矿期以富C1流体为主;稀土配分模式显示成矿物质并不是直接来源于围岩昆嵛山二长花岗岩.对黄铁矿流体包裹体He、Ar同位素特征的研究表明,3He/4He、40Ar/36Ar分别为0.1~2.2 Ra(平均值0.60 Ra),462.7~1 507.5(平均值831),显示成

  12. K/Ar ages from basal gneiss region

    International Nuclear Information System (INIS)

    K/Ar and 40Ar/39Ar geochronology of minerals from the Stadlandet region, Norway, is complicated by the presence of excess 40Ar in many samples. There is a correlation between excess 40Ar concentration and textural occurrence of samples. Amphiboles and micas closely accociated with eclogite pods are likely to contain significant concentrations of excess 40Ar, while samples from the country rocks are not. K/Ar and 40Ar/39Ar ages for hornblende from the country rocks suggest that post-metamorphic cooling through 5000C occured about 410 Ma ago, shortly after eclogite formation. Biotites containing no excess 40Ar cooled through 3000C about 370 Ma ago. A post-metamorphic cooling rate of about 50C/Ma can be inferred

  13. Ar-41 measurements and nuclear emergency preparedness

    International Nuclear Information System (INIS)

    During the early phase of an emergency is necessary to confirm the release of radioactivity predictions made by the operator of the nuclear plant. In this context, it has begun measuring Ar-41 in the vicinity of a research reactor. Since the Ar-41 is produced in the reactor, it has been studied as a good way to validate the air dispersion model used in nuclear emergencies and to develop a method to improve the characterization of the release. For this latter purpose a pilot experiment was conducted to determine computational and experimental methods, the flux of 1.29 MeV of Ar-41 and compared to evaluate the accuracy of the assessments made. This paper describes meteorological forecasting systems used in the experiment, the estimate of the stability class and the concentration of nuclides using a calculation code developed by the ARN, as well as the methodology and equipment used for measurement in the field. (authors)

  14. Improved Ar(II) transition probabilities

    OpenAIRE

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  15. Online Scene Modeling for Interactive AR Applications

    OpenAIRE

    Yoo, Jaesang; Cho, Kyusung; Jung, Jinki; Yang, Hyun S.

    2010-01-01

    Augmented reality applications require 3D model of environment to provide even more realistic experience. Unfortunately, however, most of researches on 3D modeling have been restricted to an offline process up to now, which conflicts with characteristics of AR such as realtime and online experience. In addition, it is barely possible not only to generate 3D model of whole world in advance but also trasfer the burden of 3D model generation to a user, which limits the usability of AR. Thus, it ...

  16. AR-扩增实境

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  17. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Science.gov (United States)

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  18. Dynamics of helix-coil transition and isotope exchange reaction

    International Nuclear Information System (INIS)

    A dynamical theory is presented for the helix-coil transition and the isotope exchange reaction in a short polypeptide chain. In this theory it is assumed that there is always one and only one helical sequence. The boundaries of the helix are assumed to move randomly along the chain. If we assume slow movement of the boundaries, our model theory explains the experimental results, i.e., the very low rate of the isotope exchange in the central portion of the chain and the site dependence of the rate. (author)

  19. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Science.gov (United States)

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  20. Retrograde metamorphism of the eclogite in North Qaidam, western China:Constraints by joint 40Ar/39Ar in vacuo crushing and stepped heating

    Institute of Scientific and Technical Information of China (English)

    Rongguo Hu; Jan Wijbrans; Fraukje Brouwer; Linghao Zhao; Min Wang; Huaning Qiu

    2015-01-01

    Two amphiboles and a syn-metamorphic quartz vein from the Yuka terrane, North Qaidam, western China, have been analyzed by joint 40Ar/39Ar crushing in vacuo and stepwise heating techniques. The crushing in vacuo results provide information to directly constrain the timing of fluid activity and the age of amphibolite-facies retrogression. The stepwise heating results could further be used to decipher the thermal history of the UHP rocks. Amphiboles from amphibolites and quartz vein within garnet-amphibolite lens analyzed by in vacuo crushing yield similarly shaped age spectra and exhibit rela-tively flat age plateaus for the last several steps. The characteristics of gas release patterns and geochronological data testify to the presence of significant excess 40Ar within the fluid inclusions. The age plateaux with weighted mean ages (WMA) ranges from 488 to 476 Ma for amphiboles and 403 Ma for quartz (2s). These data points constitute amphibole WMA yielding excellent isochrons with isochron ages of 469 and 463 Ma with initial 40Ar/36Ar ratios of 520 and 334, respectively. The isochron ages are interpreted to represent initial amphibolite-facies retrogression. The data points constituting the quartz age plateaux give an isochron age of 405 Ma with initial 40Ar/36Ar ratio of 295, recording a significant aqueous fluid flow episode during the early Devonian. Age spectra obtained by stepwise heating of amphibole residues remaining after crushing experiments are characterized by younger and relatively complex age spectra, which are probably influenced by the combined effects of resetting argon and/or mineral inclusions. Nevertheless, we note that the spectra shapes have features in common: excluding the last two steps, minimum apparent ages are found at temperatures of around 500 ?C, corresponding to 319 and 249 Ma, perhaps representing the time of isotopic resetting or resulting from release gas from mineral inclusions of, e.g., biotite or feldspar. Maximum apparent ages

  1. Health supply chain management.

    Science.gov (United States)

    Zimmerman, Rolf; Gallagher, Pat

    2010-01-01

    This chapter gives an educational overview of: * The actual application of supply chain practice and disciplines required for service delivery improvement within the current health environment. * A rationale for the application of Supply Chain Management (SCM) approaches to the Health sector. * The tools and methods available for supply chain analysis and benchmarking. * Key supply chain success factors. PMID:20407173

  2. Silicone chain extender

    DEFF Research Database (Denmark)

    2015-01-01

    The present invention relates to a silicone chain extender, more particularly a chain extender for silicone polymers and copolymers, to a chain extended silicone polymer or copolymer and to a functionalized chain extended silicone polymer or copolymer, to a method for the preparation thereof and...

  3. Nuclides and isotopes. Twelfth edition

    International Nuclear Information System (INIS)

    This explanatory booklet was designed to be used with the Chart of the Nuclides. It contains a brief history of the atomic theory of matter: ancient speculations, periodic properties of elements (Mendeleev table), radioactivity, early models of atomic structure, the Bohr atom, quantum numbers, nature of isotopes, artificial radioactivity, and neutron fission. Information on the pre-Fermi (natural) nuclear reactor at Oklo and the search for superheavy elements is given. The booklet also discusses information presented on the Chart and its coding: stable nuclides, metastable states, data display and color, isotopic abundances, neutron cross sections, spins and parities, fission yields, half-life variability, radioisotope power and production data, radioactive decay chains, and elements without names. The Periodic Table of the Elements is appended. 3 figures, 3 tables

  4. Pairing effects in Sn isotopes

    International Nuclear Information System (INIS)

    An extensive study of pairing effects in the Sn isotopes is carried out. The pairing Hamiltonian is treated by the chain-calculation method which provides practically exact solutions while involving less computational work than a complete-basis diagonalization. The coupling strength is fixed by reproducing the energy of the 9- state in 116Sn, while the single-particle energies have been determined by an analysis of the experimental low-energy spectra of the odd-A isotopes. A detailed comparison of the calculated results with experimental data evidences the importance of neutron pairing correlations in the 50-82 shell. The results of this paper complement those of our previous study of the N=82 isotones. It turns out that the role of pairing correlations is similar to a large extent in both cases. (orig.)

  5. Pairing effects in Sn isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Andreozzi, F. [Naples Univ. (Italy). Dipt. di Scienze Fisiche]|[Istituto Nazionale di Fisica Nucleare, Naples (Italy); Coraggio, L. [Naples Univ. (Italy). Dipt. di Scienze Fisiche]|[Istituto Nazionale di Fisica Nucleare, Naples (Italy); Covello, A. [Naples Univ. (Italy). Dipt. di Scienze Fisiche]|[Istituto Nazionale di Fisica Nucleare, Naples (Italy); Gargano, A. [Naples Univ. (Italy). Dipt. di Scienze Fisiche]|[Istituto Nazionale di Fisica Nucleare, Naples (Italy); Porrino, A. [Naples Univ. (Italy). Dipt. di Scienze Fisiche]|[Istituto Nazionale di Fisica Nucleare, Naples (Italy)

    1996-04-01

    An extensive study of pairing effects in the Sn isotopes is carried out. The pairing Hamiltonian is treated by the chain-calculation method which provides practically exact solutions while involving less computational work than a complete-basis diagonalization. The coupling strength is fixed by reproducing the energy of the 9{sup -} state in {sup 116}Sn, while the single-particle energies have been determined by an analysis of the experimental low-energy spectra of the odd-A isotopes. A detailed comparison of the calculated results with experimental data evidences the importance of neutron pairing correlations in the 50-82 shell. The results of this paper complement those of our previous study of the N=82 isotones. It turns out that the role of pairing correlations is similar to a large extent in both cases. (orig.)

  6. Using Isotopes for Design and Monitoring of Artificial Recharge Systems

    International Nuclear Information System (INIS)

    Over the past years, the IAEA has provided support to a number of Member States engaged in the implementation of hydrological projects dealing with the design and monitoring of artificial recharge (AR) systems, primarily situated in arid and semiarid regions. AR is defined as any engineered system designed to introduce water to, and store water in, underlying aquifers. Aquifer storage and recovery (ASR) is a specific type of AR used with the purpose of increasing groundwater resources. Different water management strategies have been tested under various geographical, hydrological and climatic regimes. However, the success of such schemes cannot easily be predicted, since many variables need to be taken into account in the early stages of every AR project. As often occurs in the case of the assessment and management of groundwater and aquifers, information on hydrological behaviour and response to human-made actions is difficult to obtain and often very costly, especially if only conventional hydrological methods are used. Classical methods in AR and ASR are meant to provide information on changes in the volume and quality of the artificially introduced water to ensure its sustainability. Although the use of isotopes and geochemical tracers to plan and monitor AR and ASR has been limited, there is a growing number of publications reporting the successful application of tracers in the different phases of AR and ASR schemes. This publication discusses several theoretical aspects important to the understanding, planning and monitoring of AR and ASR schemes and presents a selected number of examples illustrating the usefulness of isotopes and other tracers. One section presents the list of available isotope tracers, indicating the type of information that can be obtained from each. The case studies presented in this publication illustrate the use of these tools in the different stages of AR and ASR schemes. The publication is expected to be of interest to hydrologists

  7. Seasonal Variation in Stable Carbon and Nitrogen Isotope Values of Bats Reflect Environmental Baselines

    OpenAIRE

    Popa-Lisseanu, Ana G.; Kramer-Schadt, Stephanie; Quetglas, Juan; Delgado Huertas, Antonio; Kelm, Detlev H.; Ibáñez, Carlos

    2015-01-01

    The stable carbon and nitrogen isotope composition of animal tissues is commonly used to trace wildlife diets and analyze food chains. Changes in an animal’s isotopic values over time are generally assumed to indicate diet shifts or, less frequently, physiological changes. Although plant isotopic values are known to correlate with climatic seasonality, only a few studies restricted to aquatic environments have investigated whether temporal isotopic varia-tion in consumers may a...

  8. Study of Ar and Ar-CO2 microwave surfaguide discharges by optical spectroscopy

    Science.gov (United States)

    Silva, Tiago; Britun, Nikolay; Godfroid, Thomas; van der Mullen, Joost; Snyders, Rony

    2016-05-01

    A surfaguide microwave discharge operating at 2.45 GHz in Ar and Ar-CO2 mixtures is studied using diagnostics methods based on optical emission spectroscopy. The population densities of Ar metastable and resonant states of the lowest group of excited levels ( 1 s x ) are investigated for several experimental conditions using the self-absorption technique. It is found that the densities of these levels, ranging from 1017 to 1016 m-3 for the pure Ar case, are dependent on the discharge pressure and applied power. The electron temperature and electron density are calculated via the balances of creation/loss mechanisms of radiative and metastable levels. In the range of the studied experimental conditions (50-300 W of applied power and 0.5-6 Torr of gas pressure), the results have shown that lower values of electron temperature correspond to higher values of power and pressure in the discharge. Adding CO2 to the argon plasma results in a considerable decrease (about 3 orders of magnitude) of the Ar metastable atom density. The feasibility of using the ratio of two Ar emission line intensities to measure the electron temperature in CO2 discharges with small Ar admixtures is studied.

  9. Loewner Theory in annulus II: Loewner chains

    CERN Document Server

    Contreras, Manuel D; Gumenyuk, Pavel

    2011-01-01

    Loewner Theory, based on dynamical viewpoint, proved itself to be a powerful tool in Complex Analysis and its applications. Recently Bracci et al [Bracci et al, to appear in J. Reine Angew. Math. Available on ArXiv 0807.1594; Bracci et al, Math. Ann. 344(2009), 947--962; Contreras et al, Revista Matematica Iberoamericana 26(2010), 975--1012] have proposed a new approach bringing together all the variants of the (deterministic) Loewner Evolution in a simply connected reference domain. This paper is devoted to the construction of a general version of Loewner Theory for the annulus launched in [ArXiv 1011.4253]. We introduce the general notion of a Loewner chain over a system of annuli and obtain a 1-to-1 correspondence between Loewner chains and evolution families in the doubly connected setting similar to that in the Loewner Theory for the unit disk. Futhermore, we establish a conformal classification of Loewner chains via the corresponding evolution families and via semicomplete weak holomorphic vector fields...

  10. Sm-Nd and Ar-Ar Studies of DHO 908 and 489: Implications for Lunar Crustal History

    Science.gov (United States)

    Nyquist, L. E.; Shih, C. Y.; Reese, Y. D.; Park, J.; Bogard, D. D.; Garrison, D. H.; Yamaguchi, A.

    2011-01-01

    It is widely assumed that ferroan anorthosites (FANs) formed as flotation cumulates on a global lunar magma ocean (LMO). A corollary is that all FANs are approximately contemporaneous and formed with the same initial Nd-143/Nd-144 ratio. Indeed, a whole rock isochron for selected FANs (and An93 anorthosite) yields an isochron age of 4.42 +/- 0.13 Ga and initial Nd-143/Nd-144, expressed in epsilon-units, of epsilon(sub Nd,CHUR) = 0.3+/-0.3 relative to the CHondritic Uniform Reservoir , or epsilon(sub Nd,HEDPB)=-0.6+/-0.3 relative to the HED Parent Body. These values are in good agreement with the age (T) = 4.47+/-0.07 Ga, and epsilon(sub Nd,HEDPB) =-0.6 +/- 0.5 for FAN 67075. We also have studied anorthositic clasts in the Dhofar 908 and 489 lunar highland meteorites containing clasts of magnesian anorthosites (MAN) with Mg# approximately 75. Because of their relatively high Mg#, magnesian anorthosites should have preceded most FANs in crystallization from the LMO if both are LMO products. Thus, it is important to determine whether the Nd-isotopic data of MAN and FAN are consistent with a co-magmatic origin. We previously reported Sm-Nd data for white clast Dho 908 WC. Mafic minerals in this clast were too small to be physically separated for an isochron. However, we estimated initial Nd-143/Nd-144 for the clast by combining its bulk ("whole rock") Sm-Nd data with an Ar-39-Ar-40 age of 4.42+/-.04 Ga. Here we report additional Sm-Nd data for bulk samples of Dho 908 and its pair Dho 489.

  11. Hazard evaluation for 244-AR vault facility

    International Nuclear Information System (INIS)

    This document presents the results of a hazard identification and evaluation performed on the 244-AR Vault Facility to close a USQ (USQ No. TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed in HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities

  12. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Index Scriptorium Estoniae

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  13. Lignocellulosic Biofuels: Bioenergy Research at ARS

    Science.gov (United States)

    The growth and long-term viability of bioenergy production in the Nation are impeded by a number of technical and commercial barriers. Agricultural Research Service (ARS) addresses technical barriers and does so by leveraging its strengths and unique capabilities to (1) pursue technical barriers th...

  14. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    International Nuclear Information System (INIS)

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  15. A compilation of 40Ar-39 and K-Ar ages: report 25

    International Nuclear Information System (INIS)

    Twenty-three 40Ar-39Ar age determinations (including two potassium-argon analyses) carried out by the Geological Survey of Canada are reported. Each age determination is accompanied by a description of the rock and mineral concentrate used; brief interpretative comments regarding the geological significance of each age are also provided where possible. The experimental procedures employed are described in outline. An index of all Geological Survey of Canada K-Ar age determinations published in this format has been prepared using NTS quadrangles as the primary reference. (author). 6 refs., 2 tabs., 1 fig

  16. The ChArMEx database

    Science.gov (United States)

    Ferré, Hélène; Belmahfoud, Nizar; Boichard, Jean-Luc; Brissebrat, Guillaume; Cloché, Sophie; Descloitres, Jacques; Fleury, Laurence; Focsa, Loredana; Henriot, Nicolas; Mière, Arnaud; Ramage, Karim; Vermeulen, Anne; Boulanger, Damien

    2015-04-01

    The Chemistry-Aerosol Mediterranean Experiment (ChArMEx, http://charmex.lsce.ipsl.fr/) aims at a scientific assessment of the present and future state of the atmospheric environment in the Mediterranean Basin, and of its impacts on the regional climate, air quality, and marine biogeochemistry. The project includes long term monitoring of environmental parameters , intensive field campaigns, use of satellite data and modelling studies. Therefore ChARMEx scientists produce and need to access a wide diversity of data. In this context, the objective of the database task is to organize data management, distribution system and services, such as facilitating the exchange of information and stimulating the collaboration between researchers within the ChArMEx community, and beyond. The database relies on a strong collaboration between ICARE, IPSL and OMP data centers and has been set up in the framework of the Mediterranean Integrated Studies at Regional And Locals Scales (MISTRALS) program data portal. ChArMEx data, either produced or used by the project, are documented and accessible through the database website: http://mistrals.sedoo.fr/ChArMEx. The website offers the usual but user-friendly functionalities: data catalog, user registration procedure, search tool to select and access data... The metadata (data description) are standardized, and comply with international standards (ISO 19115-19139; INSPIRE European Directive; Global Change Master Directory Thesaurus). A Digital Object Identifier (DOI) assignement procedure allows to automatically register the datasets, in order to make them easier to access, cite, reuse and verify. At present, the ChArMEx database contains about 120 datasets, including more than 80 in situ datasets (2012, 2013 and 2014 summer campaigns, background monitoring station of Ersa...), 25 model output sets (dust model intercomparison, MEDCORDEX scenarios...), a high resolution emission inventory over the Mediterranean... Many in situ datasets

  17. Isotope ratio measurement of uranium in safeguards environmental samples by inductively-coupled plasma mass spectrometry (ICP-MS)

    International Nuclear Information System (INIS)

    In order to measure isotope ratio of uranium in safeguards environmental samples with ICP-MS precisely, production of polyatomic ions of IrAr, PtAr and AuAr was measured and mass bias of ICP-MS is investigated by using isotopic standards of uranium and lead. The intensities of IrAr, PtAr and AuAr relative to the atomic ions were found to be 1.8 x 10-6, 1.6 x 10-5 and 4.1 x 10-5, respectively. The production of 193Ir40Ar is too small to interfere with the measurement of 233U, if the concentration of Ir is the same level as that of 233U. However, there is possibility that the presence of Pt and Au interferes with the measurement of minor isotopes of uranium and 237Np. On the other hand, the mass biases of 235U/238U and 208Pb/206Pb were measured with the parameter of 238U16O/238U. Since unexpected change of the mass bias during measurements causes frequently erroneous results, the monitoring of 238U16O/238U is effective for the precise isotope ratio measurement. (author)

  18. Stable isotope studies

    Energy Technology Data Exchange (ETDEWEB)

    Ishida, T.

    1992-01-01

    The research has been in four general areas: (1) correlation of isotope effects with molecular forces and molecular structures, (2) correlation of zero-point energy and its isotope effects with molecular structure and molecular forces, (3) vapor pressure isotope effects, and (4) fractionation of stable isotopes. 73 refs, 38 figs, 29 tabs.

  19. Stable isotope studies

    International Nuclear Information System (INIS)

    The research has been in four general areas: (1) correlation of isotope effects with molecular forces and molecular structures, (2) correlation of zero-point energy and its isotope effects with molecular structure and molecular forces, (3) vapor pressure isotope effects, and (4) fractionation of stable isotopes. 73 refs, 38 figs, 29 tabs

  20. Method for separating isotopes

    Science.gov (United States)

    Jepson, B.E.

    1975-10-21

    Isotopes are separated by contacting a feed solution containing the isotopes with a cyclic polyether wherein a complex of one isotope is formed with the cyclic polyether, the cyclic polyether complex is extracted from the feed solution, and the isotope is thereafter separated from the cyclic polyether.

  1. Developing isotopic functions

    International Nuclear Information System (INIS)

    Isotopic functions, or ratios of two isotopic variables, are used to verify Pu and U measurements of spent fuels in reprocessing plants. Systematic methods have been developed for forming and evaluating isotopic functions. This paper describes the method used at Battelle to form and evaluate isotopic functions. The data base at Battelle contains measurements and calculations for the fuel from 35 reactors

  2. Measurement of 37Ar to support technology for On-site Inspection under the Comprehensive Nuclear-Test-Ban Treaty

    CERN Document Server

    Aalseth, C E; Haas, D A; Hoppe, E W; Hyronimus, B J; Keillor, M E; Mace, E K; Orrell, J L; Seifert, A; Woods, V T

    2010-01-01

    On-Site Inspection (OSI) is a key component of the verification regime for the Comprehensive Nuclear-Test-Ban Treaty (CTBT). Measurements of radionuclide isotopes created by an underground nuclear explosion are a valuable signature of a Treaty violation. Argon-37 is produced from neutron interaction with calcium in soil, 40Ca(n,{\\alpha})37Ar. For OSI, the 35-day half-life of 37Ar provides both high specific activity and sufficient time for completion of an inspection before decay limits sensitivity. This paper presents a low-background internal-source gas proportional counter with an 37Ar measurement sensitivity level equivalent to 45.1 mBq/SCM in whole air.

  3. The isotopic contamination in electromagnetic isotope separators

    International Nuclear Information System (INIS)

    In the early years of isotope separation, and in particular electromagnetic isotope separation, needs for rapid results have conducted to empiric research. This paper describes fundamental research on the electromagnetic isotope separation to a better understanding of isotope separators as well as improving the performances. Focus has been made on the study of the principle of isotope contamination and the remedial action on the separator to improve the isotope separation ratio. In a first part, the author come back to the functioning of an electromagnetic separator and generalities on isotope contamination. Secondly, it describes the two stages separation method with two dispersive apparatus, an electromagnetic separation stage followed by an electrostatic separation stage, both separated by a diaphragm. The specifications of the electrostatic stage are given and its different settings and their consequences on isotope separation are investigated. In a third part, mechanisms and contamination factors in the isotope separation are discussed: natural isotope contamination, contamination by rebounding on the collector, contamination because of a low resolution, contamination by chromatism and diffusion effect, breakdown of condenser voltage. Analysis of experimental results shows the diffusion as the most important contamination factor in electromagnetic isotope separation. As contamination factors are dependent on geometric parameters, sector angle, radius of curvature in the magnetic field and clearance height are discussed in a fourth part. The better understanding of the mechanism of the different contamination factors and the study of influential parameters as pressure and geometric parameters lead to define a global scheme of isotope contamination and determinate optima separator design and experimental parameters. Finally, the global scheme of isotope contamination and hypothesis on optima specifications and experimental parameters has been checked during a

  4. Secondary beams obtained through the interaction of 95 MeV/u 36Ar ions with various targets

    International Nuclear Information System (INIS)

    An ongoing program is developed using the GANIL-facilities in order to determine the experimental yields for secondary beams produced through projectile fragmentation. In this work, an experimental systematics for all the isotopes detected in the peripheral collisions of 95 MeV/u 36Ar ions with various targets covering a wide range of atomic numbers (Be, Ni, Ta) is presented. A short comparison with the theoretical predictions given by two usual numeric codes (LISE and INTENSITY) is also given. (authors)

  5. Uranium isotopes in groundwater occurring at Amazonas State, Brazil

    International Nuclear Information System (INIS)

    This paper reports the behavior of the dissolved U-isotopes 238U and 234U in groundwater providing from 15 cities in Amazonas State, Brazil. The isotope dilution technique accompanied by alpha spectrometry were utilized for acquiring the U content and 234U/238U activity ratio (AR) data, 0.01–1.4 µg L−1 and 1.0–3.5, respectively. These results suggest that the water is circulating in a reducing environment and leaching strata containing minerals with low uranium concentration. A tendency to increasing ARs values following the groundwater flow direction is identified in Manaus city. The AR also increases according to the SW–NE directions: Uarini→Tefé; Manacapuru→Manaus; Presidente Figueiredo→São Sebastião do Uatumã; and Boa Vista do Ramos→Parintins. Such trends are possibly related to several factors, among them the increasing acid character of the waters. The waters analyzed are used for human consumption and the highest dissolved U content is much lower than the maximum established by the World Health Organization. Therefore, in view of this radiological parameter they can be used for drinking purposes. - Highlights: • U-isotopes data in important aquifer systems in Amazon area. • Application of the U-isotopes data to investigate the groundwater flow direction. • Evaluation of the drinking-water quality in terms of dissolved uranium

  6. New Approach to Estimate 40Ar/36Ar Ratio in Shocked Meteorites

    Science.gov (United States)

    Fujimoto, H.; Hyodo, H.; Ninagawa, K.

    2008-12-01

    Measurement of a 40Ar/39Ar age in a meteorite requires proper estimation of a 40Ar/36Ar "initial" ratio. For a primordial one, it is reported to be an order of 10-4, suggesting that one can ignore it in age calculation. However, there is no basis for applying this value as individual meteorites have different histories. In terms of 40Ar/39Ar studies on various meteorites, very few studies discuss how the ratios were estimated. Using terrestrial value of 295.5 is invalid. The only case in which the ratio does not affect on the results is when an age of a meteorite is in an order of billion years, resulting in a large raw 40Ar/36Ar ratio. A proper approach to estimate the ratio is application of isochron analyses. When a small amount of sample (a few micrograms) is studied in laserprobe analysis, this often becomes difficult. A shocked meteorite Y-75097 has developed maskelynite veins, which were identified in optical microscope, electron microprobe and thermoluminescence studies. We have applied 40Ar/39Ar dating method using both stepwise heating by a continuous laser and pinpoint dating by a pulsed laser. Stepwise heating results of several fragments (about 50 micrograms) of the meteorite yielded various old and young ages. Most pinpoint analyses gave the raw 40Ar/36Ar ratio less than the terrestrial value with sporadically and anomalously old ages. Among the data, three points isochron from a maskelynite vein yielded about 300 Ma with "initial" ratio of 180. To confirm this result, plagioclase and olivine data near the vein were plotted in a correlation diagram, but an isochron is not well defined due to relatively large analytical errors. A new method to analyze these data is proposed. Once 40Ar/39Ar ratio is determined from an experiment, the only factor which determines the age is the "initial" ratio in the 40Ar/39Ar age equation. Instead of using a known fixed ratio, we set the ratio (y-axis) and the age (x-axis) as variables. In this diagram, a single data

  7. Progress on radiometric dating of Wolfcamp brines using 4He and 40Ar

    International Nuclear Information System (INIS)

    Ground water samples (brines) from deep wells in the Palo Duro Basin, Texas are being analyzed for noble gases in an attempt to obtain radiometric ages for these brines. The brines contain radiogenic 4He and 40Ar produced from the radioactive decay of U, Th, and K. Consideration of hydrochemical data for the brines, various isotopic, chemical, and mineralogical data for the aquifer rocks and noble gas production rates allow estimating the age of the brines to be about 130 million years at two wells. At a third well interaquifer mixing has occurred and the age is presently indeterminate. 9 references, 3 figures, 1 table

  8. K-Ar age of the late Pleistocene eruption of Toba, North Sumatra

    International Nuclear Information System (INIS)

    It is stated that the late Pleistocene eruption of Toba is the largest magnitude explosive eruption documented from the Quaternary. K-Ar dating of the uppermost unit of the Toba Tuff gives an age of approximately 75,000 yr. A chemically and petrographically equivalent ash layer in deep-sea cores helps calibrate the Stage 4-5 boundary of the standard oxygen isotope stratigraphy. A similar ash in Malaya that overlies finds of Tampan Palaeolithic tools indicates that they are older than 75,000 yr. (author)

  9. Comparative study of the excitation functions of nuclear reactions induced by light ions (protons and α) and heavy ions (Ne, Ca, Ar) and, after neutron evaporation, leading to platinum and polonium isotopes. Analysis by de-excitation programme allowing for the angular momentum and fission

    International Nuclear Information System (INIS)

    This work is a study on the de-excitation of heavy nuclei from the Pt - Po area obtained by the complete fusion of various projectiles (p, 3He, 4He, 20Ne, 40Ar and 40Ca) and of various targets. The aim was to create from different couples the same compound nucleus of a mass equal to the sum of the masses of the component parts. The excitation energy of the system thus created can vary between 60 and 120 MeV. The experimental study of one or more particular de-excitation channels performed by measuring the cross sections of residual nuclei production for various bombardment energies is a very conventional approach. An in depth examination was made of the effect of the angular momentum given to the compound nucleus by the input channel to the de-excitation processes. Now the population of orbital angular momenta depends essentially on the mass of the projectile at equal velocities. Consequently, the utilization of projectiles extending from the proton to mass 40 covers a wide range. Decay by neutrons is not the only de-excitation method. Fission has a significant role particularly for the Po's and consequently this strongly diminishes the probability (P,xn). The decay of (α,xn) when going from the compound nucleus of 204Po to 182Pt makes it possble to evaluate the importance of the phenomenon and to have an item of experimental information that can be compared to a theoretical calculation. Theoretical calculations using the 'ALICE' code which expresses schematically the reduction in level densities by subtracting from the excitation energy a rotation energy and the 'JULIAN' code which uses a more accurate level density calculation and takes into account the gamma emission competing with the emission of neutrons show that the last programme reports the experimental results whereas the 'ALICE' code does not enable a consistent presentation to be made of all the results by light and heavy ions. Finally, it had to be agreed that the fission does not intervene as

  10. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Science.gov (United States)

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  11. An 40 Ar- 39 Ar study of the Cape Verde hot spot

    DEFF Research Database (Denmark)

    Holm, Paul Martin; Grandvuinet, Tanja; Wilson, James Richard;

    2008-01-01

    The 40Ar-39Ar analyses of 28 groundmass separates from volcanic rocks from the islands of Santiago, Sal, and São Vicente, Cape Verde archipelago, are presented. The new age data record the volcanic evolution for Santiago from 4.6 to 0.7 Ma, for Sal from around 15 to 1.1 Ma, and for São Vicente fr...

  12. Variscan polyphase tectonothermal record in the West Sudetes (Bohemian Massif) - deduced from Ar-Ar ages

    Czech Academy of Sciences Publication Activity Database

    Marheine, D.; Kachlík, V.; Patočka, František; Maluski, H.; Zelazniewicz, A.

    La Coruňa : International Basement Tectonics Association, 2000, s. 254-257. [International Conference on Basement Tectonics /15./, Galicia 2000.. La Coruňa (ES), 04.07.2000-08.07.2000] R&D Projects: GA AV ČR BARRANDE97008; GA AV ČR KSK1012601 Institutional research plan: CEZ:AV0Z3013912 Keywords : HP-LT-; HT- metamorphic rocks * tectonothermal events * Ar-Ar geochronology Subject RIV: DB - Geology ; Mineralogy

  13. Separation of uranium isotopes

    International Nuclear Information System (INIS)

    This invention provides a method for separating uranium isotopes comprising the steps of selectively irradiating a photochemically-reactive uranyl source material at a wavelength selective to a desired isotope of uranium at an effective temperature for isotope spectral line splitting below about 77 K, further irradiating the source material within the fluorescent lifetime of the selectively irradiated source material to selectively photochemically reduce the selectively excited isotopic species, and chemically separating the reduced isotope species from the remaining uranyl salt compound

  14. Modeling and Measurement of 39Ar Recoil Loss From Biotite as a Function of Grain Dimensions

    Science.gov (United States)

    Paine, J. H.; Nomade, S.; Renne, P. R.

    2004-12-01

    The call for age measurements with less than 1 per mil error puts a demand upon geochronologists to be aware of and quantify a number of problems which were previously negligible. One such factor is 39Ar recoil loss during sample irradiation, a phenomenon which is widely assumed to affect only unusually small crystals having exceptionally high surface/volume ratios. This phenomenon has important implications for thermochronologic studies seeking to exploit a range of closure temperatures arising from variable diffusion radii. Our study focuses on biotite, in which spatial isotope distributions cannot be reliably recovered by stepwise heating and which therefore lack recoil-diagnostic age spectrum behavior. Previous work by Renne et al. [Application of a deuteron-deuteron (D-D) neutron generator to 40Ar/39Ar geochronology, Applied Radiation and Isotopes, in press] used the SRIM code to calculate a ˜20% 39Ar recoil loss from the outermost 0.25 μ m of an infinite slab of phyllosillicate. This result is applied to measured grains of the biotite standard GA1550, a hypabyssal granite from the Mount Dromedary Complex, Australia. We measure the thickness and surface area of 166 grains and approximate the shape of each grain as a cylinder. Grain thickness ranges from 3 to 210 μ m, with an average grain radius of 350 μ m. We predict the amount of 39Ar recoil loss from each grain, finding an expected age error >0.1 % for grains thinner than 150 μ m, a >1% error for grain less than 10 μ m thick, and up to a 3% error for grains less than 3 μ m thick. These modeling results will be tested by analysis of the measured grains after irradiation in the Oregon State University TRIGA reactor. It is important to either account for 39Ar loss in thin biotite grains, or use sufficiently thick ones so that recoil loss is negligible. Our results indicate that only biotite grains thicker than 150 μ m should be used for neutron fluence monitoring in order to avoid bias greater than the

  15. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    International Nuclear Information System (INIS)

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  16. Plasma etching of III-nitrides in ICl/Ar and IBr/Ar plasmas

    International Nuclear Information System (INIS)

    Two new plasma chemistries, ICl/Ar and IBr/Ar, were investigated for dry etching of III-nitrides. Under electron cyclotron resonance conditions, we examined the effect of plasma composition, and source and chuck power on etch rates and surface morphology. The etch rate of InN proved to be the most sensitive of the materials investigated to the plasma composition and ion density in ICl plasmas. The GaN, InN, and InGaN etch rates reached ∼13000, 11500, and 7000 Angstrom/min, respectively, at 250 W rf chuck power and 1000 W microwave source power for ICl discharges. The etch rates in IBr plasmas were somewhat slower than in ICl. The etched surface of GaN was found to be smooth, with no significant preferential loss of N from the surface at low rf powers in either chemistry. There was no significant residue on the GaN surfaces after etching in IBr/Ar, and only slight chlorine contamination on the surfaces etched in ICl/Ar. Selectivities of 5 endash 10 for GaN over InN, AlN, or InAlN were achieved in ICl/Ar, but were <4 under all conditions with IBr/Ar. copyright 1997 American Vacuum Society

  17. Age of the Lava Creek supereruption and magma chamber assembly at Yellowstone based on 40Ar/39Ar and U-Pb dating of sanidine and zircon crystals

    Science.gov (United States)

    Matthews, Naomi E.; Vazquez, Jorge A.; Calvert, Andrew T.

    2015-01-01

    The last supereruption from the Yellowstone Plateau formed Yellowstone caldera and ejected the >1000 km3 of rhyolite that composes the Lava Creek Tuff. Tephra from the Lava Creek eruption is a key Quaternary chronostratigraphic marker, in particular for dating the deposition of mid Pleistocene glacial and pluvial deposits in western North America. To resolve the timing of eruption and crystallization history for the Lava Creek magma, we performed (1) 40Ar/39Ar dating of single sanidine crystals to delimit eruption age and (2) ion microprobe U-Pb and trace-element analyses of the crystal faces and interiors of single zircons to date the interval of zircon crystallization and characterize magmatic evolution. Sanidines from the two informal members composing Lava Creek Tuff yield a preferred 40Ar/39Ar isochron date of 631.3 ± 4.3 ka. Crystal faces on zircons from both members yield a weighted mean 206Pb/238U date of 626.5 ± 5.8 ka, and have trace element concentrations that vary with the eruptive stratigraphy. Zircon interiors yield a mean 206Pb/238U date of 659.8 ± 5.5 ka, and reveal reverse and/or oscillatory zoning of trace element concentrations, with many crystals containing high U concentration cores that likely grew from highly evolved melt. The occurrence of distal Lava Creek tephra in stratigraphic sequences marking the Marine Isotope Stage 16–15 transition supports the apparent eruption age of ∼631 ka. The combined results reveal that Lava Creek zircons record episodic heating, renewed crystallization, and an overall up-temperature evolution for Yellowstone's subvolcanic reservoir in the 103−104 year interval before eruption.

  18. Re-Os molybdenite and Ar-Ar phlogopite dating of Cu-Fe-Au-Mo (W) deposits in southeastern Hubei, China

    Science.gov (United States)

    Xie, G.-Q.; Mao, J.-W.; Li, R.-L.; Qü, W.-J.; Pirajno, F.; Du, A.-D.

    2007-07-01

    The Cu-Fe-Au-Mo (W) deposits in southeastern Hubei are an important component of the Middle-Lower Yangtze River metallogenic belt. Molybdenite from the Fengshandong Cu- (Mo), Ruanjiawan W-Cu- (Mo), Qianjiawan Cu-Au, Tongshankou Cu-Mo and Tonglüshan Cu- (Fe) deposits yielded Re-Os ages of 144.0 ± 2.1 Ma, 143.6 ± 1.7 Ma, 137.7 ± 1.7 Ma, 142.3 ± 1.8-143.7 ± 1.8 Ma and 137.8 ± 1.7-138.1 ± 1.8 Ma, respectively. Phlogopite from the Tieshan Fe- (Cu) deposit yielded an Ar-Ar age of 140.9 ± 1.2 Ma. These data and other published isotopic ages (Re-Os molybdenite and Ar-Ar mica ages) for the Cu-Fe-Au-Mo (W) deposits in the Middle-Lower Yangtze River metallogenic belt show that Cu-Fe-Au-Mo (W) mineralisation in the Tongling, Anqing, Jiurui and Edong ore districts developed in a narrow time span between 135.5 and 144.9 Ma, reflecting an important regional metallogenic event. An integrated study of available petrological and geochronological data, together with relationships to magmatism and the regional geodynamic framework, indicate that the Cu-Fe-Au-Mo (W) mineralisation in the Middle-Lower Yangtze River belt occurred during a regime of lithospheric extension. This extension is probably related to Late Mesozoic processes of lower crustal delamination and lithospheric thinning in East China.

  19. K/Ar dating of diagenetic illite

    International Nuclear Information System (INIS)

    Ascertaining the potassium/argon (K/Ar) age of diagenetic illite yields important information for hydrocarbon exploration since the growth of this mineral in the pores of sandstone reservoir and oil migration are inter linked events in the diagenetic evolution of rocks. Illite was mechanically separated by repeating a series of ultrasonic baths and ultrasonic probes followed by high-speed centrifuging. Resultant fractions were analyzed by X-ray diffractometry to measure the illite content of each sample. The separated illite material was found to be composed of illite and ordered mixed layer illite-smectite with 80% illite layers. Separated fractions were dated radiometrically by the K/Ar method. Preliminary results indicate an average age of some 200 m.y., which marks the end of the diagenetic development of the illite of this area. (author)

  20. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Science.gov (United States)

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  1. Dicty_cDB: FC-AR02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  2. Theoretical photoabsorption spectra of Ar n+ clusters

    Science.gov (United States)

    Doltsinis, Nikos L.; Knowles, Peter J.

    2000-08-01

    The photoabsorption spectra of selected Ar n+ clusters ( n=7, 8, 17, 19, 23) have been investigated theoretically using an extended Diatomics-in-Molecules approach including induced dipole - induced dipole and spin-orbit coupling interaction effects. Our calculations at 0 K confirm the experimentally observed spectral red-shift of the visible photoabsorption peak in the region 15Haberland et al., Phys. Rev. Lett. 67 (1991) 3290] by carrying out finite temperature Monte Carlo simulations.

  3. Irradiation of samples for 40Ar/39Ar dating using the Soreq Nuclear Research Center IRR-1 Reactor, Israel

    International Nuclear Information System (INIS)

    A facility for the irradiation of geological samples for 40Ar/39Ar dating has been established at the Israel Research Reactor No.1 (IRR-1). A Cd shielded Al irradiation canister is rotated at a position close to the core. The power of the reactor is usually rated at 4.5 MW and the total neutron flux is 1 to 3 x 1013 n/cm2 x s in the center of the core. The ratio of thermal/fast neutrons has been found to be 2 and K2SO4. The Ar production rations for these are: (36Ar/37Ar)Ca = 2.38(±0.28) x 10-4; (39Ar/37Ar)Ca = 12.1(±3.07) x 10-4; (40Ar/39Ar)k = 1.56(±0.40) x 10-2. Irradiations in the reactor are designed to produce 40Ar*/39Ar>1.6 and 40Aratm/37Ar>0.63. This results in convenient measurements with 40Artotal/39Ar near 1. (author)

  4. COFFEE COMMODITY CHAIN

    OpenAIRE

    Tine Olsen; Brett Inder

    2008-01-01

    To explain the value added along the coffee commodity chain we propose and estimate a theoretical model of the coffee commodity chain. The theoretical model consists of four markets and five agents in the coffee commodity chain and predicts that prices in the coffee commodity chain move together but are also influenced by income, technology and production. A vector error correction model is used to test the theoretical predictions. In addition to the theoretical conclusions the empirical mode...

  5. The Global Value Chain

    DEFF Research Database (Denmark)

    Sørensen, Olav Jull

    The conference paper aims to develop the global value chain concept by including corporate internal value adding activities and competition to the basic framework in order to turn the global value chain into a strategic management tool......The conference paper aims to develop the global value chain concept by including corporate internal value adding activities and competition to the basic framework in order to turn the global value chain into a strategic management tool...

  6. 40Ar retention in the terrestrial planets.

    Science.gov (United States)

    Watson, E Bruce; Thomas, Jay B; Cherniak, Daniele J

    2007-09-20

    The solid Earth is widely believed to have lost its original gases through a combination of early catastrophic release and regulated output over geologic time. In principle, the abundance of 40Ar in the atmosphere represents the time-integrated loss of gases from the interior, thought to occur through partial melting in the mantle followed by melt ascent to the surface and gas exsolution. Here we present data that reveal two major difficulties with this simple magmatic degassing scenario--argon seems to be compatible in the major phases of the terrestrial planets, and argon diffusion in these phases is slow at upper-mantle conditions. These results challenge the common belief that the upper mantle is nearly degassed of 40Ar, and they call into question the suitability of 40Ar as a monitor of planetary degassing. An alternative to magmatism is needed to release argon to the atmosphere, with one possibility being hydration of oceanic lithosphere consisting of relatively argon-rich olivine and orthopyroxene. PMID:17882213

  7. Ar-O2 rf plasma diagnostics by mass spectrometry

    International Nuclear Information System (INIS)

    An investigation on the nature, energy and fluxes of the dominant species from an rf 13.56 MHz argon-oxygen plasma is realized using quadrupolar mass spectrometer (QMS). The QMS is sampling the plasma species through the anode space charge, being placed on the grounded electrode. The ion energy distributions of the most important ions in plasma, Ar+, Ar++, ArH+, Ar2+, O2+, O+ are investigated. (authors)

  8. High-spin yrast levels of 38Ar

    NARCIS (Netherlands)

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  9. Fenofibrate down-regulates the expressions of androgen receptor (AR) and AR target genes and induces oxidative stress in the prostate cancer cell line LNCaP

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Hu; Zhu, Chen; Qin, Chao [State Key Laboratory of Reproductive Medicine, Department of Urology, First Affiliated Hospital of Nanjing Medical University, Nanjing (China); Tao, Tao [Department of Neurosurgery, First Affiliated Hospital of Nanjing Medical University, Nanjing (China); Li, Jie; Cheng, Gong; Li, Pu; Cao, Qiang; Meng, Xiaoxin; Ju, Xiaobing; Shao, Pengfei; Hua, Lixin [State Key Laboratory of Reproductive Medicine, Department of Urology, First Affiliated Hospital of Nanjing Medical University, Nanjing (China); Gu, Min, E-mail: medzhao1980@163.com [State Key Laboratory of Reproductive Medicine, Department of Urology, First Affiliated Hospital of Nanjing Medical University, Nanjing (China); Yin, Changjun, E-mail: drcjyin@gmail.com [State Key Laboratory of Reproductive Medicine, Department of Urology, First Affiliated Hospital of Nanjing Medical University, Nanjing (China)

    2013-03-08

    Highlights: ► Fenofibrate induces cell cycle arrest in G1 phase and apoptosis in LNCaP cells. ► Fenofibrate reduces the expressions of androgen receptor in LNCaP cells. ► Fenofibrate induces oxidative stress in the prostate cancer cell line LNCaP. -- Abstract: Fenofibrate, a peroxisome proliferator-androgen receptor-alpha agonist, is widely used in treating different forms of hyperlipidemia and hypercholesterolemia. Recent reports have indicated that fenofibrate exerts anti-proliferative and pro-apoptotic properties. This study aims to investigate the effects of fenofibrate on the prostate cancer (PCa) cell line LNCaP. The effects of fenofibrate on LNCaP cells were evaluated by flow cytometry, reverse transcription-polymerase chain reaction, enzyme-linked immunosorbent assays, Western blot analysis, and dual-luciferase reporter assay. Fenofibrate induces cell cycle arrest in G1 phase and apoptosis in LNCaP cells, reduces the expressions of androgen receptor (AR) and AR target genes (prostate-specific antigen and TMPRSS2), and inhibits Akt phosphorylation. Fenofibrate can induce the accumulation of intracellular reactive oxygen species and malondialdehyde, and decrease the activities of total anti-oxidant and superoxide dismutase in LNCaP cells. Fenofibrate exerts an anti-proliferative property by inhibiting the expression of AR and induces apoptosis by causing oxidative stress. Therefore, our data suggest fenofibrate may have beneficial effects in fenofibrate users by preventing prostate cancer growth through inhibition of androgen activation and expression.

  10. Fenofibrate down-regulates the expressions of androgen receptor (AR) and AR target genes and induces oxidative stress in the prostate cancer cell line LNCaP

    International Nuclear Information System (INIS)

    Highlights: ► Fenofibrate induces cell cycle arrest in G1 phase and apoptosis in LNCaP cells. ► Fenofibrate reduces the expressions of androgen receptor in LNCaP cells. ► Fenofibrate induces oxidative stress in the prostate cancer cell line LNCaP. -- Abstract: Fenofibrate, a peroxisome proliferator-androgen receptor-alpha agonist, is widely used in treating different forms of hyperlipidemia and hypercholesterolemia. Recent reports have indicated that fenofibrate exerts anti-proliferative and pro-apoptotic properties. This study aims to investigate the effects of fenofibrate on the prostate cancer (PCa) cell line LNCaP. The effects of fenofibrate on LNCaP cells were evaluated by flow cytometry, reverse transcription-polymerase chain reaction, enzyme-linked immunosorbent assays, Western blot analysis, and dual-luciferase reporter assay. Fenofibrate induces cell cycle arrest in G1 phase and apoptosis in LNCaP cells, reduces the expressions of androgen receptor (AR) and AR target genes (prostate-specific antigen and TMPRSS2), and inhibits Akt phosphorylation. Fenofibrate can induce the accumulation of intracellular reactive oxygen species and malondialdehyde, and decrease the activities of total anti-oxidant and superoxide dismutase in LNCaP cells. Fenofibrate exerts an anti-proliferative property by inhibiting the expression of AR and induces apoptosis by causing oxidative stress. Therefore, our data suggest fenofibrate may have beneficial effects in fenofibrate users by preventing prostate cancer growth through inhibition of androgen activation and expression

  11. Modeling Nitrogen Isotopes in the Global Ocean

    Science.gov (United States)

    Somes, C.; Schmittner, A.

    2008-12-01

    The nitrogen isotopic signal measured in marine sediments has the potential to be a valuable paleoceanographic proxy. It captures the response of different biological processes in the marine ecosystem including photosynthesis, nitrogen fixation, denitrification as well as processes within the food chain. A simple marine ecosystem model that includes the interactive cycling of nitrogen, phosphorus, and oxygen is augmented to record nitrogen isotopes in the University of Victoria Earth System Climate Model. New nitrogen isotopic tracers are employed at all trophic levels of the ecosystem. This includes the δ15N of nitrate, both classes of phytoplankton (nitrogen fixers and all other phytoplankton), zooplankton, and detritus. Despite a few shortcomings, it is shown that the nitrogen isotope model can capture the major trends observed in the modern climate. The ability to model nitrogen isotopes in a global coupled ocean- atmosphere-sea ice-ecosystem model gives us a unique opportunity to directly infer what physical and biological changes in the climate system are driving the δ15N signal on spatial and temporal scales. This is a valuable tool giving us tremendous insight on how to interpret the nitrogen isotopic signal.

  12. Laser Spectroscopy of Neutron Rich Bismuth Isotopes

    CERN Multimedia

    2002-01-01

    %IS344 :\\\\ \\\\ The aim of the experiment is to measure the optical isotope shifts and hyperfine structures of bismuth isotopes across the N=126 shell closure in order to extract the change in mean square charge radii ($\\delta\\langle r^{2}\\rangle$) and static moments. These include the first isotones of lead to be measured directly above the shell closure and will provide new information on the systematics of the kink ($\\delta\\langle r^{2}\\rangle)$ seen in the lead isotopic chain. After two very successful runs the programme has been extended to include the neutron deficient isotopes below $^{201}$Bi to study the systematics across the $i_{13/2}$ neutron sub-shell closure at N=118.\\\\ \\\\ During the initial 2 runs (9 shifts) the isotope shifts and hyperfine structures of three new isotopes, $ ^{210,212,213}$Bi and the 9$^{-}$ isomer of $^{210}$Bi have been measured. The accuracy of the previous measurements of $^{205,206,208}$Bi have been greatly improved. The samples of $ ^{208,210,210^{m}}$Bi were prepared by c...

  13. Chain-Chain Based Routing Protocol

    Directory of Open Access Journals (Sweden)

    Samia A Ali

    2011-05-01

    Full Text Available Wireless sensor network (WSN is an emerging technology for monitoring physical world. WSNs consist of large numbers of sensor nodes operated by battery mostly in harsh environment. Thus energy conservation is a primary issue for organization of these sensor nodes. Another crucial issue is the data delivery time by sensor nodes to the sink node, especially in Military, medical fields, and security monitoring systems where minimum delay is desirable. Number of protocols has been proposed in the literature for routing. One of such protocols is the cluster based routing protocol LEACH (low energy adaptive clustering hierarchy. LEACH protocol organizes WSN into a set of clusters and a periodic voting for cluster head is performed in order to be evenly distributed among all the sensors of the WSN. This periodical cluster head voting in LEACH, however, consumes an amount of non-negligible energy and other resources. For energy conservation, PEGASIS (power efficient gathering in sensor information systems a near optimal chain-based protocol has been proposed, however, it is faced with the challenge of long delay for the transmitted data. Another routing protocol called CCM (Chain-Cluster based Mixed routing, which is mainly a hybrid of LEACH and PEGASIS is proposed, the consumed energy increases as network size increases. In this paper, we propose an efficient routing protocol called CCBRP (Chain-Chain based routing protocol, it achieves both minimum energy consumption and minimum delay. The CCBRP protocol mainly divides a WSN into a number of chains (Greedy algorithm is used to form each chain as in PEGSIS protocol and runs in two phases. In the first phase, sensor nodes in each chain transmit data to their chain leader nodes in parallel. In the second phase, all chain leader nodes form a chain (also, using Greedy algorithm and choose randomly a leader node then all chain leader nodes send their data to this chosen leader node. This chosen leader node

  14. Dicty_cDB: FC-AR12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  15. Dicty_cDB: FC-AR03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  16. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    CERN Document Server

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  17. Molybdenum isotope records as a potential new proxy for paleoceanography

    OpenAIRE

    Siebert, C.; Nägler, T. F.; Friedhelm von Blanckenburg; J. D. Kramers;  

    2003-01-01

    New high-precision isotope ratios of dissolved Mo in seawater from different ocean basins and depths show a homogeneous isotope composition (‘mean ocean water 98Mo/95Mo’ (MOMO)), as expected from its long ocean residence time (800 kyr). This composition appears to have been constant for the past 60 Myr at a 1-3 Myr time resolution as indicated from thick sections of Fe-Mn crusts from the Atlantic and Pacific. These records yield a constant offset from MOMO (average of -3.1 and -2.9‰). They ar...

  18. Isotopic age determination in Bergslagen, Sweden. 1. Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Oen, I.S. (Amsterdam Univ. (Netherlands). Geologisch Inst.); Verschure, R.H. (Laboratorium voor Isotopen-Geologie, Amsterdam (Netherlands))

    1982-09-01

    This paper is an introduction to a series of short communications 'Isotopic age determinations in Bergslagen, Sweden', which will be submitted to this journal. An earlier paper on K-Ar ages of hornblendes in skarns and metabasites in the Hjulsjoe area has been published elsewhere (Moorman et al., 1982). This joint research project of the ZWO-Laboratory of Isotope Geology and the Geological Institute University of Amsterdam forms part of the research program of the 'Stichting voor Isotopen-Geologisch Onderzoek', supported by the Netherlands Organization for the Advancement of Pure Research (Z.W.O.).

  19. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Science.gov (United States)

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  20. Discrete Quantum Markov Chains

    CERN Document Server

    Faigle, Ulrich

    2010-01-01

    A framework for finite-dimensional quantum Markov chains on Hilbert spaces is introduced. Quantum Markov chains generalize both classical Markov chains with possibly hidden states and existing models of quantum walks on finite graphs. Quantum Markov chains are based on Markov operations that may be applied to quantum systems and include quantum measurements, for example. It is proved that quantum Markov chains are asymptotically stationary and hence possess ergodic and entropic properties. With a quantum Markov chain one may associate a quantum Markov process, which is a stochastic process in the classical sense. Generalized Markov chains allow a representation with respect to a generalized Markov source model with definite (but possibly hidden) states relative to which observables give rise to classical stochastic processes. It is demonstrated that this model allows for observables to violate Bell's inequality.

  1. Gushing metal chain

    Science.gov (United States)

    Belyaev, Alexander; Sukhanov, Alexander; Tsvetkov, Alexander

    2016-03-01

    This article addresses the problem in which a chain falls from a glass from some height. This phenomenon demonstrates a paradoxical rise of the chain over the glass. To explain this effect, an initial hypothesis and an appropriate theory are proposed for calculating the steady fall parameters of the chain. For this purpose, the modified Cayley's problem of falling chain given its rise due to the centrifugal force of upward inertia is solved. Results show that the lift caused by an increase in linear density at the part of chain where it is being bent (the upper part) is due to the convergence of the chain balls to one another. The experiments confirm the obtained estimates of the lifting chain.

  2. Ar + NO microwave plasmas for Escherichia coli sterilization

    Energy Technology Data Exchange (ETDEWEB)

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  3. Isotopic geology; Geologie isotopique

    Energy Technology Data Exchange (ETDEWEB)

    Allegre, C. [Paris-7 Univ. Denis Diderot, 75 (France); Institut de physique du globe de Paris, 75 - Paris (France)

    2005-07-01

    Born from the application to geology of nuclear physics techniques, the isotopic geology has revolutionized the Earth's sciences. Beyond the dating of rocks, the tracer techniques have permitted to reconstruct the Earth's dynamics, to measure the temperatures of the past (giving birth to paleoclimatology) and to understand the history of chemical elements thanks to the analysis of meteorites. Today, all domains of Earth sciences appeal more or less to the methods of isotopic geology. In this book, the author explains the principles, methods and recent advances of this science: 1 - isotopes and radioactivity; 2 - principles of isotope dating; 3 - radio-chronological methods; 4 - cosmogenic isotope chronologies; 5 - uncertainties and radio-chronological results; 6 - geochemistry of radiogenic isotopes; 7 - geochemistry of stable isotopes; 8 - isotopic geology and dynamical analysis of reservoirs. (J.S.)

  4. Operation of a Thick Gas Electron Multiplier (THGEM) in Ar, Xe and Ar-Xe

    International Nuclear Information System (INIS)

    We present the results of our recent studies of a Thick Gaseous Electron Multiplier (THGEM)-based detector, operated in Ar, Xe and Ar:Xe (95:5) at various gas pressures. Avalanche-multiplication properties and energy resolution were investigated with soft x-rays for different detector configurations and parameters. Gains above 104 were reached in a double-THGEM detector, at atmospheric pressure, in all gases, in almost all the tested conditions; in Ar:Xe (95:5) similar gains were reached at pressures up to 2 bar. The energy resolution dependence on the gas, pressure, hole geometry and electric fields was studied in detail, yielding in some configurations values below 20% FWHM with 5.9 keV x-rays

  5. Multidiffusion mechanisms for noble gases (He, Ne, Ar) in silicate glasses and melts in the transition temperature domain: Implications for glass polymerization

    Science.gov (United States)

    Amalberti, Julien; Burnard, Pete; Laporte, Didier; Tissandier, Laurent; Neuville, Daniel R.

    2016-01-01

    Noble gases are ideal probes to study the structure of silicate glasses and melts as the modifications of the silicate network induced by the incorporation of noble gases are negligible. In addition, there are systematic variations in noble gas atomic radii and several noble gas isotopes with which the influence of the network itself on diffusion may be investigated. Noble gases are therefore ideally suited to constrain the time scales of magma degassing and cooling. In order to document noble gas diffusion behavior in silicate glass, we measured the diffusivities of three noble gases (4He, 20Ne and 40Ar) and the isotopic diffusivities of two Ar isotopes (36Ar and 40Ar) in two synthetic basaltic glasses (G1 and G2; 20Ne and 36Ar were only measured in sample G1). These new diffusion results are used to re-interpret time scales of the acquisition of fractionated atmospheric noble gas signatures in pumices. The noble gas bearing glasses were synthesized by exposing the liquids to high noble gas partial pressures at high temperature and pressure (1750-1770 K and 1.2 GPa) in a piston-cylinder apparatus. Diffusivities were measured by step heating the glasses between 423 and 1198 K and measuring the fraction of gas released at each temperature step by noble gas mass spectrometry. In addition we measured the viscosity of G1 between 996 and 1072 K in order to determine the precise glass transition temperature and to estimate network relaxation time scales. The results indicate that, to a first order, that the smaller the size of the diffusing atom, the greater its diffusivity at a given temperature: D(He) > D(Ne) > D(Ar) at constant T. Significantly, the diffusivities of the noble gases in the glasses investigated do not display simple Arrhenian behavior: there are well-defined departures from Arrhenian behavior which occur at lower temperatures for He than for Ne or Ar. We propose that the non-Arrhenian behavior of noble gases can be explained by structural modifications

  6. Optical isotope shifts for unstable samarium isotopes

    International Nuclear Information System (INIS)

    Using a tunable dye laser beam intersecting a thermal atomic beam, optical isotope shifts and hyperfine splittings have been measured for the four unstable samarium isotopes between 144Sm and 154Sm, covering the well known transition region from spherical to deformed shapes. (orig.)

  7. MEIS1 functions as a potential AR negative regulator

    International Nuclear Information System (INIS)

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells

  8. Argon defect complexes in low energy Ar irradiated molybdenum

    Energy Technology Data Exchange (ETDEWEB)

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  9. MEIS1 functions as a potential AR negative regulator

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  10. Laser Spectroscopy of neutron deficient Sn isotopes

    CERN Multimedia

    We propose to study the ground state properties of neutron-deficient tin isotopes towards the doubly-magic nucleus $^{100}$Sn. Nuclear spins, changes in the rms charge radii and electromagnetic moments of $^{101-121}$Sn will be measured by laser spectroscopy using the CRIS experimental beam line. These ground-state properties will help to clarify the evolution of nuclear structure properties approaching the $\\textit{N = Z =}$ 50 shell closures. The tin isotopic chain is currently the frontier for the application of state-of-the-art ab-initio calculations. Our knowledge of the nuclear structure of the Sn isotopes will set a benchmark for the advances of many-body methods, and will provide an important test for modern descriptions of the nuclear force.

  11. Isotope analysis of carbon by C2 molecule spectrum

    International Nuclear Information System (INIS)

    A study was made on inert gas mixture (He, Ne, Ar) with carbon-containing components (CO, CO2, CH4) under conditions of variation of mixture pressure in discharge tube, of carbon-containing components contents and the rate of gas flow through the discharge tube. The use of C2 molecule spectrum enabled to develope the spectroscopic techniques for determination of carbon isotope ratio. The method is universal with respect to molecular form of carbon-containing substance

  12. Crater chains on Mercury

    Science.gov (United States)

    Shevchenko, V.; Skobeleva, T.

    After discovery of disruption comet Shoemaker-Levy 9 into fragment train before it's collision with Jupiter there was proposed that linear crater chains on the large satellites of Jupiter and on the Moon are impact scars of past tidally disrupted comets.It's known that radar images have revealed the possible presence of water ice deposits in polar regions of Mercury. Impacts by a few large comets seem to provide the best explanation for both the amount and cleanliness of the ice deposits on Mercury because they have a larger volatile content that others external sources, for example, asteroid. A number of crater chains on the surface of Mercury are most likely the impact tracks of "fragment trains" of comets tidally disrupted by Sun or by Mercury and are not secondary craters. Mariner 10 image set (the three Mariner 10 flybys in 1974-1975) was used to recognize the crater chains these did not associate with secondary crater ejecta from observed impact structures. As example, it can be shown such crater chain located near crater Imhotep and crater Ibsen (The Kuiper Quadrangle of Mercury). Resolution of the Mariner 10 image is about 0.54 km/pixel. The crater chain is about 50 km long. It was found a similar crater chain inside large crater Sophocles (The Tolstoj Quadrangle of Mercury). The image resolution is about 1.46 km/pixel. The chain about 50 km long is located in northen part of the crater. Image resolution limits possibility to examine the form of craters strongly. It seems the craters in chains have roughly flat floor and smooth form. Most chain craters are approximately circular. It was examined many images from the Mariner 10 set and there were identified a total 15 crater chains and were unable to link any of these directly to any specific large crater associated with ejecta deposits. Chain craters are remarkably aligned. All distinguished crater chains are superposed on preexisting formations. A total of 127 craters were identified in the 15 recognized

  13. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Science.gov (United States)

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  14. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    OpenAIRE

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  15. Diverse, discrete, mantle-derived batches of basalt erupted along a short normal fault zone: The Poison Lake chain, southernmost Cascades

    Science.gov (United States)

    Muffler, L.J.P.; Clynne, M.A.; Calvert, A.T.; Champion, D.E.

    2011-01-01

    The Poison Lake chain consists of small, monogenetic, calc-alkaline basaltic volcanoes located east of the Cascade arc axis, 30 km ENE of Lassen Peak in northeastern California. This chain consists of 39 distinguishable units in a 14-km-long and 2-kmwide zone trending NNW, parallel to nearby Quaternary normal faults. The 39 units fall into nine coherent groups based on stratigraphy, field characteristics, petrography, and major-element compositions. Petrographic differences among groups are expressed by different amounts and proportions of phenocrysts. MgO-SiO 2, K 2O-SiO 2, and TiO 2-SiO 2 variation diagrams illustrate clear differences in compatible and incompatible elements among the groups. Variation of K 2O/ TiO 2 and K 2O/P 2O 5 with MgO indicates that most of the basalts of the Poison Lake chain cannot be related by crystal fractionation at different pressures and that compositions have not been affected significantly by incorporation of low-degree silicic crustal melt or interaction with sialic crust. Limited traceelement and whole-rock isotopic data also suggest little if any incorporation of uppercrustal material, and that compositional variation among groups primarily reflects source compositional differences. Precise 40Ar/ 39Ar determinations show that the lavas were erupted between 100 and 110 ka. The migration of paleomagnetic remanent directions over 30?? suggests that the entire Poison Lake chain could represent three short-lived episodes of volcanism within a period as brief as 500 yr. The diverse geologic, petrographic, chemical, paleomagnetic, and age data indicate that each of the nine groups represents a small, discrete magma batch generated in the mantle and stored briefly in the lower crust. A NNW normal fault zone provided episodic conduits that allowed rapid ascent of these batches to the surface, where they erupted as distinct volcanic groups, each aligned along a segment of the Poison Lake chain. Compositional diversity of these primitive

  16. SUMER-IRIS Observations of AR11875

    Science.gov (United States)

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  17. The Spectroscopic study of 33Ar

    International Nuclear Information System (INIS)

    The proton-rich nucleus 33Ar has been produced at the low-energy facility SPIRAL at GANIL. Spectroscopic studies of gamma and p emission of this nucleus were performed with the 'Silicon Cube' detection system. The analysis of proton and gamma singles and coincidence spectra allowed us to establish a complete decay scheme of this nucleus. The comparison of the Gamow-Teller strength distribution deduced from our experiment and the theoretical one obtained with the Shell Model permitted the determination of a quenching factor for the Gamow-Teller strength.

  18. Statistical clumped isotope signatures.

    Science.gov (United States)

    Röckmann, T; Popa, M E; Krol, M C; Hofmann, M E G

    2016-01-01

    High precision measurements of molecules containing more than one heavy isotope may provide novel constraints on element cycles in nature. These so-called clumped isotope signatures are reported relative to the random (stochastic) distribution of heavy isotopes over all available isotopocules of a molecule, which is the conventional reference. When multiple indistinguishable atoms of the same element are present in a molecule, this reference is calculated from the bulk (≈average) isotopic composition of the involved atoms. We show here that this referencing convention leads to apparent negative clumped isotope anomalies (anti-clumping) when the indistinguishable atoms originate from isotopically different populations. Such statistical clumped isotope anomalies must occur in any system where two or more indistinguishable atoms of the same element, but with different isotopic composition, combine in a molecule. The size of the anti-clumping signal is closely related to the difference of the initial isotope ratios of the indistinguishable atoms that have combined. Therefore, a measured statistical clumped isotope anomaly, relative to an expected (e.g. thermodynamical) clumped isotope composition, may allow assessment of the heterogeneity of the isotopic pools of atoms that are the substrate for formation of molecules. PMID:27535168

  19. Explanatory brochure on isotopic age map of peninsular India

    International Nuclear Information System (INIS)

    The document is an explanatory brochure accompanying the isotopic age map of peninsular India. It describes the isotopic age data used to draw the isotopic age map of peninsular India. The map on 1:5,000,000 scale presents the isotopic ages of the Precambrian of Peninsular India. The isotopic age data depicted in the map pertain to the U-Th-Pb, Pb-Pb, Rb-Sr and K-Ar methods. Age data are plotted on a geological base, at the locales from where the samples are reported to have been drawn. Each symbol depicting the age data has four attributes : (1)the material dated, (2)method used and interpretation of the date, (3)the age of the material in million years and (4)the source of information. The explanatory brochure has two parts. Part-I explains the reasons for adopting the geological base map for the isotopic age map. It describes types and levels of confidence of isotopic age data, methodology adopted to evolve the legend, reliability of dates and the database which summarises the stratigraphy. Part-II reviews the geochronological information about the Peninsular Precambrian available till the date of finalisation of the maps in 1983. It brings out the significance of the geological events which make up the geological history of the Peninsular India. (M.G.B.). refs., tabs

  20. Dicty_cDB: FC-AR10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  1. Dicty_cDB: FC-AR05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  2. Dicty_cDB: FC-AR16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  3. Dicty_cDB: FC-AR17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  4. Dicty_cDB: FC-AR01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  5. Dicty_cDB: FC-AR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  6. Supply Chain Management og Supply Chain costing

    DEFF Research Database (Denmark)

    Nielsen, Steen; Mortensen, Ole

    2002-01-01

    Formålet med denne artikel er at belyse de muligheder som ligger i at integrere virksomhedens økonomiske styring med begrebet Supply Chain Management (SCM). Dette søges belyst ved først at beskrive den teoretiske ramme, hvori SCM indgår. Herefter analyseres begrebet Supply Chain Costing (SCC) som...... Århus. Et resultat er, at via begrebet Supply Chain Costing skabes der mulighed for at måle logistikkædens aktiviteter i kr./øre. Anvendelsen af denne information har også strategisk betydning for at kunne vælge kunde og leverandør. Ved hjælp af integrationen skabes der også helt nye mulighed for at...

  7. Isotope-Geochemical Evidence For Uranium Retardation in Zeolitized Tuffs at Yucca Mountain, Nevada, USA

    International Nuclear Information System (INIS)

    Retardation of radionuclides by sorption on minerals in the rocks along downgradient groundwater flow paths is a positive attribute of the natural barrier at Yucca Mountain, Nevada, the site of a proposed high-level nuclear waste repository. Alteration of volcanic glass in nonwelded tuffs beneath the proposed repository horizon produced thick, widespread zones of zeolite- and clay-rich rocks with high sorptive capacities. The high sorptive capacity of these rocks is enhanced by the large surface area of tabular to fibrous mineral forms, which is about 10 times larger in zeolitic tuffs than in devitrified tuffs and about 30 times larger than in vitric tuffs. The alteration of glass to zeolites, however, was accompanied by expansion that reduced the matrix porosity and permeability. Because water would then flow mainly through fractures, the overall effectiveness of radionuclide retardation in the zeolitized matrix actually may be decreased relative to unaltered vitric tuff. Isotope ratios in the decay chain of 238U are sensitive indicators of long-term water-rock interaction. In systems older than about 1 m.y. that remain closed to mass transfer, decay products of 238U are in secular radioactive equilibrium where 234U/238U activity ratios (AR) are unity. However, water-rock interaction along flow paths may result in radioactive disequilibrium in both the water and the rock, the degree of which depends on water flux, rock dissolution rates, α-recoil processes, adsorption and desorption, and the precipitation of secondary minerals. The effects of long-term water-rock interaction that may cause radionuclide retardation were measured in samples of Miocene-age subrepository zeolitized tuffs of the Calico Hills Formation (Tac) and the Prow Pass Tuff (Tcp) from borehole USW SD-9 near the northern part of the proposed repository area (sampled depth interval from 451.1 to 633.7 m; Engstrom and Rautman, 1996). Mineral abundances and whole-rock chemical and U-series isotopic

  8. Food supply chains

    OpenAIRE

    Zhou, Qian

    2011-01-01

    The dissertation analyses food waste in global supply chain. From the related managerial literature, the process of supply chain operation, from agriculture, manufacturing, warehouses, retailers to customers are explained clearly. Then the reasons and characteristics of food wastes in any point of food supply chain are analyzed. From some case studies and questionnaire investigation, some corresponding methods to reduce food waste are put forward in the following. Lastly, in terms of method s...

  9. Supply chain components

    Directory of Open Access Journals (Sweden)

    Vieraşu, T.

    2011-01-01

    Full Text Available In this article I will go through three main logistics components, which are represented by: transportation, inventory and facilities, and the three secondary logistical components: information, production location, price and how they determine performance of any supply chain. I will discuss then how these components are used in the design, planning and operation of a supply chain. I will also talk about some obstacles a supply chain manager may encounter.

  10. Supply Chain Collaboration

    OpenAIRE

    Meca, Ana; Timmer, Judith

    2008-01-01

    In this chaper, we have reviewed and surveyed the literature on supply chain collaboration. As mentioned above, the game theory models that include cooperative behaviour among retailers seem to be a natural framework to model cooperation (collaboration) in supply chains that consist of a supplier and a finite number of retailers. Various researchers in this area have already adopted several cooperative models dealing with supply chain coordination, and it is expected to see many more in the n...

  11. Supply chain components

    OpenAIRE

    Vieraşu, T.; Bălăşescu, M.

    2011-01-01

    In this article I will go through three main logistics components, which are represented by: transportation, inventory and facilities, and the three secondary logistical components: information, production location, price and how they determine performance of any supply chain. I will discuss then how these components are used in the design, planning and operation of a supply chain. I will also talk about some obstacles a supply chain manager may encounter.

  12. Sustainable Supply Chain Management

    OpenAIRE

    Geentjens, Marlies

    2013-01-01

    This project investigates the phenomena Sustainable Supply Chain Management. The point of departure is Supply Chain Management, which we analyse in order to lock into an understanding of the development that occur when implementing sustainability. In the quest for higher understanding of the interlocking mechanisms of supply chain management, we combine a theoretical approach to the developmnent of sustainability with some relevant case-examples (mainly depicting IKEA). This focal point g...

  13. Economy, market and chain

    OpenAIRE

    Sukkel, W.; Hommes, M.

    2009-01-01

    In their pursuit of growth and professionalisation, the Dutch organic sector focuses primarily on market development. But how do you stimulate the market for organic foods? This is the subject of many research projects concerning market, consumer preferences and the supply chain. These projects focus specifically at consumer purchasing behaviour, product development, supply chain formation and minimising cost price. As a rule, this research takes place in close cooperation with chain actors

  14. The use of stable isotopes for food web analysis.

    Science.gov (United States)

    Wada, E; Mizutani, H; Minagawa, M

    1991-01-01

    General aspects in isotope biogeochemistry was summarized with emphasis on delta 15N and delta 13C contents in plants and animals in natural ecosystems. In the estuary, the variation of isotope ratios were principally governed by the mixing of land-derived organic matter, marine phytoplankton, and seagrasses. A clear cut linear relationship between animal delta 15N and its trophic level was obtained in the Antarctic food chain system. Several current efforts to use the stable isotopes for food web analysis were demonstrated for some terrestrial and marine systems as well as human food web. PMID:1910519

  15. Isotopes in heterogeneous catalysis

    CERN Document Server

    Hargreaves, Justin SJ

    2006-01-01

    The purpose of this book is to review the current, state-of-the-art application of isotopic methods to the field of heterogeneous catalysis. Isotopic studies are arguably the ultimate technique in in situ methods for heterogeneous catalysis. In this review volume, chapters have been contributed by experts in the field and the coverage includes both the application of specific isotopes - Deuterium, Tritium, Carbon-14, Sulfur-35 and Oxygen-18 - as well as isotopic techniques - determination of surface mobility, steady state transient isotope kinetic analysis, and positron emission profiling.

  16. Value Chain Engineering

    DEFF Research Database (Denmark)

    Wæhrens, Brian Vejrum; Slepniov, Dmitrij

    2015-01-01

    This workbook is recommended for the attention of students of and managers in Danish small and medium sized enterprises (SMEs). Danish SMEs are currently facing a number of key challenges related to their position in global value chains. This book provides an insight into value chain management...... that may help these SMEs to occupy and sustain a competitive position in the value chain. It addresses this objective by introducing and discussing: • The concept of global value chains and its founding principles • The buyer-supplier relationships • Various SMEs operations configurations • Ideas for...

  17. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Science.gov (United States)

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  18. Stable isotope applications

    International Nuclear Information System (INIS)

    The following domains of stable isotope applications are presented: - isotope dilution analyses as in trace analyses or volume and mass determinations; - stable isotopes as tracers as applied in environmental studies, agricultural research, products and objects authentification, transport phenomena, reaction mechanisms, determinations of structure and complex biological function, metabolism studies, diagnostic respiration tests, positron emission tomography; - equilibrium isotopic effects as investigated in measurements of effects, studies of equilibrium conditions, the mechanism of drug action, study of natural processes, water circuit, temperature measurements; - kinetic isotopic effects, as, for instance, reaction rates and mechanisms, solvent isotopic effects; - stable isotopes for advanced nuclear reactors as, for instance, uranium nitride with 15 N as nuclear fuel or 157 Gd for reactivity control. In spite of the difficulties regarding stable isotope use and first of all, of the difficult and costly analytical techniques, a continuous growth of the number of stable isotope applications in different fields is registered. The number of works and scientific meetings on the subject, as organized by the International Society of Isotopes and IAEA-Vienna, Gordon Conferences, regional meetings in Germany, France, etc. increase continuously. Development of the stable isotope application on a larger scale requires improving both their production technologies as well as those of labelled substances and, at the same time, the analytical methods

  19. Chromium isotope variations

    DEFF Research Database (Denmark)

    D'Arcy, Joan Mary

    Chromium (Cr) stable isotopes are a useful tracer of changes in redox conditions because changes in its oxidation state are accompanied by an isotopic fractionation. For this reason the Cr isotope system is being developed as a potential tool for paleo-redox reconstruction. Dissolved Cr in seawater...... is incorporated into carbonates. Hence, ancient carbonates can potentially record the Cr isotopic composition (δ53Cr ‰) of seawater in the geological past. Reliable application and interpretation of this proxy requires a detailed knowledge about processes that fractionate Cr on the Earth’s surface......, and the quantification the Cr isotope composition of major Cr fluxes into and out of ocean. This thesis adds to the current knowledge of the Cr isotope system and is divided into two studies. The focus of the first study was to determine what processes control the Cr isotopic compositionof river...

  20. An approach to noble-gas isotopic compositions in natural gases and gas-source tracing in the Ordos Basin, China

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Isotopic compositions of noble gases, i.e. He Ar Kr and Xe, are measured in natural gases from the Zhongbu gasfield in the Ordos Basin. And heavy noble-gas isotopes (Kr, Xe) are here first used in geochemically studying natural gases and gas-source correlation. Isotopic compositions of heavy noble gases in natural gases, especially Xe, show two-source mixing in the Zhongbu gasfield. Gas sources are somewhat different in the northeast and the southwest of the gasfield. Generally, the gas source of the Lower Paleozoic makes a greater contribution in the southwest than in the northeast in the field. Two kinds of gases can be differentiated from isotopic compositions of heavy noble gases and from their relation with the Ar isotopic composition, Therefore, the comprehensive study on isotopic compositions of light and heavy noble gases can supply more useful information on gas-source correlation and tracing.

  1. Molybdenite Re-Os and muscovite 40Ar/39Ar dating of quartz vein-type W-Sn polymetallic deposits in Northern Guangdong, South China

    Science.gov (United States)

    Qi, Hua-Wen; Hu, Rui-Zhong; Wang, Xiao-Fei; Qu, Wen-Jun; Bi, Xian-Wu; Peng, Jian-Tang

    2012-08-01

    Northern Guangdong is an important part of Nanling tungsten-tin metallogenic belt, South China. The tungsten mineralization in this area consists of mainly quartz-wolframite vein-type mineralization, with W-Sn polymetallic deposits mostly distributed at the outer contact zone between concealed Late Jurassic granitic stocks and Cambrian-Ordovician low-metamorphosed sandstones and shales. Molybdenite Re-Os and muscovite 40Ar/39Ar isotopic dating of three typical tungsten vein-type deposits (Yaoling, Meiziwo, and Jubankeng) in northern Guangdong, show that two episodes of Late Jurassic W-Sn polymetallic mineralization occurred in this area: an early episode during the Late Jurassic (158-159 Ma) represented by the Yaoling, Hongling, and Meiziwo tungsten deposits, and a younger event during the Early Cretaceous (138 Ma) represented by the Jubankeng deposit. Analysis of available radiometric ages of several W-Sn deposits in the Nanling region indicate that these deposits formed at several intervals during the Mesozoic at 90-100, 134-140, 144-162, and 210-235 Ma, and that large-scale W-Sn mineralization in this region occurred mainly between 150 and 160 Ma.

  2. U-Pb SHRIMP and 40Ar/39Ar constraints on the timing of mineralization in the Paleoproterozoic Caxias orogenic gold deposit, Sao Luis cratonic fragment, Brazil

    International Nuclear Information System (INIS)

    Caxias is an orogenic gold deposit in the Sao Luis cratonic fragment, which is correlated with the Rhyacian terranes of the West-African Craton. The deposit postdates peak metamorphism (estimated at 2100 ± 15 Ma) and is hosted in a shear zone that cuts across schists of the Aurizona Group (2240 ± 5 Ma) and the Caxias Microtonalite. The emplacement age of the microtonalite, as determined in this work by SHRIMP U-Pb zircon dating, is 2009 ± 11 Ma and represents a latest age magmatic event in the Sao Luis cratonic fragment. Older zircon age of 2139 ± 10 Ma is interpreted as due to inheritance from the older granitoid or volcanic suites (magmatic sources?) or to contamination during emplacement. Lead isotope compositions indicate that the Pb incorporated in ore-related pyrite was probably sourced from regional, orogenic calc-alkaline granitoids of ca. 2160 Ma. Hydrothermal sericite from Caxias yielded a 40Ar/39Ar plateau age of 1990 ± 30 Ma, which combined with the emplacement age of the Caxias Microtonalite brackets the age of gold mineralization between 2009 ± 11 and 1990 ± 30 Ma. (author)

  3. 40Ar/39 Ar and paleomagnetic results from the Guapore shield: further implications for the nature of middle-late proterozoic mobile belts of Gondwana land

    International Nuclear Information System (INIS)

    Twenty sites in diverse rock units of the Serra dos Carajas region provide the first paleomagnetic poles from the Guapore shield of the Amazonian Craton. The most reliable results were obtained from the Pium Complex and the Carajas and Seringa granites. The ages of magnetization of these units are reasonably well constrained by isotopic data: 40 Ar/39 Ar data on a Pium hornblende indicate an Archean (>2.7 Ga) age for high grade metamorphism, but biotite and plagioclase from the same sample, plus biotite from another, all record a trans-Amazonian overprint. Thus the trans-Amazonian orogeny in this area produced temperatures between ca. 300 and 500 o C, apparently sufficient to re magnetize these rocks, and was followed by relatively rapid cooling uninterrupted by significant later regional metamorphism. Emplacement of the Carajas and Seringa granites, members of an extensive suite of anorogenic granitoids of the craton, is reasonably well constrained by previous studies at 1.70 to 1.83 Ga. A F and thermal demagnetization of specimens from three sites in the Pium complex and one in each of the granites reveals multicomponent behavior, but characteristic direction with moderately high coercivity and/or blocking temperature were isolated from all five sites. (author)

  4. Contributions à la chaine logistique numérique : conception de circuits courts et planification décentralisée.

    OpenAIRE

    Ogier, Maxime

    2013-01-01

    The concept of digital supply chain gathers models, methods and tools to plan decisions on digital prototypes of supply chains. This doctoral dissertation proposes two contributions to digital supply chain. Mainly, our results address small and medium enterprises/industries. Firstly, we study two new problems related to service network design for short and local fresh food supply chains. For each of them we propose a Mixed Integer Linear Programming formulation. Decomposition-based methods ar...

  5. Independent sets in chain cacti

    CERN Document Server

    Sedlar, Jelena

    2011-01-01

    In this paper chain cacti are considered. First, for two specific classes of chain cacti (orto-chains and meta-chains of cycles with h vertices) the recurrence relation for independence polynomial is derived. That recurrence relation is then used in deriving explicit expressions for independence number and number of maximum independent sets for such chains. Also, the recurrence relation for total number of independent sets for such graphs is derived. Finaly, the proof is provided that orto-chains and meta-chains are the only extremal chain cacti with respect to total number of independent sets (orto-chains minimal and meta-chains maximal).

  6. Identification and analysis of ARS function of six plant MARs

    Institute of Scientific and Technical Information of China (English)

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  7. Elaboration of a model of the nuclear fragmentation and application to the method of isotopic separation of projectile fragments

    International Nuclear Information System (INIS)

    In this thesis the experimental results on the cross sections for the production of 36P in the fragmentation of 403 MeV/u 40Ar on a carbon target are presented. Furthermore some models of the nuclear fragmentation are elaborated and compared by means of experimental data for the production of gold and cerium isotopes in the reaction 12C+209Bi at 400 MeV/u, of chlorine, sulfur, aluminium, magnesium, and oxygen isotopes in the reactions 40Ar+12C at 600 MeV/u and 48Ca+9Be at 212 MeV/u, and of cobalt, manganese, vanadium, and scandium isotopes together with the charge distributions for A=43 and A=44 in the reactions 40Ar+64Cu at 2 GeV/u and 56Fe+12C at 600 MeV/u. (HSI)

  8. Isotopic contamination in electromagnetic isotope separators

    International Nuclear Information System (INIS)

    The mechanisms producing isotopic contamination in the electromagnetic separation of isotopes are studied with the aid of the Separator of Saclay and an electrostatic analyzer in cascade. After a separate investigation the result of which is that no contamination comes from the spreading of initial energies of ions, two principal mechanisms are emphasized; scattering and instability of the regime of the sources. The characters of each type of contamination arising from both mechanisms are described in some detail. An unique scheme of isotopic contamination is then derived from the partial ones. This scheme is successfully verified in several experimental separations. The applications concern principally the performances of magnetic cascades and more complex apparatus. It is found that the isotopic purities that such machines can deliver are extremely high. (author)

  9. Fields From Markov Chains

    DEFF Research Database (Denmark)

    Justesen, Jørn

    2005-01-01

    A simple construction of two-dimensional (2-D) fields is presented. Rows and columns are outcomes of the same Markov chain. The entropy can be calculated explicitly.......A simple construction of two-dimensional (2-D) fields is presented. Rows and columns are outcomes of the same Markov chain. The entropy can be calculated explicitly....

  10. Sustainable Supply Chain Design

    DEFF Research Database (Denmark)

    Bals, Lydia; Tate, Wendy

    design for TBL sustainability. These are located in catastrophe-ridden Haiti and supported by the Germany-based investor company Yunus Social Business. Three supply chain archetypes combining physical and support chains are presented that focus on TBL sustainable outputs and outcomes. For SSCM research...

  11. Chain Reaction Polymerization.

    Science.gov (United States)

    McGrath, James E.

    1981-01-01

    The salient features and importance of chain-reaction polymerization are discussed, including such topics as the thermodynamics of polymerization, free-radical polymerization kinetics, radical polymerization processes, copolymers, and free-radical chain, anionic, cationic, coordination, and ring-opening polymerizations. (JN)

  12. Naturally-occurring stable isotopes as direct measures of larval feeding efficiency, nutrient incorporation and turnover

    OpenAIRE

    Le Vay, Lewis; Gamboa-Delgado, Julián

    2011-01-01

    Stable isotopes are non-hazardous markers that have been widely-used in assessing energy flow within aquatic ecosystems. Hatchery systems are also highly amenable to this approach, as they represent controlled mesocosms with a limited number of food sources and short planktonic food chains with rapid and measurable bioaccumulation of the heavier stable isotopes of carbon and nitrogen at each trophic step. Differences in the natural isotopic composition of dietary components may be used to pro...

  13. Gamow-Teller response in deformed even and odd neutron-rich Zr and Mo isotopes

    OpenAIRE

    Sarriguren, Pedro; Algora, Alejandro; Pereira, J

    2014-01-01

    β-decay properties of neutron-rich Zr and Mo isotopes are investigated within a microscopic theoretical approach based on the proton-neutron quasiparticle random-phase approximation. The underlying mean field is described self-consistently from deformed Skyrme Hartree-Fock calculations with pairing correlations. Residual separable particle-hole and particle-particle forces are also included in the formalism. The structural evolution in these isotopic chains including both even and odd isotope...

  14. NanoSIMS50 analyses of Ar/18O2 plasma-treated Escherichia coli bacteria

    International Nuclear Information System (INIS)

    Reactive oxygen species (ROS) can be produced by electrical discharges and can be transported in uncharged regions by gas flows, in the so-called afterglows. These species are well known to have bactericidal effects but interaction mechanisms that occur with living micro-organisms remain misunderstood. In order to better understand these interactions, new analysis approaches are necessary. High-lateral-resolution secondary ion mass spectrometry (NanoSIMS) is one of the most promising ways of retrieving additional information on bacteria plasma inactivation mechanisms by combining isotopic imaging of plasma-treated bacteria and the use of 18O2 as process gas. Indeed, this technology combines a lateral resolution of a few tens of nanometres that is sufficient to image the interior of bacteria, and a high mass resolution allowing detection of isotopes present in low quantities (a few ppm or lower) within the bacteria. The present paper deals with Ar-18O2 (2%) plasma treatment, through low-pressure microwave late afterglows, of Escherichia coli bacteria and their elemental and isotopic imaging by NanoSIMS. E. coli bacteria have been exposed to this reactive medium for varying treatment duration while keeping all other parameters unchanged. Our main goal is to determine whether the quantity of 18O fixed in treated bacteria and the NanoSIMS50 lateral resolution are sufficient to give additional information on E. coli bacteria-plasma interaction. (paper)

  15. Plasma AR and abiraterone-resistant prostate cancer.

    Science.gov (United States)

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone. PMID:26537258

  16. Behaviour of AR glass fibre for building structural applications

    OpenAIRE

    Miravete, A.; Mieres, J. M.; Calvo, I; Comino, P.; Chiminelli, A.; Cuatrero, J.; Tolosana, N.

    2005-01-01

    The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be...

  17. Opera ar drama... Aleksejus Kartavovas Vilniuje

    OpenAIRE

    Bakutytė, Vida

    2007-01-01

    Straipsnio objektas – vienas iš reikšmingų laikotarpių Lietuvos profesionalaus teatro meno, ypač muzikinio, raidoje. Ši tema mažai tyrinėta muzikos ir teatro istorikų. Keturis sezonus (1887–1891) Vilniaus miesto teatrui vadovavęs talentingas teatro organizatorius Aleksejus Kartavovas iškėlė Vilniaus sceną į pirmaujančiųjų gretas, suaktyvino operos raidą kokybės linkme. Publikacijos tikslas – atskleisti aplinkybes, padėjusias ar trukdžiusias įgyvendinti A. Kartavovo numatytus planus, išryškint...

  18. Integrated supply chain risk management

    OpenAIRE

    Riaan Bredell; Jackie Walters

    2007-01-01

    Integrated supply chain risk management (ISCRM) has become indispensable to the theory and practice of supply chain management. The economic and political realities of the modern world require not only a different approach to supply chain management, but also bold steps to secure supply chain performance and sustainable wealth creation. Integrated supply chain risk management provides supply chain organisations with a level of insight into their supply chains yet to be achieved. If correctly ...

  19. Deactivation of lipopolysaccharide by Ar and H2 inductively coupled low-pressure plasma

    Science.gov (United States)

    Bartis, E. A. J.; Barrett, C.; Chung, T.-Y.; Ning, N.; Chu, J.-W.; Graves, D. B.; Seog, J.; Oehrlein, G. S.

    2014-01-01

    Using an inductively coupled plasma system, we study the effects of direct plasma, plasma-generated high-energy photons in the ultraviolet and vacuum ultraviolet (UV/VUV), and radical treatments on lipopolysaccharide (LPS). LPS is a biomolecule found in the outer membrane of Gram-negative bacteria and a potent stimulator of the immune system composed of polysaccharide and lipid A, which contains six aliphatic chains. LPS film thickness spun on silicon was monitored by ellipsometry while the surface chemistry was characterized before and after treatments by x-ray photoelectron spectroscopy (XPS). Additionally, biological activity was measured using an enzyme-linked immunosorbent assay under (a) a sensitive regime (sub-µM concentrations of LPS) and (b) a bulk regime (above µM concentrations of LPS) after plasma treatments. Direct plasma treatment causes rapid etching and deactivation of LPS in both Ar and H2 feed gases. To examine the effect of UV/VUV photons, a long-pass filter with a cut-off wavelength of 112 nm was placed over the sample. H2 UV/VUV treatment causes material removal and deactivation due to atomic and molecular UV/VUV emission while Ar UV/VUV treatment shows minimal effects as Ar plasma does not emit UV/VUV photons in the transmitted wavelength range explored. Interestingly, radical treatments remove negligible material but cause deactivation. Based on the amphiphilic structure of LPS, we expect a lipid A rich surface layer to form at the air-water interface during sample preparation with polysaccharide layers underneath. XPS shows that H2 plasma treatment under direct and UV/VUV conditions causes oxygen depletion through removal of C-O and O-C = O bonds in the films, which does not occur in Ar treatments. Damage to these groups can remove aliphatic chains that contribute to the pyrogenicity of LPS. Radical treatments from both Ar and H2 plasmas remove aliphatic carbon from the near-surface, demonstrating the important role of neutral species.

  20. Deactivation of lipopolysaccharide by Ar and H2 inductively coupled low-pressure plasma

    International Nuclear Information System (INIS)

    Using an inductively coupled plasma system, we study the effects of direct plasma, plasma-generated high-energy photons in the ultraviolet and vacuum ultraviolet (UV/VUV), and radical treatments on lipopolysaccharide (LPS). LPS is a biomolecule found in the outer membrane of Gram-negative bacteria and a potent stimulator of the immune system composed of polysaccharide and lipid A, which contains six aliphatic chains. LPS film thickness spun on silicon was monitored by ellipsometry while the surface chemistry was characterized before and after treatments by x-ray photoelectron spectroscopy (XPS). Additionally, biological activity was measured using an enzyme-linked immunosorbent assay under (a) a sensitive regime (sub-µM concentrations of LPS) and (b) a bulk regime (above µM concentrations of LPS) after plasma treatments. Direct plasma treatment causes rapid etching and deactivation of LPS in both Ar and H2 feed gases. To examine the effect of UV/VUV photons, a long-pass filter with a cut-off wavelength of 112 nm was placed over the sample. H2 UV/VUV treatment causes material removal and deactivation due to atomic and molecular UV/VUV emission while Ar UV/VUV treatment shows minimal effects as Ar plasma does not emit UV/VUV photons in the transmitted wavelength range explored. Interestingly, radical treatments remove negligible material but cause deactivation. Based on the amphiphilic structure of LPS, we expect a lipid A rich surface layer to form at the air–water interface during sample preparation with polysaccharide layers underneath. XPS shows that H2 plasma treatment under direct and UV/VUV conditions causes oxygen depletion through removal of C–O and O–C = O bonds in the films, which does not occur in Ar treatments. Damage to these groups can remove aliphatic chains that contribute to the pyrogenicity of LPS. Radical treatments from both Ar and H2 plasmas remove aliphatic carbon from the near-surface, demonstrating the important role of neutral

  1. Sensibility of different wheat varieties (strains) to Ar+ implantation

    International Nuclear Information System (INIS)

    The sensibility of different wheat varieties (strains) to Ar+ implantation was studied. The results showed that the survival rate of 21 wheat varieties (strains) at the dose of 6 x 1016 Ar+/cm2 could be divided into five groups: surplus sensitive varieties (strains), sensitive varieties (strains), transitional varieties (strains), obtuse varieties (strains) and surplus obtuse varieties (strains). The sensibility of wheat varieties (strains) to Ar+ injection is high-moisture-fertility wheat varieties (strains) > medium-moisture-fertility wheat varieties (strains) > dry land wheat varieties (strains). The study has provided theoretical basis in induced mutation medial lethal dose of different wheat varieties (strains) to Ar+ implantation. (authors)

  2. Practical reactor production of {sup 41}Ar from argon clathrate

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  3. Hyperdeformed band in the 36Ar nucleus?

    International Nuclear Information System (INIS)

    Complete text of publication follows. The exotic shapes of atomic nuclei has attracted much attention recently both from the experimental and from the theoretical sides. E.g. the superdeformed (SD) shape in N = Z nuclei were observed experimentally during the last decade. In particular the SD band of the 36Ar nucleus was detected in 2000 [1]. Following the experimental observation a considerable theoretical effort has been concentrated on this band. In [2] e.g. the possible binary clusterizations of this state was studied systematically. Similar studies have been done also for the ground, and the hyperdeformed band. The latter one had been predicted from alphacluster model calculations [3]. The possible binary cluster-configurations are important not only for the better understanding of the structure of the shape isomers, but also from the viewpoint of predicting the favoured reaction channels to populate these states. This is the straightforward consequence of the close relation between the clusterization and reaction channels. (In fact, a cluster-configuration is defined by the reaction channel in which it can be observed.) One of the interesting conclusions of the work [2] was, that the hyperdeformed (HD) state of the 36Ar nucleus could be populated in the 24Mg+12C and 20Ne+16O reactions. A recent analysis of the 24Mg+12C elastic scattering [4] revealed the fact that the cross section can be described only by supposing resonances on top of the potential scattering. This very careful analysis incorporated phase-shift study, as well as Regge-pole and energy-dependent resonance calculations. The existence of five resonances have been proved, which have angular momenta 2, 4, 6, 7, 8. These states together with the resonances from the 20Ne+16O reactions seem to establish a rotational band, as shown in the upper part of Fig. 1. Its moment of inertia is in a very good agreement with that of the HD shape predicted from alpha-cluster model [3]. The similarity of the

  4. Supply Chain Connectivity: Enhancing Participation in the Global Supply Chain

    OpenAIRE

    Patalinghug, Epictetus E.

    2015-01-01

    Supply chain connectivity is vital for the efficient flow of trade among APEC economies. This paper reviews the literature and supply chain management, describes the barriers to enhancing participation in global supply chain, analyzes the various measures of supply chain performance, and suggests steps for the Philippines to fully reap the benefits of the global value chain.

  5. Oceanic crust production in the Dinarides during the Senonian: combined U-Pb in situ laser ablation ICP(MC)-MS zircon and mineral separates Ar-Ar dating

    International Nuclear Information System (INIS)

    Full text: Serbian ophiolitic belts are part of ophiolite occurrences traced from the Alps to the Himalayas. Even though they represent one of the largest ophiolitic areas in the world, they are only poorly studied. Our ongoing project presents a comprehensive study of remnants of magmatic members of oceanic crust from Bosnia, Serbia and Macedonia. Here, we present new geochemical data for the area with focus on new U-Pb and Ar-Ar ages for mafic rocks from the Dinarides. It is thought that closure of oceanic domains present in the area of the Dinarides finished latest in early Cretaceous time, based on K-Ar ages of amphibolites from metamorphic sole and over-step sequence conglomerates. The severely altered rocks (LOI up to 9 %, high mobile element content) are characterized by low Ni and Cr contents and Mg number (66-44), implying that fractionation of mafic minerals was one of the processes modifying these magmas. Based on trace element geochemistry, especially REE patterns, rocks display MORB (depleted LREE compared to HREE,) and marginal basin basalt (somewhat elevated LREE over HREE,) signatures. The isotopic data, measured on leached samples, show more radiogenic 87Sr/86Sr (0.703854 - 0.704317), unradiogenic 143Nd/144Nd (0.512860 - 0.512733), and radiogenic 206Pb/204Pb (18.478 - 20.284), 208Pb/204Pb (38.485 - 39.957), and 207Pb/204Pb (15.611 - 15.709) values when compared with recent MORB. Although the Sr and Pb composition could reflect see water contamination, the Nd isotopic composition suggests a subduction-related setting for the generation of these magmas. We used a novel approach in ophiolite research by combining U-Pb and Lu-Hf zircon analyses by in situ laser ablation ICP-(MC)-MS and Ar-Ar dating. Combined Hf (in zircon) and Nd (on whole rock samples) data give the most accurate information about the composition of the source. First data show that zircon from a gabbro have 176Hf/177Hf slightly higher than chondritic values (0.282730 ± 0.000028; 2SD

  6. Seasonal variation in stable carbon and nitrogen isotope values of bats reflect environmental baselines.

    Science.gov (United States)

    Popa-Lisseanu, Ana G; Kramer-Schadt, Stephanie; Quetglas, Juan; Delgado-Huertas, Antonio; Kelm, Detlev H; Ibáñez, Carlos

    2015-01-01

    The stable carbon and nitrogen isotope composition of animal tissues is commonly used to trace wildlife diets and analyze food chains. Changes in an animal's isotopic values over time are generally assumed to indicate diet shifts or, less frequently, physiological changes. Although plant isotopic values are known to correlate with climatic seasonality, only a few studies restricted to aquatic environments have investigated whether temporal isotopic variation in consumers may also reflect environmental baselines through trophic propagation. We modeled the monthly variation in carbon and nitrogen isotope values in whole blood of four insectivorous bat species occupying different foraging niches in southern Spain. We found a common pattern of isotopic variation independent of feeding habits, with an overall change as large as or larger than one trophic step. Physiological changes related to reproduction or to fat deposition prior to hibernation had no effect on isotopic variation, but juvenile bats had higher δ13C and δ15N values than adults. Aridity was the factor that best explained isotopic variation: bat blood became enriched in both 13C and 15N after hotter and/or drier periods. Our study is the first to show that consumers in terrestrial ecosystems reflect seasonal environmental dynamics in their isotope values. We highlight the danger of misinterpreting stable isotope data when not accounting for seasonal isotopic baselines in food web studies. Understanding how environmental seasonality is integrated in animals' isotope values will be crucial for developing reliable methods to use stable isotopes as dietary tracers. PMID:25700080

  7. Frequency shift in high order harmonic generation from isotopic molecules

    CERN Document Server

    He, Lixin; Zhai, Chunyang; Wang, Feng; Shi, Wenjing; Zhang, Qingbin; Zhu, Xiaosong; Lu, Peixiang

    2016-01-01

    We report the first experimental observation of frequency shift in high order harmonic generation (HHG) from isotopic molecules H2 and D2 . It is found that harmonics generated from the isotopic molecules exhibit obvious spectral red shift with respect to those from Ar atom. The red shift is further demonstrated to arise from the laser-driven nuclear motion in isotopic molecules. By utilizing the red shift observed in experiment, we successfully retrieve the nuclear vibrations in H2 and D2, which agree well with the theoretical calculations from the time-dependent Schrodinger equation (TDSE) with Non-Born-Oppenheimer approximation. Moreover, we demonstrate that the frequency shift can be manipulated by changing the laser chirp.

  8. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  9. Old Shield Basalts from Savai'i Island, Samoa: Validation of A Plume-Hotspot Model for the Samoan Chain

    Science.gov (United States)

    Jackson, M.; Hart, S.; Koppers, A.; Staudigel, H.

    2006-12-01

    The standard model for the generation of an oceanic hotspot track maintains that a deep-seated mantle plume impinges on, and generates melts that escape through, the overriding tectonic plate, thereby generating an age-progressive series of volcanic islands and seamounts. The Samoan hotspot track exhibits several characteristics that are consistent with this model, including an active submarine volcano—Vailulu'u—that anchors the eastern extremity of the chain. The older, submarine portions of the 1700 km chain display a reasonable fit to Pacific plate velocity. However, Savai'i, the westernmost island, has been almost completely re-surfaced with recent, rejuvenated volcanism and there are no subaerial shield basalts with ages (~5 my) predicted by the plume-hotspot model. This lack of a clear age-progression has been taken as evidence that the Samoan hotspot chain is not plume-driven, but is simply a tectono-magmatic manifestation of the nearby Tonga subduction zone. We report geochemical analyses of old basalts recovered from the deep flanks of Savai'i during the 2005 Samoan ALIA cruise. In Samoa, Pb-isotopes provide a good discriminant between shield and rejuvenated basalts, as basalts mapped as rejuvenated in the field have an isotopic signature that is distinct from basalts mapped as shield. Basalts from four separate dredges on the submarine flanks Savai'i exhibit Pb-isotope pedigrees previously observed only in the young, shield-building province of the eastern Samoan islands and seamounts: Dredge 114 has two samples similar in chemistry to Ta'u island, dredge 128 samples are similar to lavas from Tutuila Island, dredge 115 lavas plot either within or very near the Samoan shield basalt field, and dredge 118 reveals surprising heterogeneity, with samples that lie well outside the field for published Samoan basalt data. A fifth dredge (116) on the west rift zone of Savai'i yielded a basalt with clear post-erosional affinities. Dredges 115, 118 and 128 also

  10. Reactivation episodes of the romeral fault system in the northwestern part of central andes, colombia, through 39ar-40ar and k-ar results

    OpenAIRE

    VINASCO VALLEJO, CESAR JAVIER; Cordani, Umberto

    2013-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  11. Geochronological stages of magmatism of Sorsk copper-molybdenum-porphyry are district, Kuznetsk Alatau (K-Ar, Ar-Ar and Rb-Sr methods)

    International Nuclear Information System (INIS)

    Studies on biotite, amphibole and feldspar rocks were conducted through K-Ar, 39Ar-40Ar and Rb-Sr methods for evaluation of geochronological stages of magmatism development of the Sorsk copper-molybdenum-porphyry ore district. It is shown that general duration of magmatism development at the Sorsk district exceeds 100 mln years with intervals between individual magmatic pulses about 30 mln years. Dating by magmatites, related to ore-bearing porphyry complex and ore-metasotamic formations, is within the interval of 380-400 mln years. 13 refs.; 2 figs

  12. Isotope enrichment systems

    International Nuclear Information System (INIS)

    This invention provides a system in which both phases of the countercurrent contact isotope exchange concentration process are recycled continuously and an isotope depleted liquid phase substance thereof has its prior content of the desired isotope of hydrogen and/or oxygen replenished in an isotope regenerator by direct contact isotope exchange with a flow of steam from a source external to the concentrating process, whereby such replenished liquid serves as the feed liquid for the concentration process. As the supply of steam is gaseous, all problems incident to mineral solids in solution in liquid water are eliminated. As the elevated temperature corresponds to that of the steam, the isotope replenishment of the process feed liquid may be conducted without materially altering the characteristics of the steam for use as an energy source in any system

  13. Ab Initio Potential Curve for ArH+%ArH+势能曲线的从头计算

    Institute of Scientific and Technical Information of China (English)

    王胜龙; 屈军艳; 郭锐; 赵新生

    2001-01-01

    The molecular parameters of ArH+ have been calculated with different quantum chemistry methods and basis sets.Based on the data from QCISD/Aug cc pVTZ ab initio calculation for different configurations of ArH+ and the experimental data,an accurate potential curve for ArH+ has been constructed.The molecular properties,such as dissociation energy,equilibrium bond length,and vibrational energy levels,can be accurately reproduced.

  14. Isotopic and noble gas geochemistry in geothermal research

    Energy Technology Data Exchange (ETDEWEB)

    Kennedy, B.M.; DePaolo, D.J. [Lawrence Berkeley National Lab., CA (United States)

    1997-12-31

    The objective of this program is to provide, through isotopic analyses of fluids, fluid inclusions, and rocks and minerals coupled with improved methods for geochemical data analysis, needed information regarding sources of geothermal heat and fluids, the spatial distribution of fluid types, subsurface flow, water-rock reaction paths and rates, and the temporal evolution of geothermal systems. Isotopic studies of geothermal fluids have previously been limited to the light stable isotopes of H, C, and O. However, other isotopic systems such as the noble gases (He, Ne, Ar, Kr and Xe) and reactive elements (e.g. B, N, S, Sr and Pb) are complementary and may even be more important in some geothermal systems. The chemistry and isotopic composition of a fluid moving through the crust will change in space and time in response to varying chemical and physical parameters or by mixing with additional fluids. The chemically inert noble gases often see through these variations, making them excellent tracers for heat and fluid sources. Whereas, the isotopic compositions of reactive elements are useful tools in characterizing water-rock interaction and modeling the movement of fluids through a geothermal reservoir.

  15. Understanding the supply chain

    Directory of Open Access Journals (Sweden)

    Aćimović Slobodan

    2006-01-01

    Full Text Available Supply chain management represents new business philosophy and includes strategically positioned and much wider scope of activity in comparison with its "older brother" - management of logistics. Philosophy of the concept of supply chain is directed to more coordination of key business functions of every link in distribution chain in the process of organization of the flow of both goods and information, while logistic managing instruments are focused on internal optimum of flows of goods and information within one company. Applying the concept of integrated supply chain among several companies makes the importance of operative logistics activity even greater on the level of one company, thus advancing processes of optimum and coordination within and between different companies and confirms the importance of logistics performances for the company’s profitability. Besides the fact that the borders between companies are being deleted, this concept of supply chain in one distribution channel influences increasing of importance of functional, i.e. traditional business managing approaches but instead it points out the importance of process managing approaches. Although the author is aware that "there is nothing harder, more dangerous and with uncertain success, but to find a way for introducing some novelties (Machiavelli, it would be even his additional stimulation for trying to bring closer the concept and goals of supply chain implementation that are identified in key, relevant, modern, theoretical and consulting approaches in order to achieve better understanding of the subject and faster implementation of the concept of supply chain management by domestic companies.

  16. SUMO chains: polymeric signals.

    Science.gov (United States)

    Vertegaal, Alfred C O

    2010-02-01

    Ubiquitin and ubiquitin-like proteins are conjugated to a wide variety of target proteins that play roles in all biological processes. Target proteins are conjugated to ubiquitin monomers or to ubiquitin polymers that form via all seven internal lysine residues of ubiquitin. The fate of these target proteins is controlled in a chain architecture-dependent manner. SUMO (small ubiquitin-related modifier) shares the ability of ubiquitin to form chains via internal SUMOylation sites. Interestingly, a SUMO-binding site in Ubc9 is important for SUMO chain synthesis. Similar to ubiquitin-polymer cleavage by USPs (ubiquitin-specific proteases), SUMO chain formation is reversible. SUMO polymers are cleaved by the SUMO proteases SENP6 [SUMO/sentrin/SMT3 (suppressor of mif two 3)-specific peptidase 6], SENP7 and Ulp2 (ubiquitin-like protease 2). SUMO chain-binding proteins including ZIP1, SLX5/8 (synthetic lethal of unknown function 5/8), RNF4 (RING finger protein 4) and CENP-E (centromere-associated protein E) have been identified that interact non-covalently with SUMO chains, thereby regulating target proteins that are conjugated to SUMO multimers. SUMO chains play roles in replication, in the turnover of SUMO targets by the proteasome and during mitosis and meiosis. Thus signalling via polymers is an exciting feature of the SUMO family. PMID:20074033

  17. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley, Maghalaya, India

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande

    2001-09-01

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma and 107.5 ± 1.4 Ma, respectively. The weighted mean of these ages, 107.2 ± 0.8 Ma, is the time of emplacement of this complex. This implies that Sung Valley complex and probably other such complexes in the Assam-Meghalaya Plateau postdate the main ood basalt event (i.e., the eruption of tholeiites) in the RBS province by ∼10 Ma.

  18. Acoustic resonance spectroscopy (ARS): ARS300 operations manual, software version 2.01

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-25

    Acoustic Resonance Spectroscopy (ARS) is a nondestructive evaluation technology developed at the Los Alamos National Laboratory. The ARS technique is a fast, safe, and nonintrusive technique that is particularly useful when a large number of objects need to be tested. Any physical object, whether solid, hollow, or fluid filled, has many modes of vibration. These modes of vibration, commonly referred to as the natural resonant modes or resonant frequencies, are determined by the object`s shape, size, and physical properties, such as elastic moduli, speed of sound, and density. If the object is mechanically excited at frequencies corresponding to its characteristic natural vibrational modes, a resonance effect can be observed when small excitation energies produce large amplitude vibrations in the object. At other excitation frequencies, i.e., vibrational response of the object is minimal.

  19. Support for the Astronomically Calibrated 40Ar/39Ar Age of Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian;

    2011-01-01

    Fish Canyon sanidine (FCs) is the neutron fluence monitor most widely used in Cenozoic argon geochronology. Recommend published ages for FCs have been determined through various intercalibration techniques, but have varied by up to 2% over the last three decades. The robust quality of the...... astronomical timescale, with precision better than 0.1% for the last 10 million years for directly tuned sections, suggests intercalibration with K-bearing minerals intercalated in astronomically tuned stratigraphic sections as the best way to proceed with addressing the true age of FCs. Recently, Kuiper, et...... al. (2008) determined an astronomically calibrated 40Ar/39Ar age of 28.201 0.046 Ma (2), relative to the indirect astronomically tuned Moroccan Melilla Basin Messâdit section. Here, we provide independent verification for the Kuiper, et al. (2008) FCs age using sanidines extracted from the A1 tephra...

  20. 40Ar/39Ar Age of the Lathrop Wells Volcanic Center, Yucca Mountain, Nevada.

    Science.gov (United States)

    Turrin, B D; Champion, D; Fleck, R J

    1991-08-01

    Paleomagnetic and (40)Ar/(39)Ar analyses from the Lathrop Wells volcanic center, Nevada, indicate that two eruptive events have occurred there. The ages (136 +/- 8 and 141 +/- 9 thousand years ago) for these two events are analytically indistinguishable. The small angular difference (4.7 degrees ) between the paleomagnetic directions from these two events suggests they differ in age by only about 100 years. These ages are consistent with the chronology of the surficial geological units in the Yucca Mountain area. These results contradict earlier interpretations of the cinder-cone geomorphology and soil-profile data that suggest that at least five temporally discrete eruptive events occurred at Lathrop Wells approximately 20,000 years ago. PMID:17772371

  1. The fluence effect of Ar++ bombardment in PPS

    International Nuclear Information System (INIS)

    The modifications induced by ion bombardment on the physical and chemical structures and on thermal, optical and electrical properties of poly(phenylene sulphide), PPS, were investigated. Thin PPS foils, 2, 6 and 125 μm thick were bombarded with Ar++ (700 keV) under initial vacuum of 10-6 torr. Changes in the chemical structure were monitored by infrared absorption spectroscopy (FTIR) and ultraviolet and visible spectroscopy (UV-VIS). Modifications in the relative atomic composition of the bombarded polymer samples were determined by elemental analysis (CHN) and Rutherford backscattering spectrometry (RBS). Processes resulting from ion implantation on the physical structure of PPS were followed by X-ray diffraction spectrometry (XRD), differential scanning calorimetry (DSC), solubility tests and electrical conductivity measurements. Thermal stability of these samples was established by thermogravimetric analysis (TGA). Ion bombardment induces electronic excitation and ionization of molecular species, which leads to crystallinity loss, chemical bonds disruptions and formation of free radicals. These reactive groups lead to the formation of cross-linking processes and absorption of atmospheric gases, like oxygen and nitrogen. Oxygen is combined with the polymer main chain, partaking in the cross-linking and in the formation of conjugated structures. Due to extensive bond conjugation the energy gap between valence and conduction bands diminishes. This process favors charge transport, leading to an increase of the macroscopic electrical conductivity. However, after bombardment, the oxygen absorption induces a continuous decrease of the conductivity, even after a period of six months. The samples irradiated with the highest fluences exhibit conductivities similar to those of semiconductors. A kinetic study of the thermal degradation of implanted samples indicates that the thermal stability, defined by the onset temperature and the activation energy of the process

  2. Comparison of Estimation Procedures for Multilevel AR(1) Models

    Science.gov (United States)

    Krone, Tanja; Albers, Casper J.; Timmerman, Marieke E.

    2016-01-01

    To estimate a time series model for multiple individuals, a multilevel model may be used. In this paper we compare two estimation methods for the autocorrelation in Multilevel AR(1) models, namely Maximum Likelihood Estimation (MLE) and Bayesian Markov Chain Monte Carlo. Furthermore, we examine the difference between modeling fixed and random individual parameters. To this end, we perform a simulation study with a fully crossed design, in which we vary the length of the time series (10 or 25), the number of individuals per sample (10 or 25), the mean of the autocorrelation (−0.6 to 0.6 inclusive, in steps of 0.3) and the standard deviation of the autocorrelation (0.25 or 0.40). We found that the random estimators of the population autocorrelation show less bias and higher power, compared to the fixed estimators. As expected, the random estimators profit strongly from a higher number of individuals, while this effect is small for the fixed estimators. The fixed estimators profit slightly more from a higher number of time points than the random estimators. When possible, random estimation is preferred to fixed estimation. The difference between MLE and Bayesian estimation is nearly negligible. The Bayesian estimation shows a smaller bias, but MLE shows a smaller variability (i.e., standard deviation of the parameter estimates). Finally, better results are found for a higher number of individuals and time points, and for a lower individual variability of the autocorrelation. The effect of the size of the autocorrelation differs between outcome measures.

  3. Lifetime measurement for the 21+ state in 140Sm and the onset of collectivity in neutron-deficient Sm isotopes

    Science.gov (United States)

    Bello Garrote, F. L.; Görgen, A.; Mierzejewski, J.; Mihai, C.; Delaroche, J. P.; Girod, M.; Libert, J.; Sahin, E.; Srebrny, J.; Abraham, T.; Eriksen, T. K.; Giacoppo, F.; Hagen, T. W.; Kisielinski, M.; Klintefjord, M.; Komorowska, M.; Kowalczyk, M.; Larsen, A. C.; Marchlewski, T.; Mitu, I. O.; Pascu, S.; Siem, S.; Stolarz, A.; Tornyi, T. G.

    2015-08-01

    Background: The chain of Sm isotopes exhibits a wide range of nuclear shapes and collective behavior. While the onset of deformation for N >82 has been well studied both experimentally and theoretically, fundamental data is lacking for some Sm isotopes with N Weisskopf units. The theoretical calculations are in very good agreement with the experimental result. Conclusions: The B (E 2 ;21+→01+) value for 140Sm fits smoothly into the systematic trend for the chain of Sm isotopes. The new beyond-mean field calculations are able to correctly describe the onset of collectivity in the Sm isotopes below the N =82 shell closure for the first time.

  4. 40Ar/39Ar dating and paleo-magnetism of traps from Ethiopia, Deccan and Siberia

    International Nuclear Information System (INIS)

    Recent studies have shown that major flood basalt provinces have been emplaced as short events (∼ 1 Myr), more or less synchronous with climatic crises and mass extinctions. We present new geochronologic (40Ar/39Ar) and magneto-stratigraphic results for the Ethiopian traps, one of the last remaining flood basalts for which little of such data were available. The ages obtained in a 2000 m thick section are indistinguishable. Moreover, magneto-stratigraphy reveals a simple 3-chron reverse-normal-reverse sequence. Although magnetic chrons cannot be yet unambiguously identified, there is more likelihood for the normal sub-chron in the main basaltic pile to correspond to 11N, supporting a brief duration (less than 1.5 Ma). The Ethiopian traps erupted near 30 Ma at or near the time of the cold and dry climate, major Antarctic ice sheet advance, and the largest sea-level drop in the Tertiary. Bhandari et al. (GRL, 1995) have discovered inter-traps sediments with a triple iridium anomaly in a series of seven basaltic lava flows in the Kutch area of the North Western Deccan traps of India. Plagioclases from three flows above the iridium bearing sediments yield 39Ar/40Ar plateau ages near 65.0 Ma: these flows have unambiguously reversed magnetic polarity interpreted as chron 29R. As a preliminary summary, evidence of the KTB asteroid impact is confirmed in the Deccan traps, showing that they are coeval events in a general sense (in a Ma long window) though clearly with vastly different time constants. This is compatible with paleontologic evidence of two scales of extinctions, one quasi-instantaneous and the other on the order of 105 to 106 yrs. Clearly, the impact cannot have caused trap eruptions. On the other hand, the exact age and significance of the lower flows more altered remains to be analyzed further as they pertained to the much debated question of duration of Deccan trap volcanism. (author)

  5. 40 Ar/ 39 Ar radiometric dating to constrain the volcanic stratigraphy: The Mt. Etna methodological case.

    OpenAIRE

    De Beni, E.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Groppelli, G.; Istituto per la Dinamica dei Processi Ambientali–Sezione di Milano, Consiglio Nazionale delle Ricerche, via Mangiagalli 34, 20133 Milano, Italy

    2010-01-01

    Although ~50 radiometric age analyses have been performed on Etna, and there are many historical references, these are not enough to temporally constrain the geo- logical evolution of the volcano. In particular, a new stratigraphic framework based on lithostratigraphic and unconformity-bounded units has pointed out the presence of some stratigraphic uncertainty that can be resolved only with radiometric dating. For this reason, a dating project applying the 40 Ar/ ...

  6. 40Ar/39Ar geochronology and paleomagnetism of Independence volcano, Absaroka volcanic supergroup, Beartooth mountains, Montana

    Science.gov (United States)

    Harlan, S.S.; Snee, L.W.; Geissman, J.W.

    1996-01-01

    Independence volcano is a major volcanic complex in the lower part of the Absaroka Volcanic Supergroup (AVS) of Montana and Wyoming. Recently reported Rb-Sr mineral dates from the complex give apparent ages of 91 and 84 Ma, whereas field relationships and the physical and compositional similarity of the rocks with other dated parts of the AVS indicate an Early to Middle Eocene age for eruption and deposition. To resolve the conflict between age assignments based on stratigraphic correlations and Rb-Sr dates, we report new paleomagnetic data and 40Ar/39Ar dates for Independence volcano. Paleomagnetic data for the stock and an and andesite plug that cuts the stock are well grouped, of reverse polarity, and yield a virtual geomagnetic pole that is essentially identical to Late Cretaceous and Tertiary reference poles. The reverse polarity indicates that the magnetization of these rocks is probably younger than the Cretaceous normal superchron, or less than about 83.5 Ma. Hornblende from a volcanic breccia near the base of the volcanic pile gives a 40Ar/39Ar age of 51.57 Ma, whereas biotites from a dacite sill and a granodiorite stock that forms the core of the volcano give dates that range from 49.96 to 48.50 Ma. These dates record the age of eruption and intrusion of these rocks and clearly show that the age of Independence volcano is Early to Middle Eocene, consistent with stratigraphic relations. We suggest that the Rb-Sr mineral dates from the Independence stock and related intrusions are unreliable.

  7. Arís 2.1: Adapting Arís for Object Oriented Language

    OpenAIRE

    Rahman, Fahrurrozi

    2014-01-01

    In the software development area, software verification is important such that it can guarantee the software fulfills its requirements. Despite its importance, verifying software is difficult to achieve. Additional knowledge and effort are needed to write specification especially if the software is complex and big in size. Nevertheless, there are some software that already have verified specifications. This project will focus on extending Arís (Analogical Reasoning for reuse of Im...

  8. Dicty_cDB: FC-AR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR21 (Link to dictyBase) - - - Contig-U16455-1 FC-AR21Z (Li...nk to Original site) - - FC-AR21Z 528 - - - - Show FC-AR21 Library FC (Link to library) Clone ID FC-AR21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR21Q.Seq.d/ Representative seq. ID FC-AR...21Z (Link to Original site) Representative DNA sequence >FC-AR21 (FC-AR21Q) /CSM/FC/FC-AR/FC-AR21Q.Seq....omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR21 (FC-AR

  9. New K-Ar ages of the Martel Inlet Group, king George Island, South Shetland Islands, Antarctica

    International Nuclear Information System (INIS)

    This paper presents twelve new K-Ar whole rocks ages of the Martel Inlet Group that crops out in the Keller Peninsula region, in the Admiralty Bay, King George Island. That lithostratigraphic unit has been considered the oldest one know in the area and it is the result of several volcanic and volcanoclastic episodes occurred probably during the Upper Jurassic. As the group is mainly represented by lithologies that show low-grade metamorphic changes and metasomatic evidences, as well as other alteration processes, it has been difficult to obtain that expected age, specially using the K-Ar method. A significant number of time values concentrated between 40 and 50 Ma, independently of the unit's position in the strategraphic context, could be suggesting an important tectono-thermal event that affected the area setting the isotopic results by re-heating and/or by chemical processes. (author)

  10. Project Decision Chain

    DEFF Research Database (Denmark)

    Rolstadås, Asbjørn; Pinto, Jeffrey K.; Falster, Peter;

    2015-01-01

    To add value to project performance and help obtain project success, a new framework for decision making in projects is defined. It introduces the project decision chain inspired by the supply chain thinking in the manufacturing sector and uses three types of decisions: authorization, selection......, and plan decision. A primitive decision element is defined where all the three decision types can be accommodated. Each task in the primitive element can in itself contain subtasks that in turn will comprise new primitive elements. The primitive elements are nested together in a project decision chain....

  11. Uses of stable isotopes

    International Nuclear Information System (INIS)

    The most important fields of stable isotope use with examples are presented. In isotope dilution analysis the stable isotopes are used in trace analysis, measurements of volumes and masses. In the field of stable isotope use as tracers the following applications are encountered: transport phenomena, environmental studies, agricultural research, authentication of products and objects, archaeometry, studies of reaction mechanisms, structure and function determination of complex biological entities, studies of metabolism, breath test for diagnostic. In the domain of isotope equilibrium effects applications in the study of mechanism of drug action, study of natural processes, investigation of equilibrium conditions and water cycle as well as in temperature measurements are encountered. Stable isotopes are also used in advanced nuclear reactors, particularly, the uranium nitride with 15 N as nuclear fuel and 157 Gd for reactor control. In spite of some difficulties of stable isotope use, especially related to analytical techniques, which are slow and expensive, the number of papers reporting this subject is steadily growing as well the number of scientific meetings organized by International Isotope Society and IAEA, Gordon Conferences, and regional meetings in Germany, France, etc. Stable isotope application development on large scale is ensured by improving their production technologies, as well as by development of new labelled compounds and of analytical techniques. (author)

  12. Isotopes in hydrogeology

    International Nuclear Information System (INIS)

    Questions of the application of radioactive isotopes in hydrogeology and seismology are considered, as well as their physico-chemical and geochemical properties and the regularities of their occurrence and migration in natural waters. The possibility of application of these isotopes in calculating the age of waters and in solving paleohydrogeological problems is studied. Elucidated are questions of utilization of helium and uranium isotope content in determining the effect of faults on the hydrogeological conditions of regions and in selecting burial sites for industrial wastes. Utilization of changes in the isotopic and gas composition of underground waters during the activization of tectonic movements for earthquake forecasts is considered

  13. PRINCIPAL ISOTOPE SELECTION REPORT

    International Nuclear Information System (INIS)

    Utilizing nuclear fuel to produce power in commercial reactors results in the production of hundreds of fission product and transuranic isotopes in the spent nuclear fuel (SNF). When the SNF is disposed of in a repository, the criticality analyses could consider all of the isotopes, some principal isotopes affecting criticality, or none of the isotopes, other than the initial loading. The selected set of principal isotopes will be the ones used in criticality analyses of the SNF to evaluate the reactivity of the fuel/waste package composition and configuration. This technical document discusses the process used to select the principal isotopes and the possible affect that these isotopes could have on criticality in the SNF. The objective of this technical document is to discuss the process used to select the principal isotopes for disposal criticality evaluations with commercial SNF. The principal isotopes will be used as supporting information in the ''Disposal Criticality Analysis Methodology Topical Report'' which will be presented to the United States Nuclear Regulatory Commission (NRC) when approved by the United States Department of Energy (DOE) Office of Civilian Radioactive Waste Management (OCRWM)

  14. The isotope breathe test

    International Nuclear Information System (INIS)

    The foundations of the breath diagnostic test, based on application of the carbon compounds, labeled with the stable (13C) or radioactive isotope are presented. The methodology for conducting the breath isotope test and the apparatuses, making it possible to determine under clinical conditions the isotope composition of the carbon, contained in the expired air, depending on the introduced tracer type, is briefly described. The safety of the method and prospects of its application are discussed. The examples of the breath isotope test practical application are presented

  15. Spatial autocorrelation method using AR model; Kukan jiko sokanho eno AR model no tekiyo

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, H.; Obuchi, T.; Saito, T. [Iwate University, Iwate (Japan). Faculty of Engineering

    1996-05-01

    Examination was made about the applicability of the AR model to the spatial autocorrelation (SAC) method, which analyzes the surface wave phase velocity in a microtremor, for the estimation of the underground structure. In this examination, microtremor data recorded in Morioka City, Iwate Prefecture, was used. In the SAC method, a spatial autocorrelation function with the frequency as a variable is determined from microtremor data observed by circular arrays. Then, the Bessel function is adapted to the spatial autocorrelation coefficient with the distance between seismographs as a variable for the determination of the phase velocity. The result of the AR model application in this study and the results of the conventional BPF and FFT method were compared. It was then found that the phase velocities obtained by the BPF and FFT methods were more dispersed than the same obtained by the AR model. The dispersion in the BPF method is attributed to the bandwidth used in the band-pass filter and, in the FFT method, to the impact of the bandwidth on the smoothing of the cross spectrum. 2 refs., 7 figs.

  16. Study of the Neutron-rich Isotope Ar-46 Through Intermediate Energy Coulomb Excitation

    Czech Academy of Sciences Publication Activity Database

    Calinescu, S.; Ceceres, L.; Grévy, S.; Sorlin, O.; Sohler, D.; Stanoiu, M.; Negoita, F.; Clement, E.; Astabatyan, R.; Borcea, C.; Borcea, R.; Bowry, M.; Catford, W.; Dombradi, Z.; Franchoo, S.; Garcia, R.; Gillibert, R.; Guerin, H.; Thomas, J. C.; Kuti, I.; Lukyanov, S.; Lepailleur, A.; Maslov, V.; Morfouace, P.; Mrázek, Jaromír; Niikura, M.; Perrot, L.; Podolyak, Z.; Petrone, C.; Peniozhkevich, Y.; Roger, T.; Rotaru, F.; Stefan, I.; Vajta, Zs.; Wilson, E.

    2014-01-01

    Roč. 45, č. 2 (2014), s. 199-204. ISSN 0587-4254 Institutional support: RVO:61389005 Keywords : GANIL * detector Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.850, year: 2014

  17. Age of the Lava Creek supereruption and magma chamber assembly at Yellowstone based on 40Ar/39Ar and U-Pb dating of sanidine and zircon crystals

    Science.gov (United States)

    Vazquez, J. A.; Matthews, N. E.; Calvert, A. T.

    2015-12-01

    The last supereruption from the Yellowstone Plateau formed Yellowstone caldera and ejected the >1000 km3 of rhyolite that composes the Lava Creek Tuff (LCT). Tephra from the eruption blanketed much of the western United States, and is a key Quaternary chronostratigraphic marker, in particular for dating deposition of mid-Pleistocene glacial and pluvial deposits in western North America. We performed 40Ar/39Ar dating of single sanidines to delimit eruption age, and ion microprobe U-Pb and trace-element analyses of crystal faces on single zircons to characterize magmatic evolution and date near-eruption crystallization, as well as analyses of crystal interiors to date the interval of zircon crystallization. Sanidines from the two LCT members A and B yield an 40Ar/39Ar isochron date of 631 ± 4 ka (2σ). Crystal faces on zircons from both members yield a weighted mean 206Pb/238U date of 627 ± 6 ka (2σ) and have trace element concentrations that vary with eruptive stratigraphy. Zircon interiors yield a weighted mean 206Pb/238U date of 660 ± 6 ka, and reveal reverse and/or oscillatory zoning of trace element concentrations, with many crystals containing high-U concentrations and dark cathodoluminescence (CL) cores. These crystals with high-U cores are possibly sourced from 'defrosting' of melt-impregnated margins of the growing subvolcanic reservoir. LCT sanidines mirror the variation of zircon composition within the eruptive stratigraphy, with crystals from upper LCT-A and basal LCT-B having bright-CL rims with high Ba concentrations, suggesting late crystallization after addition of less evolved silicic magma. The occurrence of distal LCT in stratigraphic sequences marking the Marine Isotope Stage 16-15 transition supports the apparent eruption age of ca. 631 ka. These results reveal that Lava Creek zircons record episodic heating, renewed crystallization, and an overall up-temperature evolution for Yellowstone's subvolcanic reservoir in the 103-104 year interval

  18. Southernmost Andes and South Georgia Island, North Scotia Ridge: Zircon U-Pb and muscovite {40Ar }/{39Ar } age constraints on tectonic evolution of Southwestern Gondwanaland

    Science.gov (United States)

    Mukasa, Samuel B.; Dalziel, Ian W. D.

    1996-11-01

    Zircon U-Pb and muscovite {40Ar }/{39Ar } isotopic ages have been determined on rocks from the southernmost Andes and South Georgia Island, North Scotia Ridge, to provide absolute time constraints on the kinematic evolution of southwestern Gondwanaland, until now known mainly from stratigraphic relations. The U-Pb systematics of four zircon fractions from one sample show that proto-marginal basin magmatism in the northern Scotia arc, creating the peraluminous Darwin granite suite and submarine rhyolite sequences of the Tobifera Formation, had begun by the Middle Jurassic (164.1 ± 1.7 Ma). Seven zircon fractions from two other Darwin granites are discordant with non-linear patterns, suggesting a complex history of inheritances and Pb loss. Reference lines drawn through these points on concordia diagrams give upper intercept ages of ca. 1500 Ma, interpreted as a minimum age for the inherited zircon component. This component is believed to have been derived from sedimentary rocks in the Gondwanaland margin accretionary wedge that forms the basement of the region, or else directly from the cratonic "back stop" of that wedge. Ophiolitic remnants of the Rocas Verdes marginal basin preserved in the Larsen Harbour complex on South Georgia yield the first clear evidence that Gondwanaland fragmentation had resulted in the formation of oceanic crust in the Weddell Sea region by the Late Jurassic (150 ± 1 Ma). The geographic pattern in the observed age range of 8 to 13 million years in these ophiolitic materials, while not definitive, is in keeping with propagation of the marginal basin floor northwestward from South Georgia Island to the Sarmiento Complex in southern Chile. Rocks of the Beagle granite suite, emplaced post-tectonically within the uplifted marginal basin floor, have complex zircon U-Pb systematics with gross discordances dominated by inheritances in some samples and Pb loss in others. Of eleven samples processed, only two had sufficient amounts of zircon for

  19. Extension of the nuclear mass surface for neutron-rich isotopes of argon through iron

    Science.gov (United States)

    Meisel, Zachary Paul

    Nuclear mass measurement has maintained an important position in the field of nuclear physics for a little over a century. Nuclear masses provide key evidence of the structural transformation of nuclei away from the valley of beta-stability and are essential input for many simulations of extreme astrophysical environments. However, obtaining these masses is often a challenging endeavor due to the low production cross sections and short half-lives of the exotic nuclei which are of particular interest. To this end, the time-of-flight mass measurement technique has been developed to obtain the masses of several nuclei at once to precisions of 1 part in 105 with virtually no half-life limitation. This dissertation contains a description of the experiment, analysis, and results of the second implementation of the time-of-flight nuclear mass measurement technique at the National Superconducting Cyclotron Laboratory. 18 masses were obtained for neutron-rich isotopes of argon through iron, where the masses of 48Ar, 49Ar, 56Sc, 57Sc, 64Cr, 67Mn, and 69Fe were measured for the first time. These newly obtained masses were applied to outstanding problems in nuclear structure and nuclear astrophysics, resulting in significant scientific advances. The measurement results for 48Ar and 49Ar, which were found to have atomic mass excesses of -22.28(31) MeV and -17.8(1.1) MeV, respectively, provide strong evidence for the closed shell nature of neutron number N = 28 in argon. It follows that argon is therefore the lowest even-Z element exhibiting the N = 28 closed shell. The masses of 64Cr, 67 Mn, and 69Fe, which were found to have atomic mass excesses of -33.48(44) MeV, -34.09(62) MeV, and -39.35(60) MeV, respectively, show signs of nuclear deformation occurring around the N = 40 subshell. In addition, we found 64Cr is substantially less bound than predicted by global mass models that are commonly used in nuclear astrophysics simulations, resulting in a significant reduction in the

  20. Investigation of shape coexistence in 118-128Te isotopes

    CERN Document Server

    Sabri, H; Mohammadi, M A

    2015-01-01

    In this paper, we have considered the interplay between phase transitions and configuration mixing of intruder excitations in the 118-128Te isotopes. A transitional interacting boson model Hamiltonian in both IBM-1 and IBM-2 versions which are based on affine Lie Algebra are employed to describe the evolution from spherical to deformed gamma unstable shapes along the chain of Te isotopes. The excitation energies, B(E0) and B(E2) transition rates are rather well reproduced in comparison with experimental counterparts when the weight of SO(6) limit is increased in Hamiltonian. Also our results show obvious relations between the configuration mixing ratio and quadrupole, hexadecapole and hexacontatetrapole deformation values in this isotopic chain.

  1. Supply chain risk management

    Directory of Open Access Journals (Sweden)

    Christian Hollstein

    2013-03-01

    Full Text Available Background: Supply chain risk management increasingly gains prominence in many international industries. In order to strengthen supply chain structures, processes, and networks, adequate potentials for risk management need to be built (focus on effective logistics and to be utilized (focus on efficient logistics. Natural-based disasters, such as the case of Fukushima, illustrate how crucial risk management is. Method: By aligning a theoretical-conceptual framework with empirical-inductive findings, it may be hypothesized that logistical systems do have a positive effect on supply chain risk management activities.  Result/conclusion:  Flexibility and capacity, as well as redundancy and standardization, are often viewed as being conflictionary. It shows, however, that in the light of supply chain risk management, those factors may yield a common benefit if proper logistics systems are applied.  

  2. Editorial: Supply Chain Management

    Directory of Open Access Journals (Sweden)

    Aidonis, D.

    2012-01-01

    Full Text Available This special issue has followed up the 2nd Olympus International Conference on Supply Chains held on October 5-6, 2012, in Katerini, Greece. The Conference was organized by the Department of Logistics of Alexander Technological Educational Institution (ATEI of Thessaloniki, in collaboration with the Laboratory of Quantitative Analysis, Logistics and Supply Chain Management of the Department of Mechanical Engineering, Aristotle University of Thessaloniki (AUTH. During the 2-Days Conference more than 50 research papers were presented covering the following thematic areas: (i Business Logistics, (ii Transportation, Telematics and Distribution Networks, (iii Green Logistics, (iv Information and Communication Technologies in Supply Chain Management, and (v Services and Quality. Three keynote invited speakers addressed interesting issues for the Humanitarian Logistics, Green Supply Chains of the Agrifood Sector and the Opportunities and Prospects of Greek Ports chaired Round Tables with other Greek and Foreign Scientists and Specialists.

  3. Environmental Retail Supply Chains

    DEFF Research Database (Denmark)

    Kotzab, Herbert; Munch, Hilde; de Faultrier, Birgitte;

    2011-01-01

    Purpose – The purpose of this paper is to develop a scale that evaluates the environmental elements in retail supply chains and to examine the environmental supply chain management initiatives of the world's largest 100 retailing companies. Design/methodology/approach – The empirical evaluation has...... which were grouped into eight categories; they refer to “fundamental environmental attitude”, “use of energy”, “use of input material”, “product”, “packaging”, “transport”, “consumption” and “waste”. The level of environmental supply chain management can be characterised as very operational and very...... short-term oriented (green operations). Long-term oriented green design initiatives were hardly observed. Furthermore, the specific environmental activities of three retailers from Denmark, France and the UK were compared. Research limitations/implications – The empirical study investigates supply chain...

  4. RECONSTRUCTION OF AR DEPTH PROFILES FROM PIXE MEASUREMENTS

    NARCIS (Netherlands)

    OSIPOWICZ, T; LIEW, SC; LOH, KK; ORLIC, [No Value; TANG, SM; WEBER, T

    1994-01-01

    We report on the application of an iterative maximum likelihood algorithm [1] to the reconstruction of depth profiles from PIXE measurements. PIXE spectra of 450 and 800 keV Ar implanted Al samples were taken at 1.5 and 1.3 MeV He+ energy and at angles ranging from 18 to 83-degrees. The measured Ar

  5. Experimental introduction of excess Ar40 into a granitic melt

    Science.gov (United States)

    Fyfe, W.S.; Lanphere, M.A.; Dalrymple, G.B.

    1969-01-01

    Samples of a Precambrian granite were melted in sealed capsules to produce a radiogenic Ar40 atmosphere over the melt. The amount of Ar40 incorporated in the quenched charge was then determined. Under these experimental conditions the amount of argon dissolved in the quenched melt was appreciable and could be an important source of error in potassiumargon dating. ?? 1969 Springer-Verlag.

  6. Aspects of What Makes or Breaks a Museum AR Experience

    DEFF Research Database (Denmark)

    Madsen, Claus B.; Madsen, Jacob Boesen; Morrison, Ann

    2012-01-01

    The paper critically evaluates central aspects of an iPad AR application developed for a museum context. The application is designed for children aged 8 to 12 and mixes AR and mini-game elements to convey dramatized historical events. The game has been deployed for roughly 3 months and the findin...

  7. In Vitro Activity of AR-709 against Streptococcus pneumoniae▿

    OpenAIRE

    Jansen, W.T.M.; Verel, A.; Verhoef, J.; Milatovic, D.

    2008-01-01

    We investigated the in vitro activity of AR-709, a novel diaminopyrimidine antibiotic currently in development for treatment of community-acquired upper and lower respiratory tract infections, against 151 Streptococcus pneumoniae strains from various European countries. AR-709 showed excellent activity against both drug-susceptible and multidrug-resistant pneumococci.

  8. Supply Chain Collaboration

    OpenAIRE

    Guy Rodrigue Ghomsi 1982

    2015-01-01

    Companies are now progressively looking beyond themselves to come up with ways to improve revenue and profit margins. This has resulted in a heightened focus on the efficiency of the supply chains. Inefficient supply chains are being perceived as cavities that can deprive the firm from its cash flows when inventory is not required and sales revenue when product is not available at the point of sales. This has stimulated development of business models that intend to leverage and enhance the su...

  9. Variance bounding Markov chains

    OpenAIRE

    Roberts, Gareth O.; Jeffrey S. Rosenthal

    2008-01-01

    We introduce a new property of Markov chains, called variance bounding. We prove that, for reversible chains at least, variance bounding is weaker than, but closely related to, geometric ergodicity. Furthermore, variance bounding is equivalent to the existence of usual central limit theorems for all L2 functionals. Also, variance bounding (unlike geometric ergodicity) is preserved under the Peskun order. We close with some applications to Metropolis–Hastings algorithms.

  10. Supply chain risk management

    OpenAIRE

    Christian Hollstein; Frank Himpel

    2013-01-01

    Background: Supply chain risk management increasingly gains prominence in many international industries. In order to strengthen supply chain structures, processes, and networks, adequate potentials for risk management need to be built (focus on effective logistics) and to be utilized (focus on efficient logistics). Natural-based disasters, such as the case of Fukushima, illustrate how crucial risk management is. Method: By aligning a theoretical-conceptual framework with empirical-induct...

  11. Editorial: Supply Chain Management

    OpenAIRE

    Aidonis, D.; Folinas, D.; Triantafillou, D.

    2012-01-01

    This special issue has followed up the 2nd Olympus International Conference on Supply Chains held on October 5-6, 2012, in Katerini, Greece. The Conference was organized by the Department of Logistics of Alexander Technological Educational Institution (ATEI) of Thessaloniki, in collaboration with the Laboratory of Quantitative Analysis, Logistics and Supply Chain Management of the Department of Mechanical Engineering, Aristotle University of Thessaloniki (AUTH). During the 2-Days Conference m...

  12. 40Ar/39Ar geochronology of the El Teniente porphyry copper deposit

    International Nuclear Information System (INIS)

    breccias. Phyllic alteration primarily occurs as quartz-sericite haloes of quartz-sulfide-sulfate veinlets within the perimeter of the orebody, and slightly overprints potassic alteration. Propylitic alteration occurs largely peripheral to ore-grade rock. The relatively restricted development of phyllic alteration and the occurrence of the central breccia conflict with the classic porphyry copper model of Lowell and Gilbert (1970), but El Teniente may be regarded as a 'variation on a theme' of the classic model, as suggested by Gustafson and Hunt (1975). The exceedingly large size of the El Teniente deposit, coupled with its apparently young mineralization age prompted us to initiate a systematic 40Ar/39Ar study whose goals are to determine the age(s) of the hydrothermal event(s) that produced such a remarkable copper concentration and ultimately to estimate the duration of the hydrothermal activity at El Teniente. This is particularly relevant to an understanding of the processes that formed super-giant high-grade copper deposits in the Chilean Andes and elsewhere. We report here 32 total fusion 40Ar/39Ar ages from sericite and biotite from different lithologic units of El Teniente and five step-heating 40Ar-39Ar ages of samples previously dated using conventional K-Ar methods (Cuadra, 1986) (au)

  13. Intracellular Cadmium Isotope Fractionation

    Science.gov (United States)

    Horner, T. J.; Lee, R. B.; Henderson, G. M.; Rickaby, R. E.

    2011-12-01

    Recent stable isotope studies into the biological utilization of transition metals (e.g. Cu, Fe, Zn, Cd) suggest several stepwise cellular processes can fractionate isotopes in both culture and nature. However, the determination of fractionation factors is often unsatisfactory, as significant variability can exist - even between different organisms with the same cellular functions. Thus, it has not been possible to adequately understand the source and mechanisms of metal isotopic fractionation. In order to address this problem, we investigated the biological fractionation of Cd isotopes within genetically-modified bacteria (E. coli). There is currently only one known biological use or requirement of Cd, a Cd/Zn carbonic anhydrase (CdCA, from the marine diatom T. weissfloggii), which we introduce into the E. coli genome. We have also developed a cleaning procedure that allows for the treating of bacteria so as to study the isotopic composition of different cellular components. We find that whole cells always exhibit a preference for uptake of the lighter isotopes of Cd. Notably, whole cells appear to have a similar Cd isotopic composition regardless of the expression of CdCA within the E. coli. However, isotopic fractionation can occur within the genetically modified E. coli during Cd use, such that Cd bound in CdCA can display a distinct isotopic composition compared to the cell as a whole. Thus, the externally observed fractionation is independent of the internal uses of Cd, with the largest Cd isotope fractionation occurring during cross-membrane transport. A general implication of these experiments is that trace metal isotopic fractionation most likely reflects metal transport into biological cells (either actively or passively), rather than relating to expression of specific physiological function and genetic expression of different metalloenzymes.

  14. Mass independent isotope separations

    International Nuclear Information System (INIS)

    Mass independent separations between isotopes of an element were first observed by Clayton on 17 O and 18 O from the Allende meteorite and attributed then to nucleosynthesis. Anomalous ratios of isotope abundance known at that time were due to nuclear processes. Later, atmospheric ozone and stratospheric CO2 were shown to exhibit mass independent isotope composition of oxygen. Several formation mechanisms of these 'anomalous' molecules have been proposed, none being completely satisfactory. In the laboratory, these mass independent chemical separation effects were eventually reproduced. Anomalous separations were also obtained between isotopes of uranium, and even of light elements such as magnesium. These were first connected with irregularities in atomic nucleus volumes. Such effects are not recorded on natural terrestrial samples. Two main reasons prevent such observations from having been made. Firstly, laboratories investigating isotope compositions of elements, publish almost exclusively deltas of one isotope only. But, to look for possible anomalies, one needs to compare each isotope abundance in a sample similar to that in the standard used as origin of deltas. An example of such calculation will be given. Secondly, deltas of isotopes published by different laboratories are usually not comparable to better than a few per mil. The reason is that, to calculate deltas, most laboratories use working standards whose absolute values may not be exactly established as they are not crucial to their work. Several per mil differences will be shown to be implied between the 'absolute' isotope abundance of 13 C of standards, reputedly the same, used by different laboratories. Laboratories making surveys of natural samples should be encouraged, e.g. by IUPAC, to cover every isotope of multiple isotope elements, and to make, at not infrequent intervals, a close comparison of their working standards with internationally distributed ones. (author)

  15. Discovery of the Mercury Isotopes

    CERN Document Server

    Meierfrankenfeld, D

    2009-01-01

    Forty mercury isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  16. Discovery of the Einsteinium Isotopes

    OpenAIRE

    Bury, A.; Fritsch, A; Ginepro, J. Q.; Heim, M; Schuh, A.; Shore, A.; Thoennessen, M.

    2009-01-01

    Seventeen einsteinium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  17. Discovery of the Titanium Isotopes

    OpenAIRE

    Meierfrankenfeld, D.; Thoennessen, M.

    2009-01-01

    Twentyfive titanium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  18. Discovery of the Scandium Isotopes

    CERN Document Server

    Meierfrankenfeld, D

    2010-01-01

    Twenty-three scandium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  19. Discovery of the Tungsten Isotopes

    OpenAIRE

    A. Fritsch; Ginepro, J. Q.; Heim, M.; Schuh, A.; SHORE, A.; Thoennessen, M

    2009-01-01

    Thirty-five tungsten isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  20. Discovery of the Vanadium Isotopes

    OpenAIRE

    SHORE, A.; A. Fritsch; Heim, M.; Schuh, A.; Thoennessen, M

    2009-01-01

    Twenty-four vanadium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  1. Discovery of the Arsenic Isotopes

    OpenAIRE

    SHORE, A.; A. Fritsch; Heim, M.; Schuh, A.; Thoennessen, M

    2009-01-01

    Twenty-nine arsenic isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  2. Discovery of the Barium Isotopes

    OpenAIRE

    SHORE, A.; A. Fritsch; Ginepro, J. Q.; Heim, M.; Schuh, A.; Thoennessen, M

    2009-01-01

    Thirty-eight barium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the Silver Isotopes

    OpenAIRE

    Schuh, A.; A. Fritsch; Ginepro, J. Q.; Heim, M.; SHORE, A.; Thoennessen, M

    2009-01-01

    Thirty-eight silver isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the Cadmium Isotopes

    OpenAIRE

    Amos, S.; Thoennessen, M

    2009-01-01

    Thirty-seven cadmium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Discovery of the Krypton Isotopes

    OpenAIRE

    Heim, M.; A. Fritsch; Schuh, A.; SHORE, A.; Thoennessen, M

    2009-01-01

    Thirty-two krypton isotopes have been observed so far; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. Discovery of the Iron Isotopes

    OpenAIRE

    Schuh, A.; A. Fritsch; Heim, M.; SHORE, A.; Thoennessen, M

    2009-01-01

    Twenty-eight iron isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  7. Discovery of the Gold Isotopes

    OpenAIRE

    Schuh, A.; A. Fritsch; Ginepro, J. Q.; Heim, M.; SHORE, A.; Thoennessen, M

    2009-01-01

    Thirty-six gold isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  8. Discovery of the Cobalt Isotopes

    OpenAIRE

    Szymanski, T; Thoennessen, M

    2009-01-01

    Twenty-six cobalt isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  9. Touch interface for markless AR based on Kinect

    Science.gov (United States)

    Hsieh, Ching-Tang; Kuo, Tai-Ku; Wang, Hui-Chun; Wu, Yeh-Kuang; Chang, Liung-Chun

    2014-01-01

    We develop an augmented reality (AR) environment with hidden-marker via touch interface using Kinect device, and then also set up a touch painting game with the AR environment. This environment is similar to that of the touch screen interface which allows user to paint picture on a tabletop with his fingers, and it is designed with depth image information from Kinect device setting up above a tabletop. We incorporate support vector machine (SVM) to classify painted pictures which correspond to the inner data and call out its AR into the tabletop in color images information from Kinect device. Because users can utilize this similar touch interface to control AR, we achieve a marker-less AR and interactive environment.

  10. Synthesis, structural characterization, and spectroscopy of the cadmium-cadmium bonded molecular species Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2).

    Science.gov (United States)

    Zhu, Zhongliang; Fischer, Roland C; Fettinger, James C; Rivard, Eric; Brynda, Marcin; Power, Philip P

    2006-11-29

    The synthesis and first structural characterization of a cadmium-cadmium bonded molecular compound Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2) are reported. The existence of the Cd-Cd bond was established by 113Cd NMR spectroscopy and X-ray diffraction (Cd-Cd = 2.6257(5) A). Like its group 12 analogue Ar'ZnZnAr', DFT calculations showed that Ar'CdCdAr' had significant p-character in the Cd-Cd sigma-bonding HOMO. PMID:17117840

  11. LEAF: a computer program to calculate fission product release from a reactor containment building for arbitrary radioactive decay chains

    Energy Technology Data Exchange (ETDEWEB)

    Lee, C.E.; Apperson, C.E. Jr.; Foley, J.E.

    1976-10-01

    The report describes an analytic containment building model that is used for calculating the leakage into the environment of each isotope of an arbitrary radioactive decay chain. The model accounts for the source, the buildup, the decay, the cleanup, and the leakage of isotopes that are gas-borne inside the containment building.

  12. LEAF: a computer program to calculate fission product release from a reactor containment building for arbitrary radioactive decay chains

    International Nuclear Information System (INIS)

    The report describes an analytic containment building model that is used for calculating the leakage into the environment of each isotope of an arbitrary radioactive decay chain. The model accounts for the source, the buildup, the decay, the cleanup, and the leakage of isotopes that are gas-borne inside the containment building

  13. Issues on Supply Chain Management

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Although supply chain is regarded as an integrated pr ocess, actually, researchers and practitioners have primarily investigated the v arious processes of the supply chain individually. The competitive field in most markets requires well-designed integrated supply chain instead of individual o perations. In this paper, some traditional thinking of supply chain is given fir st, then SCM (Supply Chain Management) is introduced, which views the entire sup ply chain as a whole rather than individual process a...

  14. Proton resonance spectroscopy in 36Ar

    International Nuclear Information System (INIS)

    Excitation functions for proton elastic scattering and for proton-induced reactions on 35Cl were measured with the KN Van de Graaff accelerator and associated high resolution system at TUNL. Differential cross sections for 35Cl(p,p0), (p,p1), (p,p2), (p, α0), and (p, α1) were measured in the range Ep = 0.6 to 4.0 MeV. The data were measured at five angles with an overall resolution of about 350 eV. The measured excitation functions were analyzed with a multi-level, multi-channel R-matrix formalism for approximately 200 levels. Resonance parameters were extracted. The resonance parameters included resonance energy, total angular momentum, parity, partial elastic and reaction widths, channel spin or orbital angular momentum mixing ratios, and for some resonances the relative signs of width amplitudes. A number of resonances have strong level-level interference effects. Comparison of these data with the Porter-Thomas distribution resulted in good agreement of almost all channels which had a statistically significant number of resonances. These comparisons indicate that nearly all the proton and alpha strength in 36Ar for this energy range was seen in the present study. The s-wave proton strength function ratio for s = 1 and s = 2 resonances was found to be consistent with previous measurements for 4N nuclei

  15. Stable isotopes labelled compounds

    International Nuclear Information System (INIS)

    The catalogue on stable isotopes labelled compounds offers deuterium, nitrogen-15, and multiply labelled compounds. It includes: (1) conditions of sale and delivery, (2) the application of stable isotopes, (3) technical information, (4) product specifications, and (5) the complete delivery programme

  16. (Carbon isotope fractionation inplants)

    Energy Technology Data Exchange (ETDEWEB)

    O' Leary, M.H.

    1990-01-01

    The objectives of this research are: To develop a theoretical and experimental framework for understanding isotope fractionations in plants; and to develop methods for using this isotope fractionation for understanding the dynamics of CO{sub 2} fixation in plants. Progress is described.

  17. Maximum abundant isotopes correlation

    International Nuclear Information System (INIS)

    The neutron excess of the most abundant isotopes of the element shows an overall linear dependence upon the neutron number for nuclei between neutron closed shells. This maximum abundant isotopes correlation supports the arguments for a common history of the elements during nucleosynthesis. (Auth.)

  18. Detecting isotopic ratio outliers

    International Nuclear Information System (INIS)

    An alternative method is proposed for improving isotopic ratio estimates. This method mathematically models pulse-count data and uses iterative reweighted Poisson regression to estimate model parameters to calculate the isotopic ratios. This computer-oriented approach provides theoretically better methods than conventional techniques to establish error limits and to identify outliers. 6 refs., 3 figs., 3 tabs

  19. Measuring isospin mixing in 36Ar using a polarized, neutral atom trap

    International Nuclear Information System (INIS)

    Magneto-optical traps provide a cold, compact cloud of radioactive atoms and therefore are an ideal source for use in precision nuclear β decay studies. Optical pumping techniques can add a new dimension to such experiments by efficiently polarizing these samples to ≤99%. TRIUMF's experiment E925 is utilizing these techniques to prepare to measure the isospin mixing between the first two Iπ=2+ excited states of 36Ar with the lowest 2+, T=1 isobaric analog state. The spin-polarized 36K β+ decay observables will be measured using TRIUMF's neutral atom trap at ISAC, TRIUMF's isotope separator and accelerator facility. The main purpose is to test isospin mixing models in the s,d-shell needed for determination of the superallowed Fermi strength in 0+ → 0+ decays

  20. Evaporation of the 36 Ar + 58 Ni system studied with the 4π INDRA detector

    International Nuclear Information System (INIS)

    With the capabilities of the INDRA 4π detector, vaporization of the 36Ar + 58Ni system has been detected permitting thus first studies. This phenomenon which corresponds to a total disintegration of the total nuclear system into neutrons and isotopes of H is expected for very high excitation energies induced in-nucleus collisions at intermediate energies. The onset of vaporization was determined, it is found at 52 MeV per nucleon, which corresponds to an available energy per nucleon into the system of 12.3 MeV. Temperature at which vaporization occurs is a crucial parameter to describe the phenomenon. Upper limits for temperature have been deduced within two frameworks (complete surface evaporation or calculation within the free gas limit) and lead to values in the range 7-10 MeV. (author). 43 refs

  1. Preliminary K/Ar geochronology of the Crater Basalt volcanic field (CBVF, northern Patagonia

    Directory of Open Access Journals (Sweden)

    Z. Pécskay

    2007-03-01

    Full Text Available The Crater Basalt volcanic field is one of the Quaternary intraplate basaltic fields in northern Patagonia. A systematic geological, volcanological and geochronological study of CBVF indicates a multistage history of eruptions of basaltic volcanoes. K/Ar dating, using whole rock samples shows that the measured analytical ages are fully consistent with the available stratigraphic control. The radiometric ages fall into three distinct, internally consistent age groups, which give evidence that there were at least three major episodes of volcanic activity, at about 1.0 Ma, 0.6 Ma and 0.3 Ma ago. The age differences appear to be just significant, even although less than 10 % radiogenic argon was found in the isotope analysis of whole rock samples.

  2. 40Ar/39Ar ages of adularia from the Golden Cross, Neavesville, and Komata epithermal deposits, Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar ages of adularia from three epithermal vein deposits in the Hauraki Goldfield constrain when these deposits formed. Adularia from veins at Neavesville has 40Ar/39Ar plateau and isochron ages of 6.89 ± 0.02 and 6.86 ± 0.02 Ma, respectively, similar to the 40Ar/39Ar plateau and isochron ages of adularia from veins at Golden Cross of 6.96 ± 0.04 and 6.93 ± 0.03 Ma, respectively. In contrast, Komata mineralisation formed at 5.99 ± 0.02 to 6.07 ± 0.03 Ma, based on the 40Ar/39Ar isochron and plateau ages of the adularia in these veins, similar to the previously reported 6.0 Ma age of mineralisation at Waihi/Favona. These preliminary data suggest that mineralisation in the Hauraki Goldfields occurred episodically. (author). 19 refs., 3 figs., 1 tab

  3. On Full Disclosure and Transparent Data Flow from 40Ar/39Ar Geochronology Measurements to Data Reduction to Online Repositories

    Science.gov (United States)

    Koppers, A. A. P.

    2015-12-01

    Arguably 40Ar/39Ar geochronology is one of the most versatile techniques available to Earth scientists today for the dating of rocks and minerals and determining the rates of geological processes on Earth and in our solar system. Over the last four decades large quantities of high (and lower) quality 40Ar/39Ar data have been produced using many different generations of mass spectrometry instrumentation. This wealth of data is only as useful as its description and availability of metadata allows. Many online data sets or compilations available in the science literature only carry the resulting product, an age and a related uncertainty in millions of years, for example. These data points are far from desirable as these don't allow recalculation against modern-day age standards, decay constants and other parameters essential in 40Ar/39Ar geochronology. Over time these data will become less useful to the research community and eventually these will be put by the wayside. In this presentation I will emphasize the need for full disclosure of all data and metadata involved in 40Ar/39Ar geochronology. I will give examples of how a complex data flow can be kept transparent from sample preparation to measurement to data reduction and eventually the uploading into online data repositories. Without the full disclosure of our data and a transparent data flow, it is evident that we cannot live up to one of the governing doctrines in the sciences, namely reproducibility of our scientific experiments and findings.

  4. Dicty_cDB: FC-AR11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR11 (Link to dictyBase) - - - Contig-U14938-1 FC-AR11E (Li...nk to Original site) - - - - - - FC-AR11E 918 Show FC-AR11 Library FC (Link to library) Clone ID FC-AR11 (Li... 8.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: endoplasmic reticulum >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR11Q.Seq.d/ Representative seq. ID FC-AR...11E (Link to Original site) Representative DNA sequence >FC-AR11 (FC-AR11Q) /CSM/FC/FC-AR/FC-AR11Q.Seq.

  5. Dicty_cDB: FC-AR19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR19 (Link to dictyBase) - - - Contig-U16521-1 FC-AR19Z (Li...nk to Original site) - - FC-AR19Z 565 - - - - Show FC-AR19 Library FC (Link to library) Clone ID FC-AR19 (Li... 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR19 is .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR19Q.Seq.d/ Representative seq. ID FC-AR...19Z (Link to Original site) Representative DNA sequence >FC-AR19 (FC-AR19Q) /CSM/FC/FC-AR/FC-AR19Q.Seq.

  6. Dicty_cDB: FC-AR15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR15 (Link to dictyBase) - - - Contig-U16022-1 FC-AR15E (Li...nk to Original site) - - - - - - FC-AR15E 390 Show FC-AR15 Library FC (Link to library) Clone ID FC-AR15 (Li..., including cell wall 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR15 is cyt 5' .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR15Q.Seq.d/ Representative seq. ID FC-AR...15E (Link to Original site) Representative DNA sequence >FC-AR15 (FC-AR15Q) /CSM/FC/FC-AR/FC-AR15Q.Seq.

  7. Dicty_cDB: FC-AR07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR07 (Link to dictyBase) - - - Contig-U16276-1 FC-AR07Z (Li...nk to Original site) - - FC-AR07Z 604 - - - - Show FC-AR07 Library FC (Link to library) Clone ID FC-AR07 (Li...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: cytoplasmic 36.0 %: nuclear 8.0 %: cytoskeletal 8.0 %: mitochondrial >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR07Q.Seq.d/ Representative seq. ID FC-AR...07Z (Link to Original site) Representative DNA sequence >FC-AR07 (FC-AR07Q) /CSM/FC/FC-AR/FC-AR07Q.Seq.

  8. Dicty_cDB: FC-AR24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR24 (Link to dictyBase) - G24050 DDB0191443 Contig-U16141-1 FC-AR...24E (Link to Original site) - - - - - - FC-AR24E 785 Show FC-AR24 Library FC (Link to library) Clone ID FC-AR...sicles of secretory system 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-AR...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR24Q.Se...q.d/ Representative seq. ID FC-AR24E (Link to Original site) Representative DNA sequence >FC-AR24 (FC-AR24Q) /CSM/FC/FC-AR/FC-AR

  9. Dicty_cDB: FC-AR13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR13 (Link to dictyBase) - - - Contig-U16456-1 FC-AR13Z (Li...nk to Original site) - - FC-AR13Z 550 - - - - Show FC-AR13 Library FC (Link to library) Clone ID FC-AR13 (Li... 8.0 %: mitochondrial 4.0 %: extracellular, including cell wall >> prediction for FC-AR13 is nuc 5' e.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR13Q.Seq.d/ Representative seq. ID FC-AR...13Z (Link to Original site) Representative DNA sequence >FC-AR13 (FC-AR13Q) /CSM/FC/FC-AR/FC-AR13Q.Seq.

  10. Principles of stable isotope distribution

    CERN Document Server

    Criss, Robert E

    1999-01-01

    1. Abundance and Measurement of Stable Isotopes 1.1. Discovery of Isotopes 1.2. Nuclide Types, Abundances, and Atomic Weights 1.3. Properties and Fractionation of Isotopic Molecules 1.4. Material Balance Relationships 1.5. Mass Spectrometers 1.6. Notation and Standards 1.7. Summary 1.8. Problems References 2. Isotopic Exchange and Equilibrium Fractionation 2.1. Isotopic Exchange Reactions 2.2. Basic Equations 2.3. Molecular Models 2.4. Theory of Isotopic Fractionation 2.5. Temperature Dependence of Isotopic Fractionation Factors 2.6. Rule of the Mean 2.7. Isotopic Thermometers

  11. ISOTOPIC MASS FRACTIONATION OF SOLAR WIND: EVIDENCE FROM FAST AND SLOW SOLAR WIND COLLECTED BY THE GENESIS MISSION

    International Nuclear Information System (INIS)

    NASA's Genesis space mission returned samples of solar wind collected over ∼2.3 years. We present elemental and isotopic compositions of He, Ne, and Ar analyzed in diamond-like carbon targets from the slow and fast solar wind collectors to investigate isotopic fractionation processes during solar wind formation. The solar wind provides information on the isotopic composition for most volatile elements for the solar atmosphere, the bulk Sun and hence, on the solar nebula from which it formed 4.6 Ga ago. Our data reveal a heavy isotope depletion in the slow solar wind compared to the fast wind composition by 63.1 ± 2.1 per mille for He, 4.2 ± 0.5 per mille amu–1 for Ne and 2.6 ± 0.5 per mille amu–1 for Ar. The three Ne isotopes suggest that isotopic fractionation processes between fast and slow solar wind are mass dependent. The He/H ratios of the collected slow and fast solar wind samples are 0.0344 and 0.0406, respectively. The inefficient Coulomb drag model reproduces the measured isotopic fractionation between fast and slow wind. Therefore, we apply this model to infer the photospheric isotopic composition of He, Ne, and Ar from our solar wind data. We also compare the isotopic composition of oxygen and nitrogen measured in the solar wind with values of early solar system condensates, probably representing solar nebula composition. We interpret the differences between these samples as being due to isotopic fractionation during solar wind formation. For both elements, the magnitude and sign of the observed differences are in good agreement with the values predicted by the inefficient Coulomb drag model.

  12. ISOTOPIC MASS FRACTIONATION OF SOLAR WIND: EVIDENCE FROM FAST AND SLOW SOLAR WIND COLLECTED BY THE GENESIS MISSION

    Energy Technology Data Exchange (ETDEWEB)

    Heber, Veronika S.; Baur, Heinrich; Wieler, Rainer [Institute for Geochemistry and Petrology, ETH Zurich, Clausiusstrasse 25, CH-8092 Zurich (Switzerland); Bochsler, Peter [Physikalisches Institut, Universitaet Bern, Sidlerstasse 5, CH-3012 Bern (Switzerland); McKeegan, Kevin D. [Department of Earth and Space Sciences, University of California Los Angeles, 595 Charles Young Drive East, Box 951567, Los Angeles, CA 90095-1567 (United States); Neugebauer, Marcia [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721-0092 (United States); Reisenfeld, Daniel B. [Department of Physics and Astronomy, University of Montana, Missoula, MT 59812 (United States); Wiens, Roger C., E-mail: heber@ess.ucla.edu [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2012-11-10

    NASA's Genesis space mission returned samples of solar wind collected over {approx}2.3 years. We present elemental and isotopic compositions of He, Ne, and Ar analyzed in diamond-like carbon targets from the slow and fast solar wind collectors to investigate isotopic fractionation processes during solar wind formation. The solar wind provides information on the isotopic composition for most volatile elements for the solar atmosphere, the bulk Sun and hence, on the solar nebula from which it formed 4.6 Ga ago. Our data reveal a heavy isotope depletion in the slow solar wind compared to the fast wind composition by 63.1 {+-} 2.1 per mille for He, 4.2 {+-} 0.5 per mille amu{sup -1} for Ne and 2.6 {+-} 0.5 per mille amu{sup -1} for Ar. The three Ne isotopes suggest that isotopic fractionation processes between fast and slow solar wind are mass dependent. The He/H ratios of the collected slow and fast solar wind samples are 0.0344 and 0.0406, respectively. The inefficient Coulomb drag model reproduces the measured isotopic fractionation between fast and slow wind. Therefore, we apply this model to infer the photospheric isotopic composition of He, Ne, and Ar from our solar wind data. We also compare the isotopic composition of oxygen and nitrogen measured in the solar wind with values of early solar system condensates, probably representing solar nebula composition. We interpret the differences between these samples as being due to isotopic fractionation during solar wind formation. For both elements, the magnitude and sign of the observed differences are in good agreement with the values predicted by the inefficient Coulomb drag model.

  13. Isotopes in Greenland Precipitation

    DEFF Research Database (Denmark)

    Faber, Anne-Katrine

    Greenland ice cores offer a unique opportunity to investigate the climate system behaviour. The objective of this PhD project is to investigate isotope modelling of present- day conditions and conduct model-data comparison using Greenland ice cores. Thus this thesis investigates how the integration...... of model and data can be used to improve the understanding of climate changes. This is done through analysis of isotope modelling, observations and ice core measurements. This dissertation comprises three projects: (1) Modelling the isotopic response to changes in Arctic sea surface conditions, (2......) Constructing a new Greenland database of observations and present-day ice core measurements, and (3) Performance test of isotope-enabled CAM5 for Greenland. The recent decades of rapid Arctic sea ice decline are used as a basis for an observational-based model experiment using the isotope-enabled CAM model 3...

  14. Intense 31–35Ar beams produced with a nanostructured CaO target at ISOLDE

    International Nuclear Information System (INIS)

    Highlights: • A nanometric mesoporous CaO powder was developed and studied in terms of sintering. • For the first time a nanostructured target material was operated at ISOLDE. • Unlike past CaO targets, stable yields over time of n-deficient argon were delivered. • Higher (exotic) Ar yields were obtained at lower temperatures and proton intensities. -- Abstract: At the ISOLDE facility at CERN, thick targets are bombarded with highly energetic pulsed protons to produce radioactive ion beams (RIBs). The isotopes produced in the bulk of the material have to diffuse out of the grain and effuse throughout the porosity of the material to a transfer line which is connected to an ionizer, from which the charged isotopes are extracted and delivered for physics experiments. Calcium oxide (CaO) powder targets have been used to produce mainly neutron deficient argon and carbon RIBs over the past decades. Such targets presented unstable yields, either decaying over time or low from the beginning of operation. These problems were suspected to come from the degradation of the target microstructure (sintering due to high temperature and/or high proton intensity). In this work, a CaO microstructural study in terms of sintering was conducted on a nanostructured CaO powder synthesized from the respective carbonate. Taking the results of this study, several changes were made at ISOLDE in terms of the CaO target production, handling and operation in order to produce and maintain the nanostructured CaO. The new target, the first nanostructured target to be operated at ISOLDE, showed improved yields of (exotic) Ar and more importantly a stable yield over the whole operation time, while operating with lower temperatures. This contradicts the ISOL paradigm of using the highest possible temperature regardless of the target’s microstructure degradation

  15. New 40Ar/39Ar dates of adularia from epithermal deposits in the Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar dates of vein and wall rock adularia from seven epithermal deposits and one porphyry copper prospect help constrain the ages of mineralisation in the Hauraki Goldfield. Vein adularia from the Paritu region yielded a single 40Ar/39Ar plateau date of 16.315 ± 0.066 Ma. Five 40Ar/39Ar plateau dates of three samples of vein adularia from the Opitonui deposit overlap within error to yield a preferred age of 13.149 ± 0.016 Ma. Two samples of vein adularia from the Night Reef at the Broken Hills deposit yield exceptionally flat 40Ar/39Ar plateaus, and all date overlap within error to provide an age of 7.121 ± 0.010 Ma. Two 40Ar/39Ar plateau dates of one sample of vein adularia from the Wharekirauponga deposit overlap within error to provide an age of 6.318 ± 0.061 Ma. Four 40Ar/39Ar plateau dates of three samples of vein adularia from the Maratoto deposit overlap within error to provide an age of 6.411 ± 0.022 Ma. Two samples of adularia from altered wall rock at the Sovereign deposit yield three 40Ar/39Ar plateau dates that range from 6.547 ± 0.021 Ma to 6.806 ± 0.028 Ma. This suggest that mineralisation formed around 6.6 Ma, but the results are complicated because the adularia contains minor illite that post-dates adularia formation. Results from the Karangahake deposit are complex. Two samples of vein adularia yield three 40Ar/39Ar plateau dates that range from 6.116 ± 0.116 Ma to 6.901 ± 0.101 Ma, wheras one sample of wall rock adularia that contains minor late illite yields two 40Ar/39Ar plateau dates that overlap within error to provide a date of 5.734 ± 0.041. The range of dates indicates that more work is necessary to understand the history of mineralisation at this deposit. Two samples of vein adularia from the Tui deposit yield four 40Ar/39Ar plateau dates that overlap within error to provide an age of 5.714 ± 0.017 Ma. These results confirm previous work that indicates that the ages of epithermal deposit young southward in the Hauraki

  16. Recombination measurements at low energies with Ar16+ and Ar18+ ions in a dense, cold electron target

    International Nuclear Information System (INIS)

    Recombination of multiply charged ions with electrons at very low relative energies has become a major topic of interest, due to the observation of rates which are enhanced beyond the expectations for radiative recombination. We present results for Ar16+ and Ar18+ ions from systematic measurements along the argon isonuclear sequence using a high density cold electron beam target (ne = 7 x 109 cm-3) at the UNILAC of GSI. The transverse and longitudinal temperatures of the electron beam were determined from DR resonance features observed with metastable Ar16+ (23S) ions. The rate at Erel = 0 for radiative recombination of completely stripped Ar18+ calculated with electron beam temperatures kTparallel = 0.002 eV, kTperpendicular = 0.2 eV amounts to α = 10-9 cm3 s-1. This is exceeded by nearly a factor of 10 by the rate measured in experiments with Ar18+ ions

  17. Evaluation of the IPCC Models (AR4 and AR5 in the Precipitation Simulation in the Northeast of Brazil

    Directory of Open Access Journals (Sweden)

    José Brabo Alves

    2016-04-01

    Full Text Available With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC, comparative studies are necessary between observations and the so-called historical run (C20 and future projections of the AR4 (A2 and AR5 (RCP8.5 experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5 in representing the anuall average and seasonal rainfall variation (summer and autumn in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  18. Evaluation of the IPCC Models (AR4 and AR5) in the Precipitation Simulation in the Northeast of Brazil

    Science.gov (United States)

    Alves, José; Vasconcelos Junior, Francisco; Chaves, Rosane; Silva, Emerson; Servain, Jacques; Costa, Alexandre; Sombra, Sérgio; Barbosa, Augusto; Dos Santos, Antonio

    2016-04-01

    With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC), comparative studies are necessary between observations and the so-called historical run (C20) and future projections of the AR4 (A2) and AR5 (RCP8.5) experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5) in representing the anuall average and seasonal rainfall variation (summer and autumn) in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation) data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  19. New K-Ar ages of altered rocks from Paramillos Sur and Norte: Interpretation of the results

    International Nuclear Information System (INIS)

    The whole-rock K-Ar dates from porphyry copper prospects of Paramillos Sur (phyllic and potasic alteration zones) and Paramillos Norte (propilitic zone) are reported. Radiometric data yielded 17,8 ± 0,9 Ma, 15,8 ± 1,0 Ma and 15,2 ± 0,5 Ma in Paramillos Sur, and 17,3 ± 0,7 Ma in Paramillos Norte, which can be added to an previously reported age of 16,4 ± 0,3 Ma. These data are in agreement with isotopic ages from non altered or non mineralized magmatic rocks of the region. When the isotopic ages and petrographic characteristics of the dated rocks are considered, two alteration-mineralization events are suggested for Paramillos Sur prospect. However this possibility needs to be confirmed by means of future studies, in view of the reduced interval between these events when compared with the analytical errors. (author)

  20. Emplacement age for the mafic-ultramafic plutons in the northern Dabie Mts. (Hubei): Zircon U-Pb, Sm-Nd and 40Ar/39Ar dating

    Institute of Scientific and Technical Information of China (English)

    WANG; Jianghai

    2002-01-01

    , China, Sci. in China, Ser. D, 2000, 43(2): 225-236.[11]Hacker, B. R., Wang, Q. C., Ar/Ar geochronology of ultrahigh-pressure metamorphism in Central China, Tectonics, 1995, 14: 994-1006.[12]Ge, N. J., Hou, Z. H., Li, H. M. et al., Zircon U-Pb ages of the Shacun gabbro body, Yuexi, Dabie orogen and its geological implications, Chinese Sci. Bull., 2000, 45(1): 74-79.[13]Xu, S. T., Liu, Y. C., Jiang, L. L. et al., Tectonic Regime and Evolution of the Dabie Mountains, Beijing: Science Press, 1994, 1-175.[14]Li, S. G., Ni, Y. H., Zheng, S. G. et al., Interaction between subducted continental crust and the mantle: I. Major and trace element geochemistry of syncollisional mafic-ultramafic intrusions in the Dabie Mountains, Sci. in China, Ser. D, 1998, 41(5): 545-553.[15]Blundy, J. D., Holland, T. J. B., Calcic amphibole equilibrium and a new amphibole plagioclase geothermometer, Contrib. Mineral. Petrol. 1990, 104: 208-224.[16]Hammartron, J. M., Zen, E. A., Aluminum in hornbole: an empirical igneous geobarometer, Amer. Mineral., 1986, 71: 1297-1313.[17]Hollister, L. S., Grisson, G. C., Peters, E. K. et al., Confirmation of the empirical correlation of Al in hornblende with pressure of solidification of calcalkaline plutons, Amer. Mineral., 1987, 72: 231-239.[18]Johnson, M. C., Rutherford, M. J., Experimental calibration of an aluminium-hornblende geobarometer applicable to calc-alkaline rocks, EOS, 1988, 69: 1511.[19]Whitney, J. A., Stormer, J. C., The distribution of NaAlSi3O8 between coexisting microcline and plagioclase and its effect on geothermometric calculations, Am. Mineral., 1977, 62: 687-691.[20]Zhang, R. Y., Cong, B. L., Mineral Thermometers and Barometers, Beijing: Geological Publishing House, 1983, 150-173.[21]Krogh, T. E., A low-contamination method for hydrothermal decomposition of zircon and extraction of U and Pb for isotopic age determinations, Geochim. Cosmochim. Acta, 1973, 48: 505-511.[22]Krogh, T. E., Vapour

  1. Ar-Ar investigations on Quarternary volcanic sequences of Monte Vulture (Southern Italy)

    Science.gov (United States)

    Buettner, A.; Principe, C.; Villa, I. M.

    2003-04-01

    Volcanic sanidines and phlogopites from feldspathoid- or sanidine-bearing volcanic sequences of Monte Vulture (Southern Italy) were analysed using Ar-Ar stepwise heating. In all samples phlogopite and sanidine are internally inhomogeneous as observed in a plot of Cl/K ratio vs step-age. At least two phases that are degassed during different temperature steps can be distinguished, resulting in internal discordance. Hence, all samples are affected by impurities and have to be treated as heterochemical mixtures. These effects are strongest in phlogopite. The high uncertainty of the calculated ages mirrors the statistically significant age discordance. The calculation of average ages was focused on isochemical steps. Isochron calculations necessarily give less precise ages because of the excessive scatter of datapoints. Moreover, most coarse grained phlogopites could contain excess 40Ar (as suggested by non-atmospheric intercepts in isochron plots) which could be of mantle origin. The analysed phlogopites from carbonatitic and melilite-foiditolite rocks of the upper stratigraphical sequence of Monte Vulture are Mg-rich, which indicates a mantle provenance (Stoppa and Woolley, 1997). All calculated phlogopite ages have, therefore, to be considered with caution. One sample, PG5, contains both sanidine and matrix phlogopite. This offers the possibility to directly compare the analytical results and further decipher possible inconsistencies. Ages were calculated as the average of isochemical steps, and errors are indicated at the 95% confidence level. Sanidine gives a weighted average age of 752±13 ka in agreement with the phlogopite age of 801±88 ka. In comparison to these average step ages, an isochron over five sanidine-steps yields an age of 737±35 ka (MSWD=1.5) and an atmospheric intercept of 295±49. The eruptive time-span covered by the analysed samples is 75±20 ka, confirming that the eruption history of Monte Vulture has been organised in clusters of activity

  2. Toward a high-resolution 40Ar/39Ar geochronology of the Tatun Volcano Group, Taiwan

    Science.gov (United States)

    Mesko, G. T.; Song, S.; Chang, S.; Hemming, S. R.; Turrin, B. D.

    2010-12-01

    The Tatun Volcano Group [TVG] consists of five volcanic subgroups of which ~30 edifices have been identified, all in close proximity to the densely populated Taipei Basin to its south (Song et al., 2000, Journal of the Geological Society of China, in Chinese). Evidence of eruptions is in the form of mostly lava flows, with pyroclastic flows, and ash deposition (Tsai et al., 2010, TAO), consistent with vulcanian and plinian eruptions that are only minimally preserved because of the region’s high weathering rate (Belousov et al., 2010, Journal of Volcanology and Geothermal Research). The TVG is made up of calc-alkaline andesite, with few interspersed basaltic lava flows that bear geochemical signatures consistent with subduction volcanism, yet due to tectonic location Teng (1996, Geology) describes it as Ryukyu back-arc basin volcanism, and still others attribute volcanism here to post-collisional collapse of the Taiwan orogen (Wang et al., 1999, Tectonophysics and 2004, Journal of Petrology). Various TVG samples were previously K-Ar dated by Juang and Chen (1989, Bulletin of Central Geological Survey, in Chinese), Tsao (1994, Bulletin of Central Geological Survey, in Chinese), and 40Ar/39Ar whole rock analyses by Lee (1996, masters thesis, National Taiwan University) to suggest volcanism from 2.8-2.5Ma and then from 1.5-.22Ma after which volcanic events ceased. In contrast, radiocarbon dates obtained from charcoal in related sediment by Chen et al. (2010, TAO) and Belousov et al. (2010, Journal of Volcanology Geothermal Research) suggest volcanic activity was present at 20ka and 6ka respectively. The andesite samples are microcrystalline; therefore hand picked aliquots of groundmass from the hand magnetic fraction were subjected to several iterations of sonic rinse in glycine-based soap, then 4N HNO3, then quartz-distilled water in a preparation modified from Nicolaysen et al. (2000, EPSL). Samples were co-irradiated at the USGS facility in Denver using Alder

  3. Development of a Laser Probe for Argon Isotope Studies.

    Science.gov (United States)

    McConville, Paul

    Available from UMI in association with The British Library. The first objective of this study was to develop a laser outgassing facility for argon isotope studies. Apart from the laser and construction of the laser sample port, existing vacuum and mass spectrometer systems were used. Laser performance and optimum operating conditions were investigated. The second objective was test and evaluate the laser extraction technique by studies of simple geological samples. Previous laser ^{40} Ar-^{39}Ar dating studies by other workers had not systematically established the basis or characteristics of the method. Results from laser and complementary stepped heating studies of the ^{40}Ar-^ {39}Ar dating standard hornblende, hb3gr; a phlogopite sample from the Palabora (Phalaborwa) Complex; and biotites in a thin section of the Hamlet Bjerg granite from East Greenland, verified that: (1) Laser extraction reproduced within experimental error the stepped heating ^{40}Ar-^ {39}Ar and K-Ar ages of simple samples. (2) The precision of the technique i.e. the amount of sample required to give reliable ages, was limited in the present experiments largely by the level of the blanks and backgrounds to 10-100 ug samples. (3) Sample outgassing appeared to be limited to the order of 10 um outside the physical size of the laser pit, consistent with other estimates of the spatial definition in the literature. This could be understood by thermal diffusion and the length of the laser pulse. (4) The efficiency of the laser pulse in melting and outgassing mineral samples was shown to be dependent on silicate latent heats and mineral absorption at the laser wavelength. In addition, the ^{40} Ar-^{39}Ar age of the geologically significant Palabora Complex was determined as (2053 +/- 5) Ma. Excess argon led to a discrepancy between the laser and stepped heating ages of biotite and muscovite, (405 +/- 5) Ma, and laser ages of feldspars (510 +/- 20) Ma in the Hamlet Bjerg granite. This illustrated

  4. Ar Ar dating of authigenic K-feldspar: Quantitative modelling of radiogenic argon-loss through subgrain boundary networks

    Science.gov (United States)

    Mark, D. F.; Kelley, S. P.; Lee, M. R.; Parnell, J.; Sherlock, S. C.; Brown, D. J.

    2008-06-01

    We have analysed two distinct generations of authigenic K-feldspar in Fucoid Bed sandstones from An-t-Sron and Skiag Bridge, NW Highlands, Scotland, which have experienced post-growth heating to levels in excess of the predicted Ar-closure temperature. Authigenic K-feldspars show microtextural similarities to patch perthites; that is subgrains separated by dislocation-rich boundary networks that potentially act as fast diffusion pathways for radiogenic argon. The two generations of authigenic K-feldspar in the Fucoid Bed sandstones can be distinguished by different microtextural zones, bulk mineral compositions, fluid-inclusion populations, and inferred temperatures and chemistries of parent fluids. Ar-Ar age data obtained using high-resolution ultraviolet laser ablation, show that the first cementing generation is Ordovician and the second cementing generation is Silurian. Modelling of Ar diffusion using subgrain size as the effective diffusion dimension and a simplified tectono-thermal thrust model assuming transient heating of the Fucoid Beds is inconsistent with observed data. Removal of heat from the thrust zone through rapid flushing of heated fluids rather than transient heating can be invoked to explain the observed Ar-Ar ages for both generations of cement. Alternatively, Ar-diffusion modelling using overgrowth thickness as the effective diffusion dimension instead of subgrain size also yields models that are consistent with both the Fucoid Bed palaeothermal maxima and determined Ar-Ar age ages for the two generations of K-feldspar cement. Based on this alternate explanation, we propose a theoretical microtextural model that highlights fundamental differences between the microtextures of deuterically formed patch perthites and authigenic K-feldspars, explaining the apparent robustness of authigenic K-feldspar with respect to Ar-retention.

  5. Surface modification and biocompatible improvement of polystyrene film by Ar, O2 and Ar + O2 plasma

    International Nuclear Information System (INIS)

    Highlights: ► NVP is successfully grafted onto the different discharge gases (Ar, O2, and Ar + O2) plasma-treated PS film surface by Ar plasma induced graft polymerization. ► Compare with Ar and O2 plasma, the Ar + O2 plasma-treated film surface introduced large amounts of NVP, as known from ATR-FTIR and XPS results. ► According to SEM, the surface roughness increased at different levels after plasma treatment. Contact angle reveal that the hydrophilicity of the PS film surface was greatly improved. ► Cellular compatibility tests indicate that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. - Abstract: This paper reports the surface modification of different discharge gases (Ar, O2, and Ar + O2) plasma-treated polystyrene (PS) film by Ar plasma induced graft polymerization, with biocompatible monomer N-vinyl-2-pyrrolidone (NVP) is carried out to improve biocompatibility. The films are characterized by attenuated total reflectance Fourier transfer infrared (ATR-FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS) and scanning electron microscopy (SEM). Water contact angle measurement demonstrates the modified films possess a relatively hydrophilic surface. Furthermore, the films are also examined cell attachment and proliferation in vitro using mouse fibroblasts (L929 cells). The modified film surface shows a better cell distribution and growth than that of the pristine PS surface. From cell culture experiments, it is also observed that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. This method will provide a potential and effective solution for grafting useful component in future tissue-engineering applications.

  6. High-precision 40Ar/39Ar age for the Jehol Biota

    Science.gov (United States)

    Chang, S.; Zhang, H.; Renne, P. R.; Fang, Y.

    2008-12-01

    Abundant fossils of the terrestrial Jehol Biota, including plants, insects, dinosaurs, birds, mammals and freshwater invertebrates, were discovered from the Yixian Formation and the overlying Jiufotang Formation in Inner Mongolia, Hebei Province and Liaoning Province, northeastern China. Because of the exceptional preservation of fossils, the Jehol Biota is one of the most important Mesozoic fossil outcrops and referred to as a "Mesozoic Pompeii". The Jehol Biota has provided a rare opportunity to address questions about the origin of birds, the evolution of feathers and flight, the early diversification of angiosperms and the timing of the radiation of placental mammals. The Tuchengzi Formation, which lies unconformably just below the Yixian Formation and consists mainly of variegated sandstones, is less fossiliferous than the two overlying formations. However, dinosaur tracks, silicified wood and compressed plants are found in this formation. A systematic 40Ar/39Ar dating of the Yixian and the Jiufotang formations was undertaken to provide a framework for understanding the timing and duration of the Jehol Biota and evolutionary events represented within it. Furthermore, determining the absolute age of the Tuchengzi Formation provides information to interpret abundant dinosaur tracks within and provide better age constrains for the beginning of the Jehol Biota. Here we present robust high-precision 40Ar/39Ar data for six tuff samples and two basalt samples collected from the Tuchengzi, the Yixian and the Jiufotang formations near the classic outcrops in western Liaoning, NE China. We obtain an age of 139.5 ± 1.0 Ma for the uppermost Tuchengzi Formation, an age of 129.7 ± 0.5 Ma for a basaltic lava from the bottom of the Yixian Formation and an age of 122.1 ± 0.3 Ma for a tuff from the base of the overlying Jiufotang Formation. Our data indicate that the Yixian Formation was deposited during the Early Cretaceous, the Barremian to early Aptian, within a time span

  7. New 40Ar/39Ar Ages From Southwest Bolivia Refine the Timing of APVC Volcanism

    Science.gov (United States)

    Salisbury, M.; de Silva, S. L.; Jicha, B.; Singer, B.; Jiménez, N.; Ort, M.

    2008-12-01

    The Altiplano-Puna Volcanic Complex (APVC) of the Central Andes has produced prodigious silicic volcanism (at least 11,000 km3 of magma) over the last 10 Ma including some of the largest known ignimbrites on Earth. Despite excellent exposure, little previous work had been conducted on the timing and distribution of ignimbrite volcanism in the Lípez region of southwestern Bolivia, the heart of the APVC. To address this deficiency we have performed ~612 single crystal laser-fusion 40Ar/39Ar analyses from 39 pumice and bulk matrix samples collected from the main ignimbrite units within the Lípez region. Geochemistry of pumice and mineral samples, and paleomagnetic data are also being used to correlate individual ignimbrite units. Our new 40Ar/39Ar results establish new or refined eruption ages (with 2σ error) from the Vilama caldera at 8.41±0.02 Ma, Pastos Grandes caldera at 5.45±0.02 and 2.94±0.01 Ma, and Guacha caldera at 5.65±0.01, and 3.57±0.02 Ma. New ages were also determined for eruptions from the Panizos ignimbrite shield (6.86±0.03 Ma), Juvina ignimbrite shield (5.23±0.01 Ma), and the Laguna Colorado ignimbrite shield (2.21±0.05 and 1.95±0.03 Ma). The oldest ignimbrite we have found in the area is 10.33±0.64 Ma, a local unit beneath the Vilama ignimbrite. The youngest units have been identified west of the Guacha caldera with eruption ages of 1.70±0.6 Ma and 0.70±0.01 Ma. These results demonstrate that ignimbrite-producing eruptions in the Lípez region span the age of APVC volcanism previously established, with the largest eruptions occurring from long-lived, cyclic supervolcano caldera systems like Guacha and Pastos Grandes. The aggregate data from the APVC support the hypothesis that the APVC developed predominantly during distinct pulses of massive ignimbrite eruptions at ~8, 6, and 4 Ma and attest to episodic behavior of the magmatic system. Ignimbrites of geothermal presence and active local surface deformation suggest that the magma

  8. Phasic Triplet Markov Chains.

    Science.gov (United States)

    El Yazid Boudaren, Mohamed; Monfrini, Emmanuel; Pieczynski, Wojciech; Aïssani, Amar

    2014-11-01

    Hidden Markov chains have been shown to be inadequate for data modeling under some complex conditions. In this work, we address the problem of statistical modeling of phenomena involving two heterogeneous system states. Such phenomena may arise in biology or communications, among other fields. Namely, we consider that a sequence of meaningful words is to be searched within a whole observation that also contains arbitrary one-by-one symbols. Moreover, a word may be interrupted at some site to be carried on later. Applying plain hidden Markov chains to such data, while ignoring their specificity, yields unsatisfactory results. The Phasic triplet Markov chain, proposed in this paper, overcomes this difficulty by means of an auxiliary underlying process in accordance with the triplet Markov chains theory. Related Bayesian restoration techniques and parameters estimation procedures according to the new model are then described. Finally, to assess the performance of the proposed model against the conventional hidden Markov chain model, experiments are conducted on synthetic and real data. PMID:26353069

  9. Expression of ER and AR in lung cancer

    Directory of Open Access Journals (Sweden)

    Shuling WANG

    2008-02-01

    Full Text Available Background and objective Epidemiology of lung cancer differs between sexes and it might be partially explained by different sex hormone levels in women and men. There are some epidemiological data indicating that gender is a significant, independent prognostic factor in lung cancer. The aim of this study is to determine expression of ER (estrogen receptor and AR (androgen receptor in lung cancer, and evaluate the relationship between their expression and clinical or pathologic characteristics. Methods Immunohistochemistry assay was used to detect expression of ER and AR. Results Positive expression of ER and AR were 14.3%(15/105 and 20%(21/105. Positive expression of ER had no relationship with age, gender, pathology, histological differentiation, TNM staging, size of tumor and lymph node metastasis. Although age, gender, pathology, histological differentiation and size of tumor had no effect on the expression of AR, positive rate of AR in staging III lung cancer was significantly higher than that in staging I lung cancer. The different AR expression was significant between N0 and N2 lymph node metastasis ( Chisquare= 4.7828,P=0.0287. Conclusion The expression of ER has no relationship with biological behavior. Positive expression of AR may be correlated with the progression and the lymph node metastasis of lung cancer.

  10. Terahertz spectroscopy of deuterated formaldehyde using a frequency multiplication chain

    Science.gov (United States)

    Zakharenko, Olena; Motiyenko, Roman A.; Margulès, Laurent; Huet, Thérèse R.

    2015-11-01

    The rotational spectra of deuterated formaldehyde HDCO and D2CO were recorded between 1.1 and 1.52 THz in order to benchmark new terahertz frequency multiplication chain used in the Lille spectrometer. Important spectrometer parameters such as sensitivity, measurement accuracy, and harmonic composition of the radiation source have been tested using the newly measured spectra. For each of the main deuterated isotopic species of formaldehyde the existent datasets from high resolution measurements were augmented by more than 300 new distinct transition frequencies. Most of these frequencies were measured with an accuracy better than 30 kHz. In addition, the high sensitivity of the spectrometer provided by the new frequency multiplication chain allowed observation, assignment and analysis of 13C, 17O, 18O, and 13C18O isotopic species of HDCO and D2CO. For some of these isotopologues the rotational parameters were determined for the first time.

  11. Supply chain quality management

    Directory of Open Access Journals (Sweden)

    Hannan Amoozad Mahdiraji

    2012-10-01

    Full Text Available In recent years, there are several methods introduced for the improvement of operational performances. Total quality management and supply chain management are two methods recommended for this purpose. These two approaches have been studied in most researches separately, while they have objectives in common, and this makes them a strategic means, which can be used, simultaneously. Total quality management and supply chain management play significant roles to increase the organizational competitiveness power. Moreover, they have only one purpose that is customer satisfaction, and they are different only on their approaches to reach their objectives. In this research, we aim to study both approaches of quality management and supply chain, their positive increasing effects that may be generated after their integration. For this purpose, the concept and definitions of each approach is studied, independently, their similarities and differences are recognized, and finally, the advantages of their integration are introduced.

  12. Qualidade do ar interior em instalações desportivas

    OpenAIRE

    Marques, Liliana Rute Dias

    2013-01-01

    A Qualidade do Ar Interior (QAI) tem vindo a despertar cada vez mais o interesse da comunidade científica, pelo facto das sociedades modernas passarem a grande maioria do seu dia em ambientes interiores, sendo o ar que respiramos um fator determinante na saúde e bem-estar do ser humano. Os indivíduos que praticam desporto estão em particular risco de inalar poluentes, não só porque durante a atividade desportiva estão sujeitos a maiores taxas de consumo de ar mas também ao f...

  13. A Survey on Web-based AR Applications

    CERN Document Server

    Parhizkar, Behrang; Lashkari, Arash Habibi; Bartaripou, Mohammad Mehdi; Babae, Hossein Reza

    2011-01-01

    Due to the increase of interest in Augmented Reality (AR), the potential uses of AR are increasing also. It can benefit the user in various fields such as education, business, medicine, and other. Augmented Reality supports the real environment with synthetic environment to give more details and meaning to the objects in the real word. AR refers to a situation in which the goal is to supplement a user's perception of the real-world through the addition of virtual objects. This paper is an attempt to make a survey of web-based Augmented Reality applications and make a comparison among them.

  14. Wellness- joogatyöpajojen tuotekehitys: case ArsMondo

    OpenAIRE

    Koukonen, Heidi; Lintunen, Maiju

    2012-01-01

    Tässä opinnäytetyössä tutkitaan, miten ArsMondo Oy:n joogamatkoja voisi kehittää entistä asiakaslähtöisempään suuntaan tulevaisuudessa. Aihe valittiin, sillä se on erittäin mielenkiintoinen ja ajankohtainen aihe matkailun alalla. ArsMondo on suomalainen kulttuurialan yritys, joka räätälöi kulttuuri- ja liikuntamatkoja Italiaan. Työ rajattiin vain ArsMondo- yrityksen joogamatkoihin Italiassa. Teoreettisessa viitekehyksessä avataan jooga- wellness- matkailun käsite sekä kerrotaan wellness- ...

  15. Rotational-isotopic symmetries

    International Nuclear Information System (INIS)

    In this note we submit a nonlocal (integral) generalization of the rotational-isotopic symmetries O-circumflex(3) introduced in preceding works for nonlinear and nonhamiltonian systems in local approximation. By recalling that the Lie-isotopic theory naturally admits nonlocal terms when all embedded in the isounit, while the conventional symplectic geometry is strictly local-differential, we introduce the notion of symplectic-isotopic two-forms, which are exact symplectic two-forms admitting a factorization into the Kronecker product of a canonical two-form time the isotopic element of an underlying Euclidean-isotopic space. Topological consistency is then achieved by embedding all nonlocal terms in the isounit of the iso-cotangent bundle, while keeping the local topology for the canonical part. In this way, we identify the symplectic-isotopic geometry as being the natural geometrical counterpart of the Lie-isotopic theory. The results are used for the introduction of the notion of Birkhoffian angular momentum, that is, the generalization of the conventional canonical angular momentum which is applicable to Birkhoffian systems with generally nonlinear, nonlocal and nonhamiltonian internal forces. The generators J (and the parameters θ) coincide with the conventional quantities. Nevertheless, the quantity J is defined on the underlying Euclidean-isotopic space, by therefore acquiring a generalized magnitude. The isocommutation rules and isoexponentiation of the Birkhoffian angular momentum are explicitly computed and shown to characterize the most general known nonlinear and nonlocal realization of the isorotational symmetry. The local isomorphisms between the infinitely possible isotopes O-circumflex(3) and the conventional symmetry O(3) is proved. Finally the isosymmetries O-circumflex(3) are used to characterize the conserved, total, Birkhoffian angular momentum of closed nonselfadjoint systems. (author). 4 refs

  16. Isotopically controlled semiconductors

    Energy Technology Data Exchange (ETDEWEB)

    Haller, Eugene E.

    2006-06-19

    The following article is an edited transcript based on the Turnbull Lecture given by Eugene E. Haller at the 2005 Materials Research Society Fall Meeting in Boston on November 29, 2005. The David Turnbull Lectureship is awarded to recognize the career of a scientist who has made outstanding contributions to understanding materials phenomena and properties through research, writing, and lecturing, as exemplified by the life work of David Turnbull. Haller was named the 2005 David Turnbull Lecturer for his 'pioneering achievements and leadership in establishing the field of isotopically engineered semiconductors; for outstanding contributions to materials growth, doping and diffusion; and for excellence in lecturing, writing, and fostering international collaborations'. The scientific interest, increased availability, and technological promise of highly enriched isotopes have led to a sharp rise in the number of experimental and theoretical studies with isotopically controlled semiconductor crystals. This article reviews results obtained with isotopically controlled semiconductor bulk and thin-film heterostructures. Isotopic composition affects several properties such as phonon energies, band structure, and lattice constant in subtle, but, for their physical understanding, significant ways. Large isotope-related effects are observed for thermal conductivity in local vibrational modes of impurities and after neutron transmutation doping. Spectacularly sharp photoluminescence lines have been observed in ultrapure, isotopically enriched silicon crystals. Isotope multilayer structures are especially well suited for simultaneous self- and dopant-diffusion studies. The absence of any chemical, mechanical, or electrical driving forces makes possible the study of an ideal random-walk problem. Isotopically controlled semiconductors may find applications in quantum computing, nanoscience, and spintronics.

  17. Episodes of Cenozoic Gold Mineralization on the Eastern Margin of the Qinghai-Tibet Plateau: 40Ar/39Ar Dating and Implication for Geodynamic Events

    Institute of Scientific and Technical Information of China (English)

    WANG Denghong; MAO Jingwen; YAN Shenghao; YANG Jianmin; XU Jue; CHEN Yuchuan; XUE Chunji

    2005-01-01

    A lot of new gold deposits have been found on the eastern margin of the Qinghai-Tibet Plateau during the past two decades. Among them, three main types of gold deposits have been recognized, including quartz-vein-type, shearzone-type and porphyry-type. The former two types of gold deposits are mainly hosted within metamorphic rocks, while the latter is related to Cenozoic magmatism. Although all of these gold deposits are believed to have been formed during the uplift process of the Qinghai-Tibet Plateau in the Cenozoic era (Wang et al., 2002b), precise isotopic age constraints have still been lacking until quite recently. This paper presents new 40Ar/39Ar data of some gold deposits on the eastern margin of the Qinghai-Tibet Plateau, which indicate that gold mineralization in the region occurred in response to the episodic stages of the orogenies.Recently obtained 40Ar/39Ar data on quartz and feldspars from several gold deposits, such as the Sandiao deposit, the Baijintaizi deposit, the Pusagang deposits, provide new constraints on gold mineralization on the eastern margin of the Qinghai-Tibet Plateau. Geochronological studies of gold deposits along the Daduhe River indicate that there are three stages of gold mineralization. The early two stages occurred as early as 65.1 Ma in the Shuibaiyang deposit and 58.95 Ma in the Ruoji deposit, while the latter stage occurred as late as 25.35 Ma in Baijintaizi and 24.70 Ma in Sandiao. Isotopic dating of three plagioclases from the Beiya deposit, Zhifanggou deposit and Luobodi deposit and a K-feldspar from the Jinchangqing deposit in Yunnan Province indicates that these deposits were formed at two stages. The Zhifanggou and Jinchangqing deposits have early stage records as old as 58.82 Ma in Zhifanggou and 55.49 Ma in Jinchangqing, but all of the above four deposits in Yunnan have late stage records of 23.18 Ma in Jinchangqing, 24.54 Ma in Zhifanggou, 24.60 Ma in Luobodi and 24.56 Ma in Hongnitang. The above results suggest

  18. Essentials of supply chain management

    CERN Document Server

    Hugos, Michael H

    2011-01-01

    The latest thinking, strategies, developments, and technologies to stay current in supply chain management Presenting the core concepts and techniques of supply chain management in a clear, concise and easily readable style, the Third Edition of Essentials of Supply Chain Management outlines the most crucial tenets and concepts of supply chain management.

  19. Building the resilient supply chain.

    OpenAIRE

    Christopher, Martin; Peck, Helen

    2004-01-01

    In today’s uncertain and turbulent markets, supply chain vulnerability has become an issue of significance for many companies. As supply chains become more complex as a result of global sourcing and the continued trend to ‘leaning-down’, supply chain risk increases. The challenge to business today is to manage and mitigate that risk through creating more resilient supply chains.

  20. Supply-Chain Optimization Template

    Science.gov (United States)

    Quiett, William F.; Sealing, Scott L.

    2009-01-01

    The Supply-Chain Optimization Template (SCOT) is an instructional guide for identifying, evaluating, and optimizing (including re-engineering) aerospace- oriented supply chains. The SCOT was derived from the Supply Chain Council s Supply-Chain Operations Reference (SCC SCOR) Model, which is more generic and more oriented toward achieving a competitive advantage in business.