WorldWideScience

Sample records for ar isotopic chain

  1. Constraints on the evolution of the Japan Sea based on 40Ar-39Ar ages and Sr isotopic ratios for volcanic rocks of the Yamato Seamount chain in the Japan Sea

    International Nuclear Information System (INIS)

    40Ar-39Ar and Sr isotope analyses were performed on basalts and andesites dredged from the Yamato Seamount chain in the Japan Sea. The 40Ar-39Ar plateau ages range from about 11 to 17 Ma, though most samples show ages between 10 and 14 Ma. The seamounts seem to have formed within a period of a few million years, although some of them might have formed earlier. Based on the present results together with previously reported radiometric age data, it is thought that the Yamato Basin formed during some period prior to 17 Ma and probably later than around 25 Ma. Taking into account the radiometric age data on rocks from the Japan Basin, it is conjectured that the opening of the Japan Sea might have started almost at this time or a little earlier. The observed 87Sr/86Sr ratios range from 0.70357 to 0.70388, suggesting incorporation of some time-integrated components enriched in incompatible elements such as continental crustal materials. This may indicate that in the Japan Sea area, at least the Yamato Basin had not developed enough to show the characteristics of typical N-type MORB source materials without being affected by pre-existing continental crustal materials. (orig.)

  2. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Science.gov (United States)

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  3. Proton scattering from the unstable nuclei sup 3 sup 0 S and sup 3 sup 4 Ar: structural evolution along the sulfur and argon isotopic chains

    CERN Document Server

    Khan, E; Blumenfeld, Y; Van Giai, N; Alamanos, N; Auger, F; Bauge, E; Beaumel, D; Delaroche, J P; Delbourgo-Salvador, P; Drouart, A; Fortier, S; Frascaria, N; Gillibert, A; Girod, M; Jouanne, C; Kemper, K W; Lagoyannis, A; Lapoux, V; Lépine-Szily, A; Lhenry, I; Libert, J; Maréchal, F; Maison, J M; Musumarra, A; Ottini-Hustache, S; Piattelli, P; Pita, S; Pollacco, E C; Roussel-Chomaz, P; Santonocito, D; Sauvestre, J E; Scarpaci, J A; Zerguerras, T

    2001-01-01

    Proton elastic and inelastic scattering angular distributions to the 2 sub 1 sup + and 3 sub 1 sup - collective states of the proton-rich nuclei sup 3 sup 0 S and sup 3 sup 4 Ar were measured at 53 MeV/A and 47 MeV/A, respectively, using secondary beams from the GANIL facility and the MUST silicon strip detector array. Data for the stable sup 3 sup 2 S nucleus were also obtained at 53 MeV/A for comparison. A phenomenological analysis was used to deduce the deformation parameters beta sub p sub , sub p sub ' for the low-lying collective excitations. A microscopic analysis was performed by generating matter and transition densities from self-consistent QRPA calculations. Configuration mixing calculations based on a collective Bohr Hamiltonian were also performed. DWBA and coupled-channel calculations using microscopic optical potentials built from these densities and the JLM interaction are compared to the data. There is no indication for the presence of proton skins in these nuclei. The microscopic calculation...

  4. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Science.gov (United States)

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  5. Dye laser chain for laser isotope separation

    Science.gov (United States)

    Doizi, Denis; Jaraudias, Jean; Pochon, E.; Salvetat, G.

    1993-05-01

    Uranium enrichment by laser isotope separation uses a three step operation which requires four visible wavelengths to boost an individual U235 isotope from a low lying atomic energy level to an autoionizing state. The visible wavelengths are delivered by dye lasers pumped by copper vapor lasers (CVL). In this particular talk, a single dye chain consisting of a master oscillator and amplifier stages will be described and some of its performance given.

  6. Earth-atmosphere evolution based on new determination of Devonian atmosphere Ar isotopic composition

    Science.gov (United States)

    Stuart, Finlay M.; Mark, Darren F.; Gandanger, Pierre; McConville, Paul

    2016-07-01

    The isotopic composition of the noble gases, in particular Ar, in samples of ancient atmosphere trapped in rocks and minerals provides the strongest constraints on the timing and rate of Earth atmosphere formation by degassing of the Earth's interior. We have re-measured the isotopic composition of argon in the Rhynie chert from northeast Scotland using a high precision mass spectrometer in an effort to provide constraints on the composition of Devonian atmosphere. Irradiated chert samples yield 40Ar/36Ar ratios that are often below the modern atmosphere value. The data define a 40Ar/36Ar value of 289.5 ± 0.4 at K/36Ar = 0. Similarly low 40Ar/36Ar are measured in un-irradiated chert samples. The simplest explanation for the low 40Ar/36Ar is the preservation of Devonian atmosphere-derived Ar in the chert, with the intercept value in 40Ar-39Ar-36Ar space representing an upper limit. In this case the Earth's atmosphere has accumulated only 3% (5.1 ± 0.4 ×1016 mol) of the total 40Ar inventory since the Devonian. The average accumulation rate of 1.27 ± 0.09 ×108 mol40Ar/yr overlaps the rate over the last 800 kyr. This implies that there has been no resolvable temporal change in the outgassing rate of the Earth since the mid-Palaeozoic despite the likely episodicity of Ar degassing from the continental crust. Incorporating the new Devonian atmosphere 40Ar/36Ar into the Earth degassing model of Pujol et al. (2013) provides the most precise constraints on atmosphere formation so far. The atmosphere formed in the first ∼100 Ma after initial accretion during a catastrophic degassing episode. A significant volume of 40Ar did not start to accumulate in the atmosphere until after 4 Ga which implies that stable K-rich continental crust did not develop until this time.

  7. A re-examination of petrogenesis and 40Ar/39Ar systematics in the Chain of Ponds K-feldspar: "diffusion domain" archetype versus polyphase hygrochronology

    Science.gov (United States)

    Chafe, Alex N.; Villa, Igor M.; Hanchar, John M.; Wirth, Richard

    2014-05-01

    K-feldspar (Kfs) from the Chain of Ponds Pluton (CPP) is the archetypal reference material, upon which thermochronological modeling of Ar diffusion in discrete "domains" was founded. We re-examine the CPP Kfs using cathodoluminescence and back-scattered electron imaging, transmission electron microscopy, and electron probe microanalysis. 40Ar/39Ar stepwise heating experiments on different sieve fractions, and on handpicked and unpicked aliquots, are compared. Our results reproduce the staircase-shaped age spectrum and the Arrhenius trajectory of the literature sample, confirming that samples collected from the same locality have an identical Ar isotope record. Even the most pristine-looking Kfs from the CPP contains successive generations of secondary, metasomatic/retrograde mineral replacements that post-date magmatic crystallization. These chemically and chronologically distinct phases are responsible for its staircase-shaped age spectra, which are modified by handpicking. While genuine within-grain diffusion gradients are not ruled out by these data, this study demonstrates that the most important control on staircase-shaped age spectra is the simultaneous presence of heterochemical, diachronous post-magmatic mineral growth. At least five distinct mineral species were identified in the Kfs separate, three of which can be traced to external fluids interacting with the CPP in a chemically open system. Sieve fractions have size-shifted Arrhenius trajectories, negating the existence of the smallest "diffusion domains." Heterochemical phases also play an important role in producing nonlinear trajectories. In vacuo degassing rates recovered from Arrhenius plots are neither related to true Fick's Law diffusion nor to the staircase shape of the age spectra. The CPP Kfs used to define the "diffusion domain" model demonstrates the predominance of metasomatic alteration by hydrothermal fluids and recrystallization in establishing the natural Ar distribution among different

  8. Leading chiral three-nucleon forces along isotope chains in the calcium region

    CERN Document Server

    Somà, V; Barbieri, C; Navrátil, P; Duguet, T

    2013-01-01

    Three-nucleon forces (3NFs), and in particular terms of the Fujita-Miyazawa type, strongly influence the structure of neutron-rich exotic isotopes. Ab-initio calculations have shown that chiral two- and three-nucleon interactions correctly reproduce binding energy systematics and neutron driplines of oxygen and nearby isotopes. Exploiting the novel self-consistent Gorkov-Green's function approach, we present the first investigation of Ar, K, Ca, Sc and Ti isotopic chains. Leading chiral 3N interactions are mandatory to reproduce the trend of binding energies throughout these chains and to obtain a good description of two-neutron separation energies. At the same time, nuclei in this mass region are systematically overbound by about 40 MeV and the $N=20$ magic gap is significantly overestimated. We conclude that ab-initio many-body calculations of mid-mass isotopic chains challenge modern theories of elementary nuclear interactions.

  9. Combined oxygen, hydrogen, /sup 40/Ar//sup 39/Ar isotopic evaluation of molybdenite mineralization, east Pioneer Mountains, Montana

    Energy Technology Data Exchange (ETDEWEB)

    Chesley, J.T.; Snee, L.W.; O' Neil, J.R.

    1985-01-01

    The Pear Lake molybdenite (moly) prospect is in the Eastern Pioneer Wilderness Area, 30 km south of the Cannivan Gulch moly deposit. It lies on a NW-SE trend with other prospects that are contemporaneous. Mineralized veins outcrop sporadically over a 4 square mile area, with a major concentration in the center of the study area. Previous studies have suggested potential moly-mineralization at depth. /sup 40/Ar//sup 39/Ar age-spectra on hornblend (hb) from the granodiorite host rock indicate emplacement at 75.0 +/- 1 Ma, with biotite closure at 69.0 +/- .3 Ma, in the vicinity of Pear Lake. Hydrothermal muscovites from the moly-bearing veins have ages of 68.0 +/- .5 Ma. partial resetting of biotite cooling dates in the vicinity of mineralization are observed, but biotites on the outer portion of the mineralizing system are undisturbed. These relations suggest that mineralization occurred after the host pluton had cooled to below 280/sup 0/C. Quartz-magnetite isotopic temperatures are 380 to 420/sup 0/C for moly-veins. These data suggest that magmatic hydrothermal fluids operated in the upper portion of this molysystem. These isotopic data, combined with geologic mapping, suggest that the Pear Lake moly prospect resulted from a weak, short-lived magmatic hydrothermal event at depth, and is unlikely to contain economic levels of molybdenum. The combined /sup 40/Ar//sup 39/Ar-stable isotope approach should prove useful in evaluating other hydrothermal systems.

  10. Growth Rate Estimates of Supergene Manganese Nodule by 40Ar/39Ar Isotopic Dating

    Institute of Scientific and Technical Information of China (English)

    Li Jianwei; Vasconcelos P M

    2004-01-01

    Increasing world-class, high-grade, and metals-enriched supergene manganese ore deposits have been discovered in the last two decades, making them more and more economically important. However, data on the timing and duration of their formation are sparse, mainly due to the difficulties extracting datable minerals suited to traditional radiometric dating methods. Hollandite, cryptomelane, coronadite, todorokite, and manjiroite are common manganese oxide minerals in supergene environments. These minerals host potassium of variable amounts from 0.1 wt% to 5.0 wt% in their structural sites. This geochemical property provides possibility to date supergene manganese ores by using K-Ar and 40Ar/39Ar methods. In this study, we perform 40Ar/39Ar dating on a 7.1-cm-thick botryoidal manganese nodule from an ancient weathering profile at Mount Tabor, central Queensland, Australia. Laser microprobe incremental analyses of distinct growth bands, from the inner core through the intermediate bands to the outermost crusts of the nodule, have yielded high quality 40Ar/39Ar ages at 27.3 Ma, 20.9 Ma, 19.2 Ma, and 16.1 Ma, respectively. The age results permit preliminary estimates on the average growth rates of the nodule varying from 4.7×10-3 mm/ka to 7.6×10-3 mm/ka to 9.0×10-3 mm/ka, from the core to the rim. Results of this study are of significance in our understanding of the mode, mechanism, process, and climatic conditions in the formation of supergene manganese ore deposits.

  11. Hydrothermal fluids, argon isotopes and mineralization ages of the Fankou Pb-Zn deposit in south China: Insights from sphalerite 40Ar/39Ar progressive crushing

    Science.gov (United States)

    Jiang, Ying-De; Qiu, Hua-Ning; Xu, Yi-Gang

    2012-05-01

    Hydrothermal fluid geochemistry and mineralization timing are two important factors in the genesis of a hydrothermal deposit. 40Ar/39Ar analyses of fluid inclusions not only provide time constraints for the mineralization but also help to clarify the K-Ca-Cl-Ar characteristics for the ore-forming fluids. In this study, six sphalerite samples collected from the Fankou lead-zinc sulfide deposit are investigated by 40Ar/39Ar in vacuo crushing. Gases liberated from the early and late crushing steps exhibit distinct Ar isotopic compositions and 40Ar/39Ar apparent ages. Argon released in the early steps has much higher 40Ar and 38ArCl and lower 37ArCa contents than those in the late steps. The significant excess Ar (40ArE) extracted in the early crushing steps shows a strong correlation with 38ArCl with very high 40ArE/38ArCl ratios. In contrast, those of the late steps mainly consist of atmospheric Ar and K-correlated radiogenic Ar with a constant 40ArR/39ArK ratio and the atmospheric initial 40Ar/36Ar ratio. As a result, all samples yield similar declining age spectra: the fore segments with anomalously old apparent ages decline quickly in the early crushing steps and the rear ones are flat with concordant apparent ages in the late crushing steps. The data points of the early steps define linear correlations in plots of 40ArNA/39ArK vs. 38ArCl/39ArK and 38ArCl/40ArNA vs. 39ArK/40ArNA (NA for non-atmospheric) and most yield ages of 240-230 Ma. On the other hand, the data of the late steps always construct well-defined isochrons in the plots of 36ArA/40ArNA vs. 39ArK/40ArNA with consistent ages of ˜300 Ma. We interpret that gases released in the early steps were from the secondary fluid inclusions (SFIs) due to their distribution characteristics along cracks leading to be easily extracted, and those released in the later steps represented the contribution of the primary fluid inclusions (PFIs). The initial 40Ar/36Ar ratios of SFIs, much higher than the modern

  12. Constraining the alteration history of a Late Cretaceous Patagonian volcaniclastic bentonite-ash-mudstone sequence using K-Ar and 40Ar/39Ar isotopes

    Science.gov (United States)

    Warr, L. N.; Hofmann, H.; van der Pluijm, B. A.

    2016-03-01

    Smectite is typically considered unsuitable for radiometric dating, as argon (40Ar) produced from decay of exchangeable potassium (40K) located in the interlayer sites can be lost during fluid-rock interaction and/or during wet sample preparation in the laboratory. However, age analysis of Late Cretaceous Argentinian bentonites and associated volcaniclastic rocks from Lago Pellegrini, Northern Patagonia, indicates that, in the case of these very low-permeability rocks, the radioactive 40Ar was retained and thus can provide information on smectite age and the timing of rock alteration. This study presents isotopic results that indicate the ash-to-bentonite conversion and alteration of the overlying tuffaceous mudstones in Northern Patagonia was complete ~13-17 my after middle Campanian sedimentation when the system isotopically closed. The general absence of illite in these smectite-rich lithologies reflects the low activity of K and the low temperature (<60 °C) of the formation waters that altered the parent ash.

  13. He and Ar isotopes in mantle megacryst minerals from Nushan and Yingfengling in Southeast China

    Institute of Scientific and Technical Information of China (English)

    XU Shijin; FANG Zhong; T. Matsumoto; J. Matsuda; M. Yasuda; YU Jinhai; WANG Rucheng; LIU Wenzhong

    2003-01-01

    He and Ar isotopic compositions of megacrystal minerals from mantle xenoliths were measured by the technique of vacuum crushing extraction. The used samples were clinopyroxene, garnet and ilmenite in Cenozoic alkaline basalts, which were from Nushan in Anhui Province and Yingfengling in Guangdong Province, respectively, and represented materials from the upper mantle in the continental margin of SE China. The results show 3He/4He ratios of 7.99 Ra to 8.58 Ra, consistent with the characteristic ratios of the MORB-type mantle. 40Ar/39Ar ratios vary from 313 to 909, suggesting a binary mixing between the MORB-type mantle and air argons. This may reflect the incorporation of the air argon absorbed in oceanic sediments into the mantle beneath the continental margin by subduction of oceanic plate. This study presents the first report that ilmenite megacrysts contain abundant fluid inclusions and noble gases in the mantle xenoliths.

  14. He, Ne and Ar isotopic composition of Fe-Mn crusts from the western and central Pacific Ocean and implications for their genesis

    Institute of Scientific and Technical Information of China (English)

    BU WenRui; SHI XueFa; ZHANG MingJie; LIU JiHua; G.P. GLASBY

    2007-01-01

    The noble gas nuclide abundances and isotopic ratios of the upmost layer of Fe-Mn crusts from the western and central Pacific Ocean have been determined. The results indicate that the He and Ar nuclide abundances and isotopic ratios can be classified into two types: low 3He/4He type and high 3He/4He type. The low 3He/4He type is characterized by high 4He abundances of 191×10-9 cm3.STP.g-1 on average, with variable 4He, 20Ne and 40Ar abundances in the range (42.8-421)×10-9 cm3.STP.g-1, (5.40-141)×10-9 cm3.STP.g-1, and (773- 10976)×10-9 cm3.STP.g-1, respectively. The high 3He/4He samples are characterized by low 4He abundances of 11.7×10-9 cm3.STP.g-1 on average, with 4He, 20Ne and 40Ar abundances in the range of (7.57-17.4)×10-9 cm3.STP.g-1, (10.4-25.5)×10-9 cm3.STP.g-1 and (5354-9050)×10-9 cm3.STP.g-1, respectively. The low 3He/4He samples have 3He/4He ratios (with R/RA ratios of 2.04-2.92) which are lower than those of MORB (R/RA=8±1) and 40Ar/36Ar ratios (447-543) which are higher than those of air (295.5). The high 3He/4He samples have 3He/4He ratios (with R/RA ratios of 10.4-12.0) slightly higher than those of MORB (R/RA=8±1) and 40Ar/36Ar ratios (293-299) very similar to those of air (295.5). The Ne isotopic ratios (20Ne/22Ne and 21Ne/22Ne ratios of 10.3-10.9 and 0.02774-0.03039, respectively) and the 38Ar/36Ar ratios (0.1886-0.1963) have narrow ranges which are very similar to those of air (the 20Ne/22Ne, 21Ne/22Ne, 38Ar/36Ar ratios of 9.80, 0.029 and 0.187, respectively),and cannot be differentiated into different groups. The noble gas nuclide abundances and isotopic ratios, together with their regional variability, suggest that the noble gases in the Fe-Mn crusts originate primarily from the lower mantle. The low 3He/4He type and high 3He/4He type samples have noble gas characteristics similar to those of HIMU (High U/Pb Mantle)- and EM (Enriched Mantle)-type mantle material, respectively. The low 3He/4He type samples with HIMU-type noble gas

  15. He,Ne and Ar isotopic composition of Fe-Mn crusts from the western and central Pacific Ocean and implications for their genesis

    Institute of Scientific and Technical Information of China (English)

    G.; P.; GLASBY

    2007-01-01

    The noble gas nuclide abundances and isotopic ratios of the upmost layer of Fe-Mn crusts from the western and central Pacific Ocean have been determined. The results indicate that the He and Ar nu- clide abundances and isotopic ratios can be classified into two types: low 3He/4He type and high 3He/4He type. The low 3He/4He type is characterized by high 4He abundances of 191×10-9 cm3·STP·g-1 on average, with variable 4He, 20Ne and 40Ar abundances in the range (42.8―421)×10-9 cm3·STP·g-1, (5.40―141)×10-9 cm3·STP·g-1, and (773―10976)×10-9 cm3·STP·g-1, respectively. The high 3He/4He samples are characterized by low 4He abundances of 11.7×10-9 cm3·STP·g-1 on average, with 4He, 20Ne and 40Ar abundances in the range of (7.57―17.4)×10-9 cm3·STP·g-1, (10.4―25.5)×10-9 cm3·STP·g-1 and (5354―9050)×10-9 cm3·STP·g-1, respectively. The low 3He/4He samples have 3He/4He ratios (with R/RA ratios of 2.04―2.92) which are lower than those of MORB (R/RA=8±1) and 40Ar/36Ar ratios (447―543) which are higher than those of air (295.5). The high 3He/4He samples have 3He/4He ratios (with R/RA ratios of 10.4―12.0) slightly higher than those of MORB (R/RA=8±1) and 40Ar/36Ar ratios (293―299) very similar to those of air (295.5). The Ne isotopic ratios (20Ne/22Ne and 21Ne/22Ne ratios of 10.3―10.9 and 0.02774―0.03039, respectively) and the 38Ar/36Ar ratios (0.1886―0.1963) have narrow ranges which are very similar to those of air (the 20Ne/22Ne, 21Ne/22Ne, 38Ar/36Ar ratios of 9.80, 0.029 and 0.187, respectively), and cannot be differentiated into different groups. The noble gas nuclide abundances and isotopic ratios, together with their regional variability, suggest that the noble gases in the Fe-Mn crusts originate primarily from the lower mantle. The low 3He/4He type and high 3He/4He type samples have noble gas characteristics similar to those of HIMU (High U/Pb Mantle)- and EM (Enriched Mantle)-type mantle material, respectively. The low 3He/4

  16. High-power laser chains used for laser isotope separation

    Science.gov (United States)

    Lompre, Louis A.

    2000-01-01

    Since 1985, France has chosen to focus on the selective photo-ionization process called SILVA for uranium enrichment. The general SILVA schedule has led to the construction of a pilot facility called ASTER, aimed to a general assessment of SILVA. It utilizes a mid power dye laser chain pumped by copper vapor laser chains. An alternative solution to pump dye laser is under development. It is based on high-power diode-pumped frequency doubled Nd:YAG modules. Performances as high as 150 Watts, at 532 nm, 10 kHz and pulse duration shorter than 75 ns have been obtained. The electrical efficiency overpasses 5 percent. The paper will give a description of the high power laser chains used or proposed for laser isotope separation.

  17. C-14 and Ar-39 content in a ground water aquifer in the Saarland - comparison of two ground water isotope dating methods

    International Nuclear Information System (INIS)

    For the Ar-39 groundwater ages found an age comparison is made with ground waters investigated for C-14, Kr-85 and H-3 contents. The location of investigation is a sandstone aquifer of Southern Saarland. The underground production of Ar-39 the hydrological applicability. In granite, the average concentration of U, Th, K, and Cl with an average porosity of 1% and complete diffusion of the isotopes Ar-39 and Cl-36 produced underground can be as high as 105% for Ar-39 moderated and 16% Cl-36 moderated in the interstitial water. (DG)

  18. Heterogeneous lithospheric mantle metasomatism in the eastern North China Craton: He-Ar isotopes in peridotite xenoliths from Cenozoic basalts

    Science.gov (United States)

    Tang, Huayun; Matsumoto, Takuya; Zheng, Jianping; Czuppon, György; Yu, Chunmei; Miyakawa, Chie; Ping, Xianquan

    2014-02-01

    The abundances and isotopic compositions of Helium and Argon have been analyzed in a suite of fresh spinel peridotite xenoliths in Cenozoic basalts from the eastern North China Craton (NCC) by step-wise heating experiments, to investigate the nature of noble gas reservoirs in the subcontinental lithospheric mantle beneath this region. The xenoliths include one harzburgite collected from Hebi in the interior of the NCC, two lherzolites from Hannuoba at the northern margin of the craton, and three lherzolites from Shanwang and Nushan on the eastern margin. 3He/4He ratios in most of the xenoliths are similar to those of mid-ocean ridge basalts (MORB) or slightly lower (2-10.5 Ra, where Ra is the 3He/4He ratio of the atmosphere), suggesting mixing of MORB-like and radiogenic components. One olivine separate from Nushan has a helium value of 25.3 Ra, probably suggesting cosmogenic 3He addition. The 40Ar/36Ar ratios vary from atmospheric value (296) to 1625, significantly lower than the MORB value. Available data of the peridotite xenoliths indicate the He and Ar isotopic systematics of the mantle reservoirs beneath the NCC can be interpreted as mixtures of at least three end-members including MORB-like, radiogenic and atmospheric components. We suggest that the MORB-like noble gases were derived from the underlying asthenosphere during mantle upwelling, whereas the radiogenic and recycled components probably were incorporated into the lithospheric mantle during circum-craton subduction of oceanic crust. Available data suggest that the MORB-like fluids are better preserved in the interior of the NCC, whereas the radiogenic ones are more prevalent at the margins. The Paleo-Asian ocean subduction system probably was responsible for the enriched and recycled noble gas signatures on the northern margin of the craton, while the Pacific subduction system could account for the observed He-Ar isotopic signatures beneath the eastern part. Therefore, integration of helium and

  19. Crude oil He and Ar isotopic characteristics and their geochemical significance: an example from the Gangxi oil field in the Huanghua depression

    Directory of Open Access Journals (Sweden)

    S. Chenpeng

    2005-06-01

    Full Text Available Sampled from the Gangxi oil field in the Huanghua depression, Bohaiwan Basin, the crude oil He and Ar isotopic compositions and their geochemical significance were investigated. The result shows that i the 3He/4He values of the six oil samples free from air contamination indicate a mantle helium contribution ranging between 13.9% and 32.8% and averaging 24.1%, which means that the Gangxi oil field once had a tectonic background of the mantle-derived helium input and higher geothermal flow with an average of 75.0 mWm-2; ii deduced from the 40Ar/36Ar aging effect the Gangxi oil should be derived from the Tertiary; iii water injection is the main reason for the air contamination for the Gangxi oil noble gases and the relations between 3He/4He and 4He/20Ne as well as 40Ar/36Ar and 4He/20Ne are of an applicative potential in estimating the water injection effect and the connectivity of producing formations. The search for the crude oil He and Ar isotopes provides a new approach to inferring natural gas and oil sources, tectonic backgrounds, geothermal flow and water injection effect.

  20. α-decay chains relevant with superheavy isotopes 270-318118

    International Nuclear Information System (INIS)

    Understanding the decay modes and knowing the involved half-lives are of prime importance to identify the decay chains of superheavy elements, which are the experimental signature of the formation of the elements in fusion reactions. In the present study α-decay half-lives are found out using coulomb and proximity potential model and spontaneous fission half-life are found out using the formula of Ren et al. The range of isotopes in which α-decay shall occur are found out by making use of the difference in α-decay half-life and the fission decay half- life as criterion. It is done in the case of 275 even-even isotopes of the isotopic chains from 270-318118 to 230-27898

  1. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  2. Tracking the provenance of Greenland-sourced, Holocene aged, individual sand-sized ice-rafted debris using the Pb-isotope compositions of feldspars and 40Ar/39Ar ages of hornblendes

    Science.gov (United States)

    White, Lee F.; Bailey, Ian; Foster, Gavin L.; Allen, Georgina; Kelley, Simon P.; Andrews, John T.; Hogan, Kelly; Dowdeswell, Julian A.; Storey, Craig D.

    2016-01-01

    The provenance of sand-sized ice-rafted debris (IRD) sourced from Greenland is currently difficult to determine. Such knowledge, if it could be ascertained with a high degree of certainty, could be applied to the Greenland-proximal marine records to improve both our understanding of modern-day spatial patterns of iceberg rafting and the past history of the Greenland Ice Sheet (GIS). Recent studies have highlighted the utility of the Pb-isotope composition of individual sand-sized feldspars and the 40Ar/39Ar ages of individual sand-sized hornblendes in this regard. However, before any such provenance toolkit can be applied to the palaeo-record, it is necessary first to determine whether this approach can be used to track the sources of known recent Greenland-proximal IRD deposition. To this end we present new records of the Pb-isotope composition and the 40Ar/39Ar ages of individual sand-sized grains of feldspars and hornblendes, respectively, from modern Greenland glacifluvial and fjord sands and Holocene to modern Greenland-proximal marine sediments. These new data demonstrate that sand-sized feldspars and hornblendes glacially eroded by the GIS exhibit distinct intra- and inter-tectonic terrane differences in their Pb-isotope compositions and ages and that these differences are clearly expressed in the geochemistry and geochronology of sand-sized IRD deposited in marine sediments around Greenland. Although overlap exists between some Greenland-proximal IRD 'source fields' defined by these data, our approach has the potential to both better understand spatial patterns of Greenland-derived IRD in the modern day as well as during past episodes of iceberg calving.

  3. Investigation of the impact of the $^{39}$Ar(n , $\\alpha)^{36}$S reaction on the nucleosynthesis of the rare isotope $^{36}$S

    CERN Multimedia

    Geltenbort, P

    2002-01-01

    The origin of the rare, neutron rich isotope $^{36}$S remains a debated question. One of the key reactions in the s-process nucleosynthesis network leading to $^{36}$S is $^{39}$Ar(n , $\\alpha) ^{36}\\!$S. This reaction has never been studied so far, which is due to the fact that $^{39}$Ar is a radioactive (T$_{1/2}$ = 269 y) gas, which is not commercially available. During a three days experimental campaign, an optimized $^{39}$Ar sample was prepared at ISOLDE. A dedicated titaniumoxide target (8 g/cm$^{2}$) was bombarded with 1 GeV protons from the PS Booster. In order to obtain a pure argon beam, a water-cooled transfer line was used to freeze-out less volatile isobars before they can reach the ion source. Adding stable argon with a calibrated leak to the ion source enabled to determine the ionization efficiency (3.5%). For the isotope separation, the low-mass side (GLM) of the General Purpose Separator was used. After magnetic separation, $^{39}$Ar ions (1+) were implanted at 60 keV in a 12 mm thick alumin...

  4. 用于早前寒武纪岩石Ar-Ar法定年的K-Ar法年龄国家二级标准物质——ZMT04白云母的定值结果%The certified results of ZMT04 muscovite reference material utilized for 40Ar/39Ar isotopic geochronological research on Early precambrian rocks in China.

    Institute of Scientific and Technical Information of China (English)

    桑海清; 王非; 龚俊峰; 周晶

    2013-01-01

    desirable for any relatively old sample.In that occasion,if the neutron flux monitor is much younger than the unknown age sample,the 40 Ar/39Ar ratio in standard may become very small,approaching a smaller limit value (≈3).Therefore,it is quite necessary to prepare an old age standard for the flux monitor of the 40 Ar-39 Ar method,especially for isotopic geochronological research on Early Precambrian rocks and meteorites.ZMT04 muscovite as K-Ar age geostandard of China,were separated from a pegmatite dike which occurs at Tianpishan area,in the southwest of Zhuozi County,Inner Mongolia of China.The pegmatite consists of muscovite,quartz and minor zircon,sphere etc.About 1080g of pure ZMT04 muscovite was obtained at the (10 × 1 × 0.02)mm fraction.The purity is about 100%.Following mixing,the ZMT04 muscovite was divided into 14 jars about 77g each.Each jar sample was further subdivided into14 aliquots about 5.51g each (total 196 aliquots).One aliquot (prefixed C) was retained for control analysis of K and 40Ar*,the other 13 aliquot of the same jar remain to be used fo interlabortory work.40Ar-39 Ar age spectrum of ZMT04 muscovite indicats that the muscovite has remained undisturbed since its crystallisation.The plateau age age is 1823 ± 15Ma.Thirteen stepwise hating Ar isotopic data of the muscovite give a 40Ar/39Ar isochron age of 1824 ± 15Ma and the initial 40Ar/36Ar ration of 288 ± 16,and the MSWD in the 40Ar/36Ar-39Ar/36Ar isochron diagram is 2.10.This age may represent the crystallization time of the muscovite in the pegmatite dike.The homogeneity tests and the certification analyses of 40Ar* and K in ZMT04 muscovite were performed according to the rules from the International Standard Organization (ISO) Guid 35 (1985) and primary referenc material technique of China (1994).During the homogeneity tests the analyses of K and 40Ar* in 77-600 hornblende,Hb3gr hornblende and BSP-1 hornblend were done and the results are almost coincident with their mean value

  5. Rb, Sr and strontium isotopic composition, K/Ar age and large ion lithophile trace element abundances in rocks and glasses from the Wanapitei Lake impact structure

    International Nuclear Information System (INIS)

    Shock metamorphosed rocks and shock-produced melt glasses from the Wanapitei Lake impact structure have been examined petrographically and by electron microprobe. Eleven clasts exhibiting varying degrees of shock metamorphism and eight impact-produced glasses have been analyzed for Rb, Sr and Sr isotopic composition. Five clasts and one glass have also been analyzed for large ion lithophile (LIL) trace element abundances including Li, Rb, Sr, and Ba and the REE's. The impact event forming the Wanapitei Lake structure occurred 37 m.y. ago based on K/Ar dating of glass and glassy whole-rock samples. Rb/Sr isotopic dating failed to provide a meaningful whole-rock or internal isochron. The isotopic composition of the glasses can be explained by impact-produced mixing and melting of metasediments. Large ion lithophile trace element abundance patterns confirm the origin of the glasses by total shock melting of metasediments. (author)

  6. Source of ore-forming fluids of the Tianbaoshan Pb-Zn deposit, Southwest China: constrains from C-O, S, and He-Ar isotopes

    Science.gov (United States)

    Wang, Jian; Zhang, Jun; Zhong, Wenbin

    2016-04-01

    The Sichuan-Yunnan-Guizhou (SYG) metallogenic province is one of the most important areas for Pb-Zn resources in China. The metallogenic sources of these Pb-Zn deposits have long been debated. In this study, we provide integrated C-O-S-He-Ar isotopic data of the typical Tianbaoshan Pb-Zn deposit, with an aim to constrain the sources of ore-forming fluids. The Tianbaoshan deposit a large-sized Pb-Zn deposit in SYG metallogenic province, Southwest China. The proven resources include 2.6 Mt metals of Zn+Pb with average grades of 10.09% Zn and 1.50% Pb. The orebodies are hosted within the carbonates of the Ediacaran Dengying Formation. Ore minerals consist mainly of sphalerite, galena, chalcopyrite, and pyrite. Gangue minerals are dominated by calcite and dolomite. The calcite samples from the Tianbaoshan deposit yield homogeneous δ13CV ‑PDBvalues of -1.70‰ to -1.60‰ (average -1.63), with δ18OV ‑SMOW values ranging from 12.9‰ to 15.2‰ (average 14.4). The C-O isotopic data suggest the hydrothermal fluids may be originated from a mixed source involving both mantle and carbonate wall rocks. The δ34S values of the sphalerite, galena and chalcopyrite samples vary from 3.32‰ to 5.71‰ -0.36‰ to 1.31‰ and 4.5‰ to 4.7‰ respectively, indicating a magmatic source for sulfur. The 3He/4He ratios of chalcopyrite samples range from 0.01 to 0.32 Ra which is slightly higher than the crustal ratios (0.05 Ra), but obviously lower than that of mantle fluids (6 to 9 Ra). The 40Ar/36Ar ratios range from 345.0 to 669.1, which are slightly higher than that of air (298.5). The He-Ar isotopic compositions suggest that the ore-forming fluids are dominantly derived from the crust, with litter contamination from mantle-derived fluids. In combination with the C-O, S, and He-Ar isotopic data, we propose the ore-forming fluids of the Tianbaoshan deposit were derived by mixing of crustal and mantle fluids. And the metallogenic process may be genetically related to the

  7. The L3-6 chondritic regolith breccia Northwest Africa (NWA) 869: (I) Petrology, chemistry, oxygen isotopes, and Ar-Ar age determinations

    Science.gov (United States)

    Metzler, Knut; Bischoff, Addi; Greenwood, Richard C.; Palme, Herbert; Gellissen, Marko; Hopp, Jens; Franchi, Ian A.; Trieloff, Mario

    2011-05-01

    Northwest Africa (NWA) 869 consists of thousands of individual stones with an estimated total weight of about 7 metric tons. It is an L3-6 chondrite and probably represents the largest sample of the rare regolith breccias from the L-chondrite asteroid. It contains unequilibrated and equilibrated chondrite clasts, some of which display shock-darkening. Impact melt rocks (IMRs), both clast-free and clast-poor, are strongly depleted in Fe,Ni metal, and sulfides. An unequilibrated microbreccia, two different light inclusions and two different SiO2-bearing objects were found. Although the matrix of this breccia appears partly clastic, it is not a simple mixture of fine-grained debris formed from the above lithologies, but mainly represents an additional specific lithology of low petrologic type. We speculate that this material stems from a region of the parent body that was only weakly consolidated. One IMR clast and one SiO2-bearing object show Δ17O values similar to bulk NWA 869, suggesting that both are related to the host rock. In contrast, one light inclusion and one IMR clast appear to be unrelated to NWA 869, suggesting that the IMR clast is contaminated with impactor material. 40Ar-39Ar analyses of a type 4 chondrite clast yield a plateau age of 4402 ± 7 Ma, which is interpreted to be the result of impact heating. Other impact events are recorded by an IMR clast at 1790 ± 36 Ma and a shock-darkened clast at 2216 ± 40 Ma, demonstrating that NWA 869 escaped major reset in the course of the event at approximately 470 Ma that affected many L-chondrites.

  8. Petrology, 40Ar/39Ar age, Sr-Nd isotope systematics, and geodynamic significance of an ultrapotassic (lamproitic) dyke with affinities to kamafugite from the easternmost margin of the Bastar Craton, India

    Science.gov (United States)

    Rao, N. V. Chalapathi; Atiullah; Burgess, R.; Nanda, Purnendu; Choudhary, A. K.; Sahoo, Samarendra; Lehmann, B.; Chahong, Ngazipmi

    2016-04-01

    We report the mineralogy, bulk-rock geochemistry, 40Ar/39Ar (whole-rock) age and radiogenic (Sr and Nd) isotope composition of an ultrapotassic dyke from Sakri (Nuapada lamproite field) located at the tectonic contact between the easternmost margin of the Bastar craton and Eastern Ghats Mobile Belt, India. The Sakri dyke has a mineralogy which strongly resembles a lamproite sensu stricto (viz.,Ti-rich phlogopite, Na-poor diopside, Fe-rich sanidine, ulvospinel trend and Sr-rich apatite). However, its bulk-rock major element geochemical characteristics (viz., extreme silica-undersaturated nature) resemble sensu lato kamafugite from Toro Ankole, Uganda, East African Rift, and Alto Paranaiba Province, Brazil. The Sakri dyke also displays certain compositional peculiarities (viz., high degree of evolution of mica composition from phlogopite to biotite, elevated titanium and aluminum in clinopyroxene and significantly lower bulk Mg#) when compared to the ultrapotassic rocks from various Indian cratons. 40Ar/39Ar dating gave a plateau age of 1045 ± 9 Ma which is broadly similar to that of other Mesoproterozoic (i) lamproites from the Bastar and Bundelkhand cratons, and (ii) kimberlites from the Eastern Dharwar craton. Initial bulk-rock Sr (0.705865-0.709024) and Nd (0.511063-0.511154) isotopic ratios reveal involvement of an `enriched' source region with long-term incompatible element enrichment and a depleted mantle (TDM) Nd model age of 2.56 Ga straddling the Archaean-Proterozoic chronostratigraphic boundary. The bulk-rock incompatible trace element ratios (Ta/Yb, Th/Yb, Rb/Ba and Ce/Y) of the Sakri ultrapotassic dyke negate any significant influence of crustal contamination. Small-degree melting (1 to 1.5 %) of a mixed garnet-facies and spinel-facies phlogopite lherzolite can account for its observed REE concentrations. Whereas the emplacement of the Sakri ultrapotassic dyke is related to the amalgamation of the supercontinent of Rodinia, its overlapping geochemical

  9. On the Production of He, Ne, and AR Isotopes from Mg, Al, Si, Ca, Fe, and NI in an Artificially Irradiated Meteoroid

    Science.gov (United States)

    Wieler, R.; Signet, P.; Rosel, R.; Herpers, U.; Lupke, M.; Lange, H.-J.; Michel, R.

    1992-07-01

    The production of He, Ne, and Ar isotopes from their main target elements was investigated in an experiment (1) by irradiating a 50-cm-diameter gabbro sphere isotropically with 1.6 GeV protons. The model meteoroid contained, among a large number of other targets, pure element foils of Mg, Al, Si, Fe, and Ni at 10 different depths and wollastonite targets at 3 different depths in central bores. After the irradiation, radionuclide production in these targets was measured by gamma spectrometry. Stable He, Ne, and Ar isotopes were measured in statically operated mass spectrometers. Here, we report the results for stable He, Ne, and Ar isotopes and for ^22Na. The production depth profiles vary widely, ranging from profiles with near-surface production 15% higher than in the center (^22Na from Fe) to such profiles with production in the center 45% higher than near the surface (^20Ne from Mg). The isotope ratios ^3He/^4He and ^3He/^21Ne in Mg, Al, Si and ^22Ne/^21Ne in Mg all decrease significantly with increasing shielding. The production rates of He, Ne, and ^22Na from Mg, Al, and Si in the 1600-MeV simulation experiment are 1.5 to 3 times higher than in the model meteoroid of similar size but irradiated earlier with 600 MeV protons (2). This increase is attributed to the increase of the production of secondary neutrons with primary energies rising from 600 to 1600 MeV. This effect also causes the depth dependences of isotope ratios observed in the 1600-MeV simulation that was not seen in the 600-MeV experiment. Model calculations of the production of He, Ne, and Ar isotopes and of ^22Na were performed for the artificial meteorites of the 600- and 1600 MeV-exposures as well as for real meteoroids. Production rates were calculated from depth-dependent p- and n- spectra, which were derived by Monte Carlo techniques using the HERMES code system (3), and from cross sections for the relevant nuclear reactions as described earlier (4). The cross section database for p

  10. Argon, oxygen, and boron isotopic evidence documenting 40ArE accumulation in phengite during water-rich high-pressure subduction metasomatism of continental crust

    Science.gov (United States)

    Menold, Carrie A.; Grove, Marty; Sievers, Natalie E.; Manning, Craig E.; Yin, An; Young, Edward D.; Ziegler, Karen

    2016-07-01

    The Luliang Shan area of the North Qaidam high pressure (HP) to ultrahigh pressure (UHP) metamorphic terrane in northwestern China features thick, garnet- and phengite-rich metasomatic selvages that formed around gneiss-hosted mafic eclogite blocks during HP conditions. Here we present new 40Ar/39Ar, δ18 O, and δ11 B results from a previously studied 30 m, 18 sample traverse that extends from the host gneiss into a representative eclogite block. Previous thermobarometry and new mica-quartz oxygen isotope thermometry from the traverse reveal that the phengite-rich selvage formed at temperatures similar to those recorded by the eclogites at peak pressure. Quartz and white mica δ18 O data from the selvage cannot be explained by simple mixing of gneiss and eclogite, and indicate a fluid/rock ratio >1 during regional-scale infiltration of high δ18 O (ca. 14‰) fluids. Heavy δ18 O overgrowths of metamorphic zircon over lighter δ18 O detrital grains indicate that the gneiss was similarly affected. Starkly contrasting boron content and δ11 B compositions for the host gneiss and the selvage also cannot be explained by local-scale devolatilization of the gneiss to form the selvage. Instead, the boron systematics are best attributed to two distinct phases of fluid infiltration: (1) low-boron selvage phengite with δ11 B from -10 to -30‰ grew under HP conditions; and (2) tourmaline and boron-rich muscovite with generally positive δ11 B crystallized in the host gneiss under subsequent lower pressure epidote-amphibolite facies conditions as the Luliang Shan gneiss terrane was exhumed past shallower portions of the subduction channel. Consistent with observations made worldwide, we were able to identify uptake of excess argon (40ArE) in phengite as a high pressure phenomenon. Phengite 40Ar/39Ar ages from massive eclogite exceed the ca. 490 Ma zircon U-Pb age of eclogite metamorphism by a factor of 1.5. However, phengite ages from the more permeable schistose selvage

  11. He, Ne and Ar isotope compositions of fluid inclusions in hy-drothermal sulfides from the TAG hydrothermal field, Mid-Atlantic Ridge

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Helium, neon and argon isotope compositions of fluid inclusionshave been measured in hydrothermal sulfide samples from the TAG hydrothermal field at the Mid-Atlantic Ridge. Fluid-inclusion 3He/4He ratios are 2.2-13.3 times the air value (Ra), and with a mean of 7.2 Ra. Com-parison with the local vent fluids (3He/4He=7.5-8.2 Ra) and mid-ocean ridge basalt values (3He/4He=6-11 Ra) shows that the variation range of 3He/4He ratios from sulfide-hosted fluid inclu-sions is significantly large. Values for 20Ne/22Ne are from 10.2 to 11.4, which are significantly higher than the atmospheric ratio (9.8). And fluid-inclusion 40Ar/36Ar ratios range from 287 to 359, which are close to the atmospheric values (295.5). These results indicate that the noble gases of fluid inclu-sions in hydrothermal sulfides are a mixture of mantle- and seawater-derived noble gases; the partial mantle-derived components of trapped hydrothermal fluids may be from the lower mantle; the helium of fluid inclusions is mainly from upper mantle; and the Ne and Ar components are mainly from seawater.

  12. The Bulong Gold Deposit-a Quartz-Barite Vein Type Gold Deposit in Xinjiang:Geological Characteristics and S, He and Ar Isotopic Compositions

    Institute of Scientific and Technical Information of China (English)

    YANG Fuquan; WANG Yitian; MAO Jingwen

    2004-01-01

    The Bulong gold deposit, located in the southwest Tianshan in China, occurs in the Upper Devonian finegrained clastic rocks. The gold orebodies are controlled by an gently inclined interlayer fractured zone. They are hosted only in quartz-barite veins though there are barite veins and quartz veins in the ore district. The δ34S values of pyrite in the ores range from 14.6‰ to 19.2‰ and those of barite from 35.0‰o to 39.6‰, indicating that the sulfur was derived from the strata. 3He/4He ratios of fluid inclusions in pyrite are 0.24-0.82 R/Ra, approximating to that of the crust. The 40Ar/36Ar ratios range from 338 to 471, slightly higher than that of the atmosphere. 40Ar/4He ratios of ore fluids range from 0.015 to 0.412 with a mean of 0.153. Helium and argon isotope compositions of fluid inclusions show that the ore fluids of the Bulong gold deposit were mainly derived from the crust.

  13. 40Ar/39Ar Geochronology, Isotope Geochemistry (Sr, Nd, Pb), and petrology of alkaline lavas near Yampa, Colorado: migration of alkaline volcanism and evolution of the northern Rio Grande rift

    Science.gov (United States)

    Cosca, Michael A.; Thompson, Ren A.; Lee, John P.; Turner, Kenzie J.; Neymark, Leonid A.; Premo, Wayne R.

    2014-01-01

    Volcanic rocks near Yampa, Colorado (USA), represent one of several small late Miocene to Quaternary alkaline volcanic fields along the northeast margin of the Colorado Plateau. Basanite, trachybasalt, and basalt collected from six sites within the Yampa volcanic field were investigated to assess correlations with late Cenozoic extension and Rio Grande rifting. In this paper we report major and trace element rock and mineral compositions and Ar, Sr, Nd, and Pb isotope data for these volcanic rocks. High-precision 40Ar/39Ar geochronology indicates westward migration of volcanism within the Yampa volcanic field between 6 and 4.5 Ma, and the Sr, Nd, and Pb isotope values are consistent with a primary source in the Proterozoic subcontinental lithospheric mantle. Relict olivine phenocrysts have Mg- and Ni-rich cores, whereas unmelted clinopyroxene cores are Na and Si enriched with finely banded Ca-, Mg-, Al-, and Ti-enriched rims, thus tracing their crystallization history from a lithospheric mantle source region to one in contact with melt prior to eruption. A regional synthesis of Neogene and younger volcanism within the Rio Grande rift corridor, from northern New Mexico to southern Wyoming, supports a systematic overall southwest migration of alkaline volcanism. We interpret this Neogene to Quaternary migration of volcanism toward the northeast margin of the Colorado Plateau to record passage of melt through subvertical zones within the lithosphere weakened by late Cenozoic extension. If the locus of Quaternary alkaline magmatism defines the current location of the Rio Grande rift, it includes the Leucite Hills, Wyoming. We suggest that alkaline volcanism in the incipient northern Rio Grande rift, north of Leadville, Colorado, represents melting of the subcontinental lithospheric mantle in response to transient infiltration of asthenospheric mantle into deep, subvertical zones of dilational crustal weakness developed during late Cenozoic extension that have been

  14. Rb-Sr whole-rock and mineral ages, K-Ar, 40Ar/39Ar, and U-Pb mineral ages, and strontium, lead, neodymium, and oxygen isotopic compositions for granitic rocks from the Salinian Composite Terrane, California:

    Science.gov (United States)

    Kistler, R.W.; Champion, D.E.

    2001-01-01

    This report summarizes new and published age and isotopic data for whole-rocks and minerals from granitic rocks in the Salinian composite terrane, California. Rubidium-strontium whole-rock ages of plutons are in two groups, Early Cretaceous (122 to 100 Ma) and Late Cretaceous (95 to 82 Ma). Early Cretaceous plutons occur in all granitic rock exposures from Bodega Head in the north to those from the Santa Lucia and Gabilan Ranges in the central part of the terrane. Late Cretaceous plutons have been identified in the Point Reyes Peninsula, the Santa Lucia and the Gabilan Ranges, and in the La Panza Range in the southern part of the terrane. Ranges of initial values of isotopic compositions are 87Sr/86Sr, 0.7046-0.7147, δ18O, +8.5 to +12.5 per mil, 206Pb/204Pb, 18.901-19.860, 207Pb/204Pb, 15.618-15.814, 208Pb/204Pb, 38.569- 39.493, and εNd, +0.9 to -8.6. The initial 87Sr/86Sr=0.706 isopleth is identified in the northern Gabilan Range and in the Ben Lomond area of the Santa Cruz Mountains, in Montara Mountain, in Bodega Head, and to the west of the Farallon Islands on the Cordell Bank. This isotopic boundary is offset about 95 miles (160km) by right-lateral displacements along the San Gregorio-Hosgri and San Andreas fault systems.

  15. Mineralogical, chemical and K-Ar isotopic changes in Kreyenhagen Shale whole rocks and pyrolysis experimental maturation

    Science.gov (United States)

    Clauer, Norbert; Lewan, Michael D.; Dolan, Michael P.; Chaudhuri, Sambhudas; Curtis, John B.

    2014-01-01

    Progressive maturation of the Eocene Kreyenhagen Shale from the San Joaquin Basin of California was studied by combining mineralogical and chemical analyses with K–Ar dating of whole rocks and pyrolysis of an immature outcrop sample. The K–Ar age decreases from 89.9 ± 3.9 and 72.4 ± 4.2 Ma for the outcrop whole rock and its <2 μm fraction, respectively, to 29.7 ± 1.5 and 21.0 ± 0.7 Ma for the equivalent materials buried to 5167 m. The natural maturation does not produce K–Ar ages in the historical sense, but rather K/Ar ratios of relative K and radiogenic 40Ar amounts resulting from a combined crystallization of authigenic and alteration of initial detrital K-bearing minerals of the rocks. The Al/K ratio of the naturally matured rocks is essentially constant for the entire depth sequence, indicating that there is no detectable variation in the crystallo-chemical organization of the K-bearing alumino-silicates with depth. No supply of K from outside of the rock volumes occurred, which indicates a closed-system behavior for it. Conversely, the content of the total organic carbon (TOC) content decreases significantly with burial, based on the progressive increasing Al/TOC ratio of the whole rocks. The initial varied mineralogy and chemistry of the rocks and their <2 μm fractions resulting from differences in detrital sources and depositional settings give scattered results that homogenize progressively during burial due to increased authigenesis, and concomitant increased alteration of the detrital material.

  16. Changes in nuclear structure along the Mn isotopic chain studied via charge radii

    CERN Document Server

    Heylen, H; Beerwerth, R; Billowes, J; Bissell, M L; Blaum, K; Bonnard, J; Campbell, P; Cheal, B; Goodacre, T Day; Fedorov, D; Fritzsche, S; Ruiz, R F Garcia; Geithner, W; Geppert, Ch; Gins, W; Grob, L K; Kowalska, M; Kreim, K; Lenzi, S M; Moore, I D; Maass, B; Malbrunot-Ettenauer, S; Marsh, B; Neugart, R; Neyens, G; Nortershauser, W; Otsuka, T; Papuga, J; Rossel, R; Rothe, S; Sanchez, R; Tsunoda, Y; Wraith, C; Xie, L; Yang, X F; Yordanov, D T

    2016-01-01

    The hyperfine spectra of $^{51,53-64}$Mn were measured in two experimental runs using collinear laser spectroscopy at ISOLDE, CERN. Laser spectroscopy was performed on the atomic $3d^5\\ 4s^2\\ ^{6}\\text{S}_{5/2}\\rightarrow 3d^5\\ 4s4p\\ ^{6}\\text{P}_{3/2}$ and ionic $3d^5\\ 4s\\ ^{5}\\text{S}_2 \\rightarrow 3d^5\\ 4p\\ ^{5}\\text{P}_3$ transitions, yielding two sets of isotope shifts. The mass and field shift factors for both transitions have been calculated in the multiconfiguration Dirac-Fock framework and were combined with a King plot analysis in order to obtain a consistent set of mean-square charge radii which, together with earlier work on neutron-deficient Mn, allow the study of nuclear structure changes from $N=25$ across $N=28$ up to $N=39$. A clear development of deformation is observed towards $N=40$, confirming the conclusions of the nuclear moments studies. From a Monte Carlo Shell Model study of the shape in the Mn isotopic chain, it is suggested that the observed development of deformation is not only d...

  17. Isotopic chains around oxygen from evolved chiral two- and three-nucleon interactions

    CERN Document Server

    Cipollone, Andrea; Navrátil, Petr

    2013-01-01

    We extend the formalism of self-consistent Green's function theory to include three-body interactions and apply it to isotopic chains around oxygen for the first time. The third-order algebraic diagrammatic construction [ADC(3)] equations for two-body Hamiltonians can be exploited upon defining system-dependent one- and two-body interactions coming from the three-body force, and correspondingly dropping interaction reducible diagrams. This goes beyond the standard normal ordering truncations recently used in ab-inito studies. The Koltun sum rule for the total binding energy acquires a correction due to the added three-body interaction. This formalism is then applied to study chiral two-nucleon (2N) and three-nucleon forces (3NF) evolved to low momentum cutoffs. We find that these interactions reproduce the binding energies of nitrogen, oxygen and fluorine isotopes to great accuracy, providing clear indication of the predictive power of this approach. All three neutron driplines are correctly predicted when fu...

  18. New K-Ar ages for calculating end-of-shield extrusion rates at West Maui volcano, Hawaiian island chain

    Science.gov (United States)

    Sherrod, D.R.; Murai, T.; Tagami, Takahiro

    2007-01-01

    Thirty-seven new K-Ar ages from West Maui volcano, Hawai'i, are used to define the waning stages of shield growth and a brief episode of postshield volcanism. All but two samples from shield-stage strata have reversed polarity magnetization, so conceivably the exposed shield is not much older than the Olduvai Normal-Polarity subchron, or about 1.8 Ma. The oldest ages obtained are in the range 1.9-2.1 Ma but have large analytical error. Shield volcanism ended about 1.35 Ma, and postshield volcanism followed soon thereafter, persisting until about 1.2 Ma. Exposed shield-stage strata were emplaced at a rate of about 0.001 km3 per year, a rate smaller than historic Hawaiian magmatic rates by a factor of 100. Stratigraphic accumulation rates are similar to those measured previously at Wai'anae volcano (O'ahu) or the upper part of the Mauna Kea shield sequence (Hilo drill core, Hawai'i). These rates diminish sharply during the final 0.3-0.5 m.y. of the shield stage. Hawaiian shield volcanoes begin waning well before their last 0.5 m.y. of life, then end quickly, geologically speaking, if West Maui is representative. ?? Springer-Verlag 2006.

  19. Long chain n-alkanes and their carbon isotopes in lichen species from western Hubei Province: implication for geological records

    Institute of Scientific and Technical Information of China (English)

    Xianyu HUANG; Jiantao XUE; Shouyu GUO

    2012-01-01

    Five coticolous lichen samples were collected from western Hubei Province of China to analyze the long chain n-alkanes and their carbon isotope compositions.The n-alkanes range in carbon number from C17 to C33 with strong odd-over-even predominance between C21and C33.Lichens are dominated by n-C29 in the samples of Dajiuhu,Shennongjia Mountain,but by both n-C23 and n-C29 at Qizimei Mountain.This difference may result from the different environmental conditions in these two sites.The δ13C values of long chain n-alkanes in lichen samples show the signature of C3 plants.Based on compoundspecific carbon isotopic values and previous results,we state that alkane homologs > C23 mainly originate from the symbiotic fungi,while symbiotic algae only contribute trace amount of long chain alkanes.Of great interesting is the occurrence of long chain 3-methylalkanes in the Qizimei samples.These anteiso compounds range from C24 to C32,displaying obvious even-over-odd predominance.This study reveals that the association of long chain 3-methylalkanes with n-C23 alkane might be used as proxies to reconstruct the paleoecological implications of lichens in Earth history.

  20. Ars disyecta Ars disyecta

    Directory of Open Access Journals (Sweden)

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  1. 40Ar/39Ar age calibration against counted annuallayers

    DEFF Research Database (Denmark)

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  2. Gas isotopic signatures (He, C, and Ar) in the Lake Kivu region (western branch of the East African rift system): Geodynamic and volcanological implications

    Science.gov (United States)

    Tedesco, D.; Tassi, F.; Vaselli, O.; Poreda, R. J.; Darrah, T.; Cuoco, E.; Yalire, M. M.

    2010-01-01

    On 17 January 2002, the city of Goma was partly destroyed by two of the several lava flows erupted from a roughly N-S oriented fracture system opened along the southern flank of Mount Nyiragongo (Democratic Republic of Congo), in the western branch of the East African rift system. A humanitarian and scientific response was promptly organized by international, governmental, and nongovernmental agencies coordinated by the United Nations and the European Union. Among the different scientific projects undertaken to study the mechanisms triggering this and possible future eruptions, we focused on the isotopic (He, C, and Ar) analysis of the magmatic-hydrothermal and cold gas discharges related to the Nyiragongo volcanic system, the Kivu and Virunga region. The studied area includes the Nyiragongo volcano, its surroundings, and peripheral areas inside and outside the rift. They have been subdivided into seven regions characterized by distinct 3He/4He (expressed as R/Rair) ratios and/or δ13C-CO2 values. The Nyiragongo summit crater fumaroles, whose R/Rair and δ13C-CO2 values are up to 8.73 and from -3.5‰ to -4.0‰ VPDB, respectively, show a clear mantle, mid-ocean ridge basalt (MORB)-like contribution. Similar mantle-like He isotopic values (6.5-8.3 R/Rair) are also found in CO2-rich gas emanations (mazukus) along the northern shoreline of Lake Kivu main basin, whereas the 13δC-CO2 values range from -5.3‰ to -6.8‰ VPDB. The mantle influence progressively decreases in (1) dissolved gases of Lake Kivu (2.6-5.5 R/Rair) and (2) the distal gas discharges within and outside the two sides of the rift (from 0.1 to 1.7 R/Rair). Similarly, δ13C-CO2 ratios of the peripheral gas emissions are lighter (from -5.9‰ to -11.6‰ VPDB) than those of the crater fumaroles. Therefore, the spatial distribution of He and C signatures in the Lake Kivu region is mainly produced by mixing of mantle-related (e.g., Nyiragongo crater fumaroles and/or mazukus gases) and crustal-related (e

  3. He, Ne and Ar isotope compositions of fluid inclusions in hy-drothermal sulfides from the TAG hydrothermal field, Mid-Atlantic Ridge

    Institute of Scientific and Technical Information of China (English)

    ZENG; Zhigang; (

    2001-01-01

    Elderfield, H. , Schultz, A. , Mid-ocean ridge hydrothermal fluxes and the chemical composition of the ocean, Annu. Rev. Earth Planet. Sci. , 1996, 24: 191.[12]Hou, Z. Q. , Li, Y. H. , Ai, Y. D. , The helium isotopic compositions of activity hydrothermal system in the Okinawa trough?/FONT>mantle-derived helium evidence, Science in China, Ser. D, 1999, 42(2): 155.[13]Herzig, P. M. , Petersen, S. , Hannington, M D. , Geochemistry and sulfur-isotopic composition of the TAG hydrothermal mound, Mid-Atlantic Ridge, 26°N, Proc ODP, Sci. Results, 1998, 158: 47.[14]Meyer, P. S. , Bryan, W. B. , Petrology of basaltic glasses from the TAG segment: Implications for a deep hydrothermal heat source, Geophysical Research Letters, 1996, 23: 3435.[15]Thompson, G. , Humphris, S. E. , Schroeder, B. et al. , Active vents and massive sulfides at 26°N (TAG) and 23°N (Snakepit) on the Mid-Atlantic Ridge, Canadian Mineralogist, 1988, 26: 697.[16]Lalou, C. , Reyss, J. L. , Brichet, E. et al. , Hydrothermal activity on a 105-year scale at a slow-spreading ridge, TAG hydrothermal field, Mid-Atlantic ridge 26°N, Journal of Geophysical Research, 1995, 100: 17855.[17]Stuart, F. M. , Turner, G. , Mantle-derived 40Ar in mid-ocean ridge hydrothermal fluids: implications for the source of volatiles and mantle degassing rates, Chemical Geology, 1998, 147: 77.[18]Lalou, C. , Reyss, J. L. , Brichet, E. et al. , New age data for Mid-Atlantic Ridge hydrothermal sites: TAG and Snakepit chronology revisited, Journal of Geophysical Research, 1993, 98: 9705.[19]Lalou, C. , Reyss, J. L. , Brichet, E. , Age of sub-bottom sulfide samples at the TAG active mound, Proc. ODP, Sci. Results, 1998, 158: 111.[20]You, C. F. , Bickle, M. J. , Evolution of an active sea-floor massive sulphide deposit, Nature, 1998, 394: 668.[21]Kurz, M. D. , Jenkins, W. J. , Schilling, J. G. et al. , Helium isotopic variations in the mantle beneath the central North Atlantic Ocean, Earth and Planetary

  4. Natural variation of magnesium isotopes in mammal bones and teeth from two South African trophic chains

    Science.gov (United States)

    Martin, Jeremy E.; Vance, Derek; Balter, Vincent

    2014-04-01

    Isotopic fractionations accompanying element transfer through terrestrial ecosystems have the potential to shed light on ecological interactions between primary producers and consumers, but with the exception of carbon and nitrogen this potential has barely been exploited. Here, the magnesium stable isotope composition of bones and teeth of extant mammals from Kruger National Park (KNP) and Western Cape (WC), South Africa was measured for the first time. The nature of the geological substrate proves to be a major determinant of the ecosystem isotope baseline, as indicated by the lighter magnesium isotope ratios measured in WC mammals (ranging from -1.58‰ to -0.79‰) compared to those from KNP mammals (ranging from -1.01‰ to -0.04‰). Therefore, comparisons between the isotope signatures of taxa must be restricted to a pre-defined geographic area with a homogeneous substrate. In both parks, Mg shows slight enrichment in heavier isotopes from herbivores to carnivores. Plant remains trapped in the dentition of herbivores provide direct evidence of dietary source and, when available, were measured. In KNP only, δ26Mg of plant remains is systematically lighter than the values for herbivore teeth. These results invite further exploration of the variability of Mg isotopes in vertebrate ecosystems in order to test whether magnesium, a bio-essential element present in relatively large proportions in bone and teeth apatite, may serve as an additional trophic tracer to nitrogen, which is a constituent of collagen that rapidly degrades after burial.

  5. Application of nitrogen and carbon stable isotopes (δ(15N and δ(13C to quantify food chain length and trophic structure.

    Directory of Open Access Journals (Sweden)

    Matthew J Perkins

    Full Text Available Increasingly, stable isotope ratios of nitrogen (δ(15N and carbon (δ(13C are used to quantify trophic structure, though relatively few studies have tested accuracy of isotopic structural measures. For laboratory-raised and wild-collected plant-invertebrate food chains spanning four trophic levels we estimated nitrogen range (NR using δ(15N, and carbon range (CR using δ(13C, which are used to quantify food chain length and breadth of trophic resources respectively. Across a range of known food chain lengths we examined how NR and CR changed within and between food chains. Our isotopic estimates of structure are robust because they were calculated using resampling procedures that propagate variance in sample means through to quantified uncertainty in final estimates. To identify origins of uncertainty in estimates of NR and CR, we additionally examined variation in discrimination (which is change in δ(15N or δ(13C from source to consumer between trophic levels and among food chains. δ(15N discrimination showed significant enrichment, while variation in enrichment was species and system specific, ranged broadly (1.4‰ to 3.3‰, and importantly, propagated variation to subsequent estimates of NR. However, NR proved robust to such variation and distinguished food chain length well, though some overlap between longer food chains infers a need for awareness of such limitations. δ(13C discrimination was inconsistent; generally no change or small significant enrichment was observed. Consequently, estimates of CR changed little with increasing food chain length, showing the potential utility of δ(13C as a tracer of energy pathways. This study serves as a robust test of isotopic quantification of food chain structure, and given global estimates of aquatic food chains approximate four trophic levels while many food chains include invertebrates, our use of four trophic level plant-invertebrate food chains makes our findings relevant for a majority

  6. Primary production and carbon export rates across the subpolar N. Atlantic Ocean basin based on triple oxygen isotope and dissolved O2 and Ar gas measurements

    Science.gov (United States)

    Quay, P.; Stutsman, J.; Steinhoff, T.

    2012-06-01

    Gross photosynthetic O2 production (GOP) rates in the subpolar North Atlantic Ocean were estimated using the measured isotopic composition of dissolved oxygen in the surface layer on samples collected on nine transits of a container ship between Great Britain and Canada during March 2007 to June 2008. The mean basin-wide GOP rate of 226 ± 48 mmol O2 m-2 d-1 during summer was double the winter rate of 107 ± 41 mmol O2 m-2 d-1. Converting these GOP rates to equivalent 14C-based PP (14C-PPeqv) yielded rates of 1005 ± 216 and 476 ± 183 mg C m-2 d-1 in summer and winter, respectively, that generally agreed well with previous 14C-based PP estimates in the region. The 14C-PPeqv estimates were 1-1.6× concurrent satellite-based PP estimates along the cruise track. A net community production rate (NCP) of 87 ± 12 mmol O2 m-2 d-1 (62 ± 9 mmol C m-2 d-1) and NCP/GOP of 0.35 ± 0.06 in the mixed layer was estimated from O2/Ar and 17Δ measurements (61°N 26°W) during spring bloom conditions in May 2008. Contrastingly, a much lower long-term annual mean NCP or organic carbon export rate of 2.8 ± 2.7 mol C m-2 yr-1 (8 ± 7 mmol C m-2 d-1) and NCP/GOP of 0.07 ± 0.06 at the winter mixed layer depth was estimated from 15 years of surface O2 data in the subpolar N. Atlantic collected during the CARINA program.

  7. 40Ar-39Ar geochronology and thermochronology: principles and potential

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  8. Geological Dating by 40 Ar - 39 Ar method

    International Nuclear Information System (INIS)

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  9. Neutrinoless $\\beta\\beta$ decay nuclear matrix elements in an isotopic chain

    CERN Document Server

    Rodríguez, Tomás R

    2012-01-01

    We analyze nuclear matrix elements (NME) of neutrinoless double beta decay calculated for the Cadmium isotopes. Energy density functional methods including beyond mean field effects such as symmetry restoration and shape mixing are used. Strong shell effects are found associated to the underlying nuclear structure of the initial and final nuclei. Furthermore, we show that NME for two-neutrino double beta decay evaluated in the closure approximation, $M^{2\

  10. Nuclear structure studies on indium and tin isotope chains by means of laser spectroscopy

    International Nuclear Information System (INIS)

    In a collaboration with GSI in Darmstadt and ISOLDE in Geneva the hyperfine structure (HFS) and the isotope shift (IS) of the indium isotopes from 104In - 127In in their ground and isomeric states could be studied. Additionally the tin isotopes 109Sn and 111Sn could be measured. In tin the transition 5p21S0 → 5p6s 3P1 with λ = 563 nm was studied. In indium the transition 5p 2P1/2 → 6s 2S1/2 with λ = 410 nm and 5p 2P3/2 → 6s 2S1/2 with λ = 451 nm could be measured. The magnetic dipole moments and electric quadrupole moments determined from the measurements of the HFS can be sufficiently explained in the framework of the single-particle model. From the moments the configurations and spins of the studied nuclear states can be stated. In 109Sn the nuclear spin was determined to I = 5/2. The measurement of the IS in two lines in 108In allowed regarding the coupling rules for nuclear moments the determination of the nuclear spin. The spin of the 40 m isomers of the 108mIn can be stated to I = 2. The mean square nuclear charge radius exhibits a parabolic slope the quadratic part of which with a maximum in the shell center at N = 66 between the neutron numbers N = 50 and N = 82 can be understood as sum of contributions of a surface correlation, i.e. a quadrupole deformation as well as eventually present higher order terms or a change of the surface skin density. The deformation determinable by this description is both for tin and for indium essentially larger than the deformation from the B(E2) values of tin or from the intrinsic quadrupole moments in indium derived from the HFS. (orig./HSI)

  11. He, Ne and Ar isotope signatures of mid-ocean ridge basalts and their implications for upper mantle structure: A case study from the Mid-Atlantic Ridge at 4-12°S

    Science.gov (United States)

    Stroncik, Nicole A.; Niedermann, Samuel

    2016-06-01

    The geochemical structure of the upper mantle in general and its noble gas isotopic structure in particular have been the subject of countless studies, as both provide important insights into mantle dynamic processes and are essential for the formulation of mantle geodynamic models. This contribution presents a noble gas study of basaltic glasses derived from the Mid-Atlantic Ridge (MAR) between 4° and 12°S, an area well known for its high degree of lithophile isotope heterogeneity and its anomalous crustal thickness. The Sr, Nd, Pb and Hf isotopic systematics along this segment of the MAR range from strongly depleted (i.e. more depleted than N-MORB) to highly enriched. Different concepts have been proposed to explain the observed isotopic signatures. Here we show that the high degree of heterogeneity is not confined to the isotopes of the lithophile elements, but is also shown by the noble gas isotopes and noble gas interelement ratios, such as 3He/22NeM or 4He/40Ar∗. Helium isotopic ratios (3He/4He), 21Ne/22Neextra and 40Ar/36Ar range from 7.34 ± 0.06 to 9.38 ± 0.08 RA, from 0.039 ± 0.020 to 0.075 ± 0.007, and from 346 ± 5 to 37,400 ± 1300, respectively. However, the majority of the Ne isotope data are clearly aligned along a single mixing line in the Ne three-isotope diagram, represented by the equation 20Ne/22Ne = 70.5 × 21Ne/22Ne + 7.782, with a slope distinctly less than that of the MORB line. This indicates that the strongly depleted material is characterised by a significantly more nucleogenic Ne isotopic composition than the normal depleted mantle. We show, based on covariations between 3He/4He and 21Ne/22Neextra with 206Pb/204Pb and 178Hf/177Hf that the strongly depleted material erupted at this MAR segment was most likely produced by an ancient melting event. This implies that isotopic heterogeneities in the upper mantle are not solely caused by the injection of enriched materials from deep-seated mantle plumes or by crustal recycling but may

  12. Archean and proterozoic in the West-European Hercynian chain: isotopic geochemistry (Sr-Nd-Pb) and U-Pb geochronology on zircons

    International Nuclear Information System (INIS)

    The first part of this research thesis reports the study of isotopic (Sr-Nd-Pb) geochemistry and U-Pb geochronology on zircons in the immersed granulites of the Bay of Biscay: U-Pb geochronology on zircons, Nd isotopic geochemistry, Sr isotopic geochemistry, common Pb, Rb-Sr, Sm-Nd and rare earth data on minerals, comparison with other European granulites, comparison with West-Africa, study of Archean and proterozoic in the Hercynian chain. The second part reports the study of the U-Pb geochronology on zircon in the Cadomian, and the third part addresses the Sr-Nd isotopic geochemistry of some Cadomian granitoid, and the crust contamination in different regions

  13. Ars Electronica

    DEFF Research Database (Denmark)

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  14. Identification and quantification of mixed sources of oil spills based on distributions and isotope profiles of long-chain n-alkanes.

    Science.gov (United States)

    Li, Yun; Xiong, Yongqiang

    2009-12-01

    Combined with quantitative determination of concentration and isotopic composition of petroleum hydrocarbons, weathering simulation experiments on artificially mixed oils and their two end-member oils are performed for identification and quantification of mixed sources. The >C(18)n-alkanes show no appreciable losses during a short-term weathering process. An approach based on distribution of long-chain n-alkanes (>C(18)) is suggested for estimating the contribution proportion of each source in mixed oils. Stable carbon isotope profile of individual n-alkanes is a powerful tool to differentiate sources of oil spills, but unavailable to accurately allocate each contribution due to a relatively large analytical error.

  15. 甘肃拾金坡金矿床成因:来自40Ar/39Ar定年、成矿流体及H-O-S同位素证据%Ore Genesis of the Shijinpo Gold Deposit in Gansu Province, NW China:40Ar/39Ar Dating, Ore-Forming Fluid and H-O-S Isotopes Constrains

    Institute of Scientific and Technical Information of China (English)

    朱江; 吕新彪; 莫亚龙; 曹晓峰; 陈超

    2013-01-01

    , variably coexisting with minor amounts of galena, sphalerite and chalcopyrite. Laser incremental heating 40Ar/39Ar analysis of hydrothermal sericite yields a plateau age of (364. 6 ± 3) Ma (2σ) , which suggests that the gold mineralization took place in the late Devonian period. The comprehensive fluid inclusion study shows that there are three major types of fluid inclusions in the early stage: liquid-rich, gas-rich aqueous and CO2-bearing fluid inclusions, with intermediate homogenization temperature (280 - 325℃) , and low salinity (7. 86%- 9. 21% NaCl eqv). The fluid boiling is evidenced by the co-existence of three types of fluid inclusions with similar homogenization temperatures. There is only liquid-rich aqueous fluid inclusions in the late stage, with hqmogenization temperatures and salinities varying from 160℃ to 230℃ , 9. 47% to 11. 10%Nacl equivalent. Fluid pressures declined from ca. 113 MPa to ca. 11 MPa through the early stage to the late stage, and the ore-forming fluids are assumed to undergo boiling in a transitional setting (from compression to extension). Oxygen and hydrogen isotopic contents in the ore-forming fluid range from 1. 39%o to 3. 39%o and - 71%o to -99%o, respectively, suggesting that the ore-forming fluid was mainly derived from the metamorphic water, and mixed by the meteoric water in the late stage. The measured δ34 S values in sulfide minerals range from 4. 44%o to 11. 33%o. Both the Precambrian metamorphic rock and granitic wall-rock might be the sulfur sources. Based on the paper and the regional geologic data, we conclude that the Shijinpo gold deposit belongs to the orogenic-type gold deposit.

  16. Stable isotope model for assessing production of short chain fatty acids from colon-derived sugar: application in pigs.

    Science.gov (United States)

    Kien, C L; Murray, R D; Ailabouni, A; Powers, P; Kepner, J; Powers, L; Brunengraber, H

    1996-12-01

    Sugar reaching the colon because of intestinal maldigestion or malabsorption may be fermented to acetate and other short-chain fatty acids, resulting in stimulation of colonic water absorption and cell proliferation. To explore this phenomenon in more detail, we have developed a stable isotope model for estimating the fraction of colon-derived glucose or lactose that is fermented to acetate, propionate and butyrate. In an initial application of the model, [d3]-acetate and either [1-(13)C]-glucose or [D-1-(13)C]-lactose were infused into the cecum or colon of piglets, and plateau plasma acetate enrichment was monitored in the carotid artery. In acutely anesthetized piglets, the fractions of glucose and lactose fermented to acetate were 17.0 and 20.0%, respectively. In a chronically catheterized piglet, fermentation was higher (34.2%). When conducted in chronically catheterized animals or via a colostomy or ileostomy in infants, this model may be used to determine how age, previous surgery or antibiotic therapy affects the efficiency of colonic assimilation of carbohydrate. PMID:9001376

  17. Revised error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, Pieter

    2015-12-01

    The main advantage of the 40Ar/39Ar method over conventional K-Ar dating is that it does not depend on any absolute abundance or concentration measurements, but only uses the relative ratios between five isotopes of the same element -argon- which can be measured with great precision on a noble gas mass spectrometer. The relative abundances of the argon isotopes are subject to a constant sum constraint, which imposes a covariant structure on the data: the relative amount of any of the five isotopes can always be obtained from that of the other four. Thus, the 40Ar/39Ar method is a classic example of a 'compositional data problem'. In addition to the constant sum constraint, covariances are introduced by a host of other processes, including data acquisition, blank correction, detector calibration, mass fractionation, decay correction, interference correction, atmospheric argon correction, interpolation of the irradiation parameter, and age calculation. The myriad of correlated errors arising during the data reduction are best handled by casting the 40Ar/39Ar data reduction protocol in a matrix form. The completely revised workflow presented in this paper is implemented in a new software platform, Ar-Ar_Redux, which takes raw mass spectrometer data as input and generates accurate 40Ar/39Ar ages and their (co-)variances as output. Ar-Ar_Redux accounts for all sources of analytical uncertainty, including those associated with decay constants and the air ratio. Knowing the covariance matrix of the ages removes the need to consider 'internal' and 'external' uncertainties separately when calculating (weighted) mean ages. Ar-Ar_Redux is built on the same principles as its sibling program in the U-Pb community (U-Pb_Redux), thus improving the intercomparability of the two methods with tangible benefits to the accuracy of the geologic time scale. The program can be downloaded free of charge from

  18. Monzonitoid magmatism of the copper-porphyritic Lazurnoe deposit (South Primor'e): U-Pb and K-Ar geochronology and peculiarities of ore-bearing magma genesis by the data of isotopic-geochemical studies

    Science.gov (United States)

    Sakhno, V. G.; Kovalenko, S. V.; Alenicheva, A. A.

    2011-05-01

    Magmatic rocks from the copper-porphyritic Lazurnoe deposit (Central Primor'e) have been studied. It has been found that rocks from the Lazurnyi massif are referred to gabbro-monzodiorites, monzodiorites, and monzo-granodiorites formed during two magmatic phases of different ages. The earlier phase is represented by gabbro-monzodiorites and diorites of the North Stock, and the later one, by gabbro-monzodiorites and monzo-grano-diorites of the South Stock. On the basis of isotopic dating by the U-Pb (SHRIMP) method for zircon and by the K-Ar method for hornblendes and biotites, the age of magmatic rocks is determined at 110 ± 4 for the earlier phase and at 103.5 ± 1.5 for the later one. Examination of the isotopic composition for Nd, Sr, Pb, Hf, δ18O, and REE spectra has shown that melts of the first phase are contaminated with crustal rocks and they are typical for a high degree of secondary alterations. Potassiumfeldspar, biotite, propylitic alterations, and sulfidization are manifested in these rocks. The rocks of the later stage of magmatism are characteristic for a primitive composition of isotopes and the absence of secondary alterations. They carry the features of adakite specifics that allows us to consider them derivatives of mantle generation under high fluid pressure. The intrusion of fluid-saturated melts of the second phase into the magmatic source of the first phase caused both an alteration pattern of rocks and copper-porphyritic mineralization. Isotopes of sulfur and oxygen allow us to consider the ore component to be of magmatic origin.

  19. Relativistic mean field study of the properties of Z=117 nucleus and the decay chains of $^{293,294}$117 isotopes

    CERN Document Server

    Bhuyan, M

    2010-01-01

    We have calculated the binding energy, root-mean-square radius and quadrupole deformation parameter for the recently synthesized superheavy element Z=117, using the axially deformed relativistic mean field (RMF) model. The calculation is extended to various isotopes of Z=117 element, strarting from A=286 till A=310. We predict almost spherical structures in the ground state for almost all the isotopes. A shape transition appears at about A=292 from prolate to a oblate shape structures of Z=117 nucleus in our mean field approach. The most stable isotope (largest binding energy per nucleon) is found to be the $^{288}$117 nucleus. Also, the Q-value of $\\alpha$-decay $Q_\\alpha$ and the half-lives $T_{\\alpha}$ are calculated for the $\\alpha$-decay chains of $^{293}$117 and $^{294}$117, supporting the magic numbers at N=172 and/ or 184.

  20. Neogene geomorphic and climatic evolution of the central San Juan Mountains, Colorado: K/Ar age and stable isotope data on supergene alunite and jarosite from the Creede mining district

    Science.gov (United States)

    Rye, Robert O.; Bethke, Philip M.; Lanphere, Marvin A.; Steven, Thomas A.

    2000-01-01

    K/Ar age determinations or supergene alunite and jarosite, formed during Neogene weathering of the epithermal silver and base-metal ores of the Creede mining district, have been combined with geologic evidence to estimate the timing of regional uplift of the southern Rocky Mountains and related canyon cutting. In addition, oxygen and hydrogen isotopic studies suggest climate changes in the central San Juan Mountains during the past 5 m.y. Alunite [ideally (K,Na)Al3(SO4)2(OH)6] and jarosite [ideally KFe3(SO4)2(OH)6] can be dated by K/Ar or 40Ar/39Ar techniques and both contain OH and SO4 sites that enable four stable isotope analyses (δD, δ18OOH, and δ34S) to be made. This supergene alunite and jarosite formed by weathering of sulfide-rich ore bodies may record the evolution of the chemical and hydrologic processes affecting ancient oxidized acid ground water, as well as details of climate history and geomorphic evolution. Fine-grained (1-10 μm) supergene alunite and jarosite occur in minor fractures in the upper, oxidized parts of the 25 Ma sulfide-bearing veins of the Creede mining district, and jarosite also occurs in adjacent oxidized Ag-bearing clastic sediments. K/Ar ages for alunite range from 4.8 to 3.1 Ma, and for jarosite range from 2.6 to 0.9 Ma. The δD values for alunite and jarosite show opposite correlations with elevation, and values for jarosite correlate with age. Calculated δDH2O values of alunite fluids approach but are larger than those of present-day meteoric water. Calculated δDH2O values for jarosite fluids are more variable; the values of the youngest jarosites are lowest and are similar to those of present-day meteoric water in the district. The narrow δD-δ18OSO4 values of alunites reflects oxidation of sulfide below the water table. The greater range in these values for jarosites reflects oxidation of sulfide under vadose conditions. The ages of alunite mark the position of the paleo-water table at the end of a period of moderate

  1. Diversity of Anaerobic Microorganisms Involved in Long-Chain Fatty Acid Degradation in Methanogenic Sludges as Revealed by RNA-Based Stable Isotope Probing▿

    OpenAIRE

    Hatamoto, Masashi; IMACHI, HIROYUKI; Yashiro, Yuto; Ohashi, Akiyoshi; Harada, Hideki

    2007-01-01

    Long-chain fatty acid (LCFA) degradation is a key step in methanogenic treatment of wastes/wastewaters containing high concentrations of lipids. However, despite the importance of LCFA-degrading bacteria, their natural diversity is little explored due to the limited availability of isolate information and the lack of appropriate molecular markers. We therefore investigated these microbes by using RNA-based stable isotope probing. We incubated four methanogenic sludges (mesophilic sludges MP a...

  2. Properties of Z=120 nuclei and the \\alpha-decay chains of the (292,304)120 isotopes using relativistic and non-relativistic formalisms

    CERN Document Server

    Ahamad, Shakeb; Patra, S K

    2012-01-01

    The ground state and first intrinsic excited state of superheavy nuclei with Z=120 and N=160-204 are investigated using both non-relativistic Skyrme-Hartree-Fock and the axially deformed Relativistic Mean Field formalisms. We employ a simple BCS pairing approach for calculating the energy contribution from pairing interaction. The results for isotopic chain of binding energy, quadrupole deformation parameter, two neutron separation energies and some other observables are compared with the FRDM and some recent macroscopic-microscopic calculations. We predict superdeformed ground state solutions for almost all the isotopes. Considering the possibility of magic neutron number, two different mode of \\alpha-decay chains (292)120 and (304)120 are also studied within these frameworks. The Q_{\\alpha}-values and the half-life T^{\\alpha}_{1/2} for these two different mode of decay chains are compared with FRDM and recent macroscopic-microscopic calculations. The calculation is extended for the \\alpha-decay chains of 29...

  3. A refined astronomically calibrated 40Ar/39Ar age for Fish Canyon sanidine

    NARCIS (Netherlands)

    Rivera, T.A.; Storey, M.; Zeeden, C.; Hilgen, F.J.; Kuiper, K.

    2011-01-01

    Intercalibration between the astronomical and radio-isotopic dating methods provides a means to improving accuracy and reducing uncertainty of an integrated, multi-chronometer geologic timescale. Here we report a high-precision 40Ar/39Ar age for the FishCanyon sanidine (FCs) neutron fluence monitor,

  4. Analyzing sites of OH radical attack (ring vs. side chain) in oxidation of substituted benzenes via dual stable isotope analysis (δ(13)C and δ(2)H).

    Science.gov (United States)

    Zhang, Ning; Geronimo, Inacrist; Paneth, Piotr; Schindelka, Janine; Schaefer, Thomas; Herrmann, Hartmut; Vogt, Carsten; Richnow, Hans H

    2016-01-15

    OH radicals generated by the photolysis of H2O2 can degrade aromatic contaminants by either attacking the aromatic ring to form phenolic products or oxidizing the substituent. We characterized these competing pathways by analyzing the carbon and hydrogen isotope fractionation (εC and εH) of various substituted benzenes. For benzene and halobenzenes that only undergo ring addition, low values of εC (-0.7‰ to -1.0‰) were observed compared with theoretical values (-7.2‰ to -8‰), possibly owing to masking effect caused by pre-equilibrium between the substrate and OH radical preceding the rate-limiting step. In contrast, the addition of OH radicals to nitrobenzene ring showed a higher εC (-3.9‰), probably due to the lower reactivity. Xylene isomers, anisole, aniline, N,N-dimethylaniline, and benzonitrile yielded normal εH values (-2.8‰ to -29‰) indicating the occurrence of side-chain reactions, in contrast to the inverse εH (11.7‰ to 30‰) observed for ring addition due to an sp(2) to sp(3) hybridization change at the reacting carbon. Inverse εH values for toluene (14‰) and ethylbenzene (30‰) were observed despite the formation of side-chain oxidation products, suggesting that ring addition has a larger contribution to isotope fractionation. Dual element isotope slopes (∆δ(2)H/∆δ(13)C) therefore allow identification of significant degradation pathways of aromatic compounds by photochemically induced OH radicals. Issues that should be addressed in future studies include quantitative determination of the contribution of each competing pathway to the observed isotope fractionation and characterization of physical processes preceding the reaction that could affect isotope fractionation. PMID:26520272

  5. Comparison of the carbon isotope composition of total organic carbon and long-chain n-alkanes from surface soils in eastern China and their significance

    Institute of Scientific and Technical Information of China (English)

    RAO ZhiGuo; JIA GuoDong; ZHU ZhaoYu; WU Yi; ZHANG JiaWu

    2008-01-01

    Surface soil samples collected over a high spatial resolution in eastern China were analyzed for carbon isotope composition (δ13C) of total organic carbon (TOC) and higher plant-derived long-chain n-alkanes,with the latter reported as weighted mean values. The two sets of δ13C values are significantly correlated and show similar trends in spatial variation. The spatial distribution of δ13C shows less negative values in the mid-latitudes between 31°N and 40°N and more negative ones at higher and lower latitudes. This is consistent with previously reported carbon isotope data from surface soil phytoliths in the same region and suggests that the mid-latitude area provides relatively favorable growing conditions for C4 plants. Furthermore, δ13C values of both TOC and long-chain n-alkanes from 12 surface soil samples collected from a small grassland in north China displayed similar carbon isotope values and the difference between paired δ13C of a soil samples remains relatively constant. Our data demonstrate that in eastern China, soil δ13C composition of both TOC and long-chain n-alkanes is effective indicators of Ca/C4 ratios of the prevailing vegetation. This work suggests that -22‰ and -32‰ are good estimated end members for the weighted mean δ13C values of long-chain n-alkanes (C27, C29 and C31 n-alkanes) from soils under dominant C4 or C3 vegetation, allowing us to reconstruct paleovegetation trends.

  6. The Precise Radio Observation of the 13C Isotopic Fractionation for Carbon Chain Molecule HC3N in the Low-Mass Star Forming Region L1527

    Science.gov (United States)

    Araki, Mitsunori; Takano, Shuro; Sakai, Nami; Yamamoto, Satoshi; Oyama, Takahiro; Kuze, Nobuhiko; Tsukiyama, Koichi

    2016-06-01

    We observed the three 13C isotopic species of HC3N with the high signal-to-noise ratios in L1527 using Green Bank 100 m telescope and Nobeyama 45 m telescope to explore the production scheme of HC3N, where L1527 is the low-mass star forming region in the phase of a warm carbon chain chemistry region. The spectral lines of the J = 5--4, 9--8, 10--9, and 12--11 transitions in the 44-109 GHz region were used to measure isotopic ratios. The abundance of HCCCN was determined from the line intensities of the two weak hyperfine components of the J = 5-4 transition. The isotopic ratios were precisely determined to be 1.00 : 1.01 : 1.35 : 86.4 for [H13CCCN] : [HC13CCN] : [HCC13CN] : [HCCCN]. It was found that the abundance of H13CCCN is equal to that of HC13CCN, and it was implied that HC3N is mainly formed by the reaction schemes via C2H2 and C2H2+ in L1527. This would suggest a universality of dicarbide chemistry producing HC3N irrespective of evolutional phases from a starless dark cloud to a warm carbon chain chemistry region. Sakai, N., Sakai, T., Hirota, T., & Yamamoto, S. 2008, ApJ, 672, 371 Takano, S., Masuda, A., Hirahara, Y., et al. 1998, A&A, 329, 1156

  7. Sensitivity of stellar electron-capture rates to parent neutron number: A case study on a continuous chain of twenty Vanadium isotopes

    CERN Document Server

    Hitt, G W; Zegers, R G T; Titus, R; Sullivan, C; Brown, B A; Cole, A L; Shams, S

    2016-01-01

    Gamow-Teller (GT) strength distributions (B(GT)) in electron-capture (EC) daughters stemming from the parent ground state are computed with the shell-model in the full pf-shell space, with quasi-particle random-phase approximation (QRPA) in the formalism of Krumlinde and M\\"oller and with an Approximate Method (AM) for assigning an effective B(GT). These are compared to data available from decay and charge-exchange (CE) experiments across titanium isotopes in the pf-shell from A=43 to A=62, the largest set available for any chain of isotopes in the pf-shell. The present study is the first to examine B(GT) and the associated EC rates across a particular chain of isotopes with the purpose of examining rate sensitivities as neutron number increases. EC rates are also computed for a wide variety of stellar electron densities and temperatures providing concise estimates of the relative size of rate sensitivities for particular astrophysical scenarios. This work underscores the astrophysical motivation for CE exper...

  8. Asynchronous evolution of the isotopic composition and amount of precipitation in north China during the Holocene revealed by a record of compound-specific carbon and hydrogen isotopes of long-chain n-alkanes from an alpine lake

    Science.gov (United States)

    Rao, Zhiguo; Jia, Guodong; Li, Yunxia; Chen, Jianhui; Xu, Qinghai; Chen, Fahu

    2016-07-01

    Both the timing of the maximum East Asian summer monsoon (EASM) intensity in monsoonal China and the environmental significance of the Chinese stalagmite oxygen isotopic record (δ18O) have been debated. Here, we present a ca. 120-year-resolution compound-specific carbon (δ13C) and hydrogen (δD) isotopes of terrestrial long-chain n-alkanes extracted from a well-dated sediment core from an alpine lake in north China. Our δ13C data, together with previously reported pollen data from a parallel core, demonstrate a humid mid-Holocene from ca. 8-5 ka BP. Assuming that the climatic humidity of north China is an indicator of the EASM intensity, then the maximum EASM intensity occurred in the mid-Holocene. Our δD data reveal a similar long-term trend to the δ18O record from nearby Lianhua Cave, indicating that the synchronous δD and δ18O records faithfully record the δD and δ18O of precipitation, respectively. The most negative δD and δ18O values occur in the early-mid Holocene, from ca. 11-5 ka BP. This contrast in the timing of isotopic variations demonstrates a complex relationship between the isotopic composition of precipitation and precipitation amount, or EASM intensity. Further comparisons indicate a possible linkage between the precipitation amount in north China and the west-east thermal gradient in the equatorial Pacific. In addition, the temperature of the moisture source area may play an important role in determining the isotopic composition of precipitation in monsoonal China.

  9. Efficient synthesis of D-branched-chain amino acids and their labeled compounds with stable isotopes using D-amino acid dehydrogenase.

    Science.gov (United States)

    Akita, Hironaga; Suzuki, Hirokazu; Doi, Katsumi; Ohshima, Toshihisa

    2014-02-01

    D-Branched-chain amino acids (D-BCAAs) such as D-leucine, D-isoleucine, and D-valine are known to be peptide antibiotic intermediates and to exhibit a variety of bioactivities. Consequently, much effort is going into achieving simple stereospecific synthesis of D-BCAAs, especially analogs labeled with stable isotopes. Up to now, however, no effective method has been reported. Here, we report the establishment of an efficient system for enantioselective synthesis of D-BCAAs and production of D-BCAAs labeled with stable isotopes. This system is based on two thermostable enzymes: D-amino acid dehydrogenase, catalyzing NADPH-dependent enantioselective amination of 2-oxo acids to produce the corresponding D-amino acids, and glucose dehydrogenase, catalyzing NADPH regeneration from NADP(+) and D-glucose. After incubation with the enzymes for 2 h at 65°C and pH 10.5, 2-oxo-4-methylvaleric acid was converted to D-leucine with an excellent yield (>99 %) and optical purity (>99 %). Using this system, we produced five different D-BCAAs labeled with stable isotopes: D-[1-(13)C,(15)N]leucine, D-[1-(13)C]leucine, D-[(15)N]leucine, D-[(15)N]isoleucine, and D-[(15)N]valine. The structure of each labeled D-amino acid was confirmed using time-of-flight mass spectrometry and nuclear magnetic resonance analysis. These analyses confirmed that the developed system was highly useful for production of D-BCAAs labeled with stable isotopes, making this the first reported enzymatic production of D-BCAAs labeled with stable isotopes. Our findings facilitate tracer studies investigating D-BCAAs and their derivatives. PMID:23661083

  10. 云南金平白马寨铜镍(铂族)矿床地质特征、Ar-Ar定年及矿床成因研究%Characteristics, Ar-Ar Isotopic Dating and Ore Genesis of the Baimazhai Cu-Ni(PGE) Deposits, Yunnan

    Institute of Scientific and Technical Information of China (English)

    谭木昌; 念红; 张学书; 秦德先; 范柱国; Franco Pirajno

    2012-01-01

    白马寨镍铜(铂族)硫化物矿床赋存于二叠纪峨眉山大火成岩省内的基性-超基性侵入岩体之中.矿床地质特征表明矿床可能遭受了二叠纪后的区域构造及热事件的改造作用,这些特征主要有:含矿岩体中部分硫化物与热液蚀变矿物如黑云母、蚀变成因角闪石和绿泥石等紧密共生;硫化矿石相对富集Cu、Pd和Au;含矿岩石的Ar-Ar法同位素坪年龄值为160~170Ma,晚于峨眉山大火成岩省的年龄等.本文提出了两种可能的改造成矿模式:①后期热液沿变形的块状硫化矿的角砾化边缘带入,对原生矿石、岩石产生改造作用形成新的硫化物;②块状-浸染状原生矿石产生变形时,热液流体优先渗入到浸染状矿石中,从而对原生矿石产生改造作用.%The Baimazhai Cu-Ni(PGE) sulphide deposit in the southeast Yunnan Province occurs in mafic-ultramafic rock swarms of Permian Emeishan large igneous provinces. The deposit is a hydrothermal modified deposit with geological and petrologic characteristics and microscopic determination. The genesis of the ore-bearing mafic-ultramaf-ic intrusions is dispersive hydrothermal reworking. Sulphides are associated with the hydrothermal altered minerals, such as biotite, amphiboles and chlorites, showing that the sulphide ores have suffered deformed and hydro-thermal alteration and have become disseminated and brecciated ores. The sulphide ores have higher Cu, Pd and Au than ores elsewhere, indicating that the ores has been affected by hydrothermal alteration. The Ar-Ar age of the ore and ore-bearing rocks (160?70 Ma) shows that the Baimazhai intrusions have been reworked by a regional tectonic thermal event in the Jurassic period. Based on the reworked strength, this paper proposes two possible metallogenic models.

  11. GC/MS method for determining carbon isotope enrichment and concentration of underivatized short-chain fatty acids by direct aqueous solution injection of biogas digester samples.

    Science.gov (United States)

    Mulat, Daniel Girma; Feilberg, Anders

    2015-10-01

    In anaerobic digestion of organic matter, several metabolic pathways are involved during the simultaneous production and consumption of short-chain fatty acids (SCFA) in general and acetate in particular. Understanding the role of each pathway requires both the determination of the concentration and isotope enrichment of intermediates in conjunction with isotope labeled substrates. The objective of this study was to establish a rapid and simple GC/MS method for determining the isotope enrichment of acetate and concentration of underivatized short-chain fatty acids (SCFA) in biogas digester samples by direct liquid injection of acidified aqueous samples. Sample preparation involves only acidification, centrifugation and filtration of the aqueous solution followed by direct injection of the aqueous supernatant solution onto a polar column. With the sample preparation and GC/MS conditions employed, well-resolved and sharp peaks of underivatized SCFA were obtained in a reasonably short time. Good recovery (96.6-102.3%) as well as low detection (4-7 µmol/L) and quantification limits (14-22 µmol/L) were obtained for all the 6 SCFA studied. Good linearity was achieved for both concentration and isotope enrichment measurement with regression coefficients higher than 0.9978 and 0.9996, respectively. The method has a good intra- and inter-day precision with a relative standard deviation (RSD) below 6% for determining the tracer-to-tracee ratio (TTR) of both [2-(13)C]acetate and [U-(13)C]acetate. It has also a good intra- and inter-day precision with a RSD below 6% and 5% for determining the concentration of standard solution and biogas digester samples, respectively. Acidification of biogas digester samples with oxalic acid provided the low pH required for the protonation of SCFA and thus, allows the extraction of SCFA from the complex sample matrix. Moreover, oxalic acid was the source of formic acid which was produced in the injector set at high temperature. The produced

  12. 40Ar/39Ar dating of Daqingshan thrust

    Institute of Scientific and Technical Information of China (English)

    LIU Zhenghong; XU Zhongyuan; YANG Zhensheng

    2003-01-01

    The Daqingshan thrust system, to the south of the Shiguai Mesozoic basin, is a complex system of top-to- the-north thrusting tectonic sheets. The thrust system has a complicated evolution due to multi-stage thrusting. In order to date the thrusting events, syntectonic muscovite and biotite grains are respectively analyzed with normal 40Ar/39Ar dating and laser 40Ar/39Ar dating, which yield 2 isochron ages, i.e. 193.74 ± 3.88 Ma and 121.6 ± 1.6 Ma. These ages suggest that faults within the Daqingshan thrust system formed during 2 stages of thrusting, one the early Indosinian and the other the late Yanshanian. The isotopic dating is consistent with field geological relations. Indosinan deformation is evidenced by top-to-the-north thrusting, with the occurrence of a series of large-scale east-west trending thrust faults and folds, while the Yanshanian thrusting is characterized by top-to-the-NNW thrusting. It is superposed on and modifies early Indosinian thrust faults.

  13. Compound-specific carbon isotope compositions of individual long-chain n-alkanes in severe Asian dust episodes in the North China coast in 2002

    Institute of Scientific and Technical Information of China (English)

    GUO Zhigang; LI Juyuan; FENG Jialiang; FANG Ming; YANG Zuosheng

    2006-01-01

    The molecular compositions and compound-specific carbon isotope compositions of individual long-chain n-alkanes of atmospheric aerosols collected during two severe Asian dust episodes in Qingdao in spring of 2002 were analyzed using gas chromatography/mass spectrometry (GC/MS) and gas chromatography/isotope ratio mass spectrometry (GC/IRMS). Typical plant wax n-alkanes (C29 and C31) had lowerδ13C values than those from anthropogenic (engine exhaust) sources (C21―C23). The average δ13C value of plant wax n-alkane C29 in non-dust episode periods was -30.5‰ (-30.3‰― -31.9‰), while -31.3‰ (-31.1‰―-31.5‰) in dust episode periods; for C31, it was -31.4‰ (-31.1‰―-33.0‰) in non-dust episode periods, and -31.7‰ (-31.3‰―-32.6‰) in dust episode periods. Plant wax in the dust episode samples was mainly from herbaceous plants via long-range transport, while local plant wax was mainly from deciduous plants and woody plants. In North China coast, 83.3% of the plant wax in the severe dust episode samples was from C3 plants while 80.0% for the non-dust samples, indicating that plant wax transported to the northwestern Pacific Ocean by airborne dust from East Asia was mainly from C3 plants. The results suggest that the molecular and molecular-isotopic compositions of individual long-chain n-alkanes can, as an effective indicator, identify the terrestrial organic components in the dust from East Asia and sediments in the northwest Pacific Ocean.

  14. Behavior of argon gas release from manganese oxide minerals as revealed by 40Ar/39Ar laser incremental heating analysis

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Manganese oxides in association with paleo- weathering may provide significant insights into the multiple factors affecting the formation and evolution of weathering profiles, such as temperature, precipitation, and biodiversity. Laser probe step-heating analysis of supergene hollandite and cryptomelane samples collected from central Queensland, Australia, yield well-defined plateaus andconsistent isochron ages, confirming the feasibility dating very-fined supergene manganese oxides by 40Ar/39Ar technique. Two distinct structural sites hostingAr isotopes can be identified in light of their degassing behaviors obtained byincremental heating analyses. The first site, releasing its gas fraction at thelaser power 0.2-0.4 W, yields primarily 40Aratm, 38Aratm, and 36Aratm (atmospheric Ar isotopes). The second sites yield predominantly 40Ar* (radiogenic 40Ar),39ArK, and 38ArK (nucleogenic components), at ~0.5-1.0 W. There is no significant Ar gas released at the laser power higher than 1.0 W, indicating the breakdown of the tunnel sites hosting the radiogenic and nucleogenic components. The excellent match between the degassing behaviors of 40Ar*, 39ArK, and 38ArK suggests that these isotopes occupy the same crystallographic sites and that 39ArK lossfrom the tunnel site by recoil during neutron irradiation and/or bake-out procedure preceding isotopic analysis does not occur. Present investigation supports that neither the overwhelming atmospheric 40Ar nor the very-fined nature of the supergene manganese oxides poses problems in extracting meaningful weathering geochronological information by analyzing supergene manganese oxides minerals.

  15. An isotope-labeled chemical derivatization method for the quantitation of short-chain fatty acids in human feces by liquid chromatography–tandem mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Han, Jun; Lin, Karen; Sequeira, Carita [University of Victoria – Genome BC Proteomics Centre, University of Victoria, Vancouver Island Technology Park, 3101–4464 Markham Street, Victoria, BC V8Z 7X8 (Canada); Borchers, Christoph H., E-mail: christoph@proteincentre.com [University of Victoria – Genome BC Proteomics Centre, University of Victoria, Vancouver Island Technology Park, 3101–4464 Markham Street, Victoria, BC V8Z 7X8 (Canada); Department of Biochemistry and Microbiology, University of Victoria, Petch Building Room 207, 3800 Finnerty Road, Victoria, BC V8P 5C2 (Canada)

    2015-01-07

    Highlights: • 3-Nitrophenylhydrazine was used to derivatize short-chain fatty acids (SCFAs) for LC-MS/MS. • {sup 13}C{sub 6} analogues were produced for use as isotope-labeled internal standards. • Isotope-labeled standards compensate for ESI matrix effects in LC-MS/MS. • Femtomolar sensitivities and 93–108% quantitation accuracy were achieved for human fecal SCFAs. - Abstract: Short-chain fatty acids (SCFAs) are produced by anaerobic gut microbiota in the large bowel. Qualitative and quantitative measurements of SCFAs in the intestinal tract and the fecal samples are important to understand the complex interplay between diet, gut microbiota and host metabolism homeostasis. To develop a new LC-MS/MS method for sensitive and reliable analysis of SCFAs in human fecal samples, 3-nitrophenylhydrazine (3NPH) was employed for pre-analytical derivatization to convert ten C{sub 2}–C{sub 6} SCFAs to their 3-nitrophenylhydrazones under a single set of optimized reaction conditions and without the need of reaction quenching. The derivatives showed excellent in-solution chemical stability. They were separated on a reversed-phase C{sub 18} column and quantitated by negative-ion electrospray ionization – multiple-reaction monitoring (MRM)/MS. To achieve accurate quantitation, the stable isotope-labeled versions of the derivatives were synthesized in a single reaction vessel from {sup 13}C{sub 6}-3NPH, and were used as internal standard to compensate for the matrix effects in ESI. Method validation showed on-column limits of detection and quantitation over the range from low to high femtomoles for the ten SCFAs, and the intra-day and inter-day precision for determination of nine of the ten SCFAs in human fecal samples was ≤8.8% (n = 6). The quantitation accuracy ranged from 93.1% to 108.4% (CVs ≤ 4.6%, n = 6). This method was used to determine the SCFA concentrations and compositions in six human fecal samples. One of the six samples, which was collected from a

  16. An isotope-labeled chemical derivatization method for the quantitation of short-chain fatty acids in human feces by liquid chromatography–tandem mass spectrometry

    International Nuclear Information System (INIS)

    Highlights: • 3-Nitrophenylhydrazine was used to derivatize short-chain fatty acids (SCFAs) for LC-MS/MS. • 13C6 analogues were produced for use as isotope-labeled internal standards. • Isotope-labeled standards compensate for ESI matrix effects in LC-MS/MS. • Femtomolar sensitivities and 93–108% quantitation accuracy were achieved for human fecal SCFAs. - Abstract: Short-chain fatty acids (SCFAs) are produced by anaerobic gut microbiota in the large bowel. Qualitative and quantitative measurements of SCFAs in the intestinal tract and the fecal samples are important to understand the complex interplay between diet, gut microbiota and host metabolism homeostasis. To develop a new LC-MS/MS method for sensitive and reliable analysis of SCFAs in human fecal samples, 3-nitrophenylhydrazine (3NPH) was employed for pre-analytical derivatization to convert ten C2–C6 SCFAs to their 3-nitrophenylhydrazones under a single set of optimized reaction conditions and without the need of reaction quenching. The derivatives showed excellent in-solution chemical stability. They were separated on a reversed-phase C18 column and quantitated by negative-ion electrospray ionization – multiple-reaction monitoring (MRM)/MS. To achieve accurate quantitation, the stable isotope-labeled versions of the derivatives were synthesized in a single reaction vessel from 13C6-3NPH, and were used as internal standard to compensate for the matrix effects in ESI. Method validation showed on-column limits of detection and quantitation over the range from low to high femtomoles for the ten SCFAs, and the intra-day and inter-day precision for determination of nine of the ten SCFAs in human fecal samples was ≤8.8% (n = 6). The quantitation accuracy ranged from 93.1% to 108.4% (CVs ≤ 4.6%, n = 6). This method was used to determine the SCFA concentrations and compositions in six human fecal samples. One of the six samples, which was collected from a clinically diagnosed type 2 diabetes

  17. GEOCHRONOMETRY ISOTOPE GEOLOGY

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    <正>20040631 Chen Jiangfeng (School of Earth and Space Sciences, University of Science and Technology of China, Hefei, Anhui) ; Xie Zhi Relationships Between Rb-Sr, Ar - Ar Geochronometers and Oxygen Isotopic Equilibrium of Intrusions from Eastern Anhui Province, China (Geological Journal of China Universities, ISSN 1006 - 7493, CN 32 -

  18. 15N isotope fractionation in an aquatic food chain: Bellamya aeruginosa (Reeve) as an algal control agent.

    Science.gov (United States)

    Han, Shiqun; Yan, Shaohua; Chen, Kaining; Zhang, Zhenhua; Zed, Rengel; Zhang, Jianqiu; Song, Wei; Liu, Haiqin

    2010-01-01

    15N isotope tracer techniques and ecological modeling were adopted to investigate the fractionation of nitrogen, its uptake and transformation in algae and snail (Bellamya aeruginosa Reeve). Different algal species were found to differ in their uptake of nitrogen isotopes. Microcystis aeruginisa Kütz. demonstrated the greatest 15N accumulation capacity, with the natural variation in isotopic ratio (delta 15N) and the isotope fractionation factor (epsilon, % per hundred) being the highest among the species investigated. The transformation and utilization of 15N by snails differed depending on the specific algae consumed (highest for Chlorella pyrenoidosa Chick., lowest for M. aeruginisa). When snails was seeded in the experimental pond, the algae population structure changed significantly, and total algal biomass as well as the concentration of all nitrogen species decreased, causing an increase in water transparency. A model, incorporating several chemical and biological parameters, was developed to predict algal biomass in an aquatic system when snails was present. The data collected during this investigation indicated that the gastropods such as snails could significantly impact biological community and water quality of small water bodies, suggesting a role for biological control of noxious algal blooms associated with eutrophication. PMID:20397413

  19. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    International Nuclear Information System (INIS)

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  20. Geogenic lead isotope signatures from meat products in Great Britain: Potential for use in food authentication and supply chain traceability.

    Science.gov (United States)

    Evans, Jane A; Pashley, Vanessa; Richards, Gemma J; Brereton, Nicola; Knowles, Toby G

    2015-12-15

    This paper presents lead (Pb) isotope data from samples of farm livestock raised in three areas of Britain that have elevated natural Pb levels: Central Wales, the Mendips and the Derbyshire Peak District. This study highlights three important observations; that the Pb found in modern British meat from these three areas is geogenic and shows no clear evidence of modern tetraethyl anthropogenic Pb contribution; that the generally excellent match between the biological samples and the ore field data, particularly for the Mendip and Welsh data, suggests that this technique might be used to provenance biological products to specific ore sites, under favourable conditions; and that modern systems reflect the same process of biosphere averaging that is analogous to cultural focusing in human archaeological studies that is the process of biological averaging leading to an homogenised isotope signature with increasing Pb concentration. PMID:26282777

  1. ``Smoking From The Same Pipe": Developement of an 40Ar/39Ar Datting Intercalibration PIpette System (Invited)

    Science.gov (United States)

    Turrin, B. D.; Swisher, C. C.; Deino, A.; Hemming, S. R.; Hodges, K.; Renne, P. R.

    2010-12-01

    The precision and accuracy of Ar isotope ratio measurements is one of the main limiting factors in the uncertainties of an 40Ar/39Ar age. Currently, it is relatively common to measure Ar isotopic ratios to a precision of 1-2‰ or better on an intralaboratory basis. This level of analytical precision equates to a comparable level of precision (1-3‰) in the calculated age, depending on the extent of atmospheric Ar contamination, importance of nucleogenic interference corrections, and other factors. However, it has become clear that improving the precision of mass spectrometry is not the only bottleneck towards improving the accuracy and precision of 40Ar/39Ar dating in general. Rather, the most urgent issue is interlaboratory reproducibility. This became obvious in a recent EARTHTIME initiative undertaken to intercalibrate two commonly used 40Ar/39Ar standards [the Fish Canyon sanidine (FCs) and the Alder Creek sanidine (ACs)]. This effort revealed variations amongst laboratories (at the 1-2% level), an order of magnitude greater than the internal analytical precisions. To address these issues, we have proposed (to NSF) to construct two identical pipette systems loaded to identical starting pressures and with identical isotopic compositions. One pipette system will travel between participating 40Ar/39Ar labs and the second system will not travel and serve as the “Master” system to test for any fractionation or undocumented depletion of the traveling pipette system. In order to ensure delivery of uniform amounts of homogenous gas, the pipette system will be computer-controlled with preprogrammed routines and lockouts to prevent compromising the reservoirs. The pipette systems will deliver three gas samples with different isotopic ratios at two different pressures/concentrations. One pipette bulb will be of atmospheric isotopic composition, and the other two pipette bulbs will have 40Ar*/39ArK ratios corresponding to co-irradiated ACs and FCs fixed by their

  2. Proton scattering from unstable nuclei 20O, 30S, 34Ar: experimental study and models

    International Nuclear Information System (INIS)

    Elastic and inelastic proton scattering from the unstable nuclei 20O, 30S and 34Ar were measured in inverse kinematics at the Grand Accelerateur National d'Ions Lourds. Secondary beams of 20O at 43 MeV/A, 30S at 53 MeV/A and 34Ar at 47 MeV/A impinged on a (CH2)n target. Recoiling protons were detected in the silicon strip array MUST. Energies and angular distributions of the first 2+ and 3- states were measured. A phenomenological analysis yields values of the deformation parameters β2 and β3 of 0.55 (6) and 0.35 (5) for 20O, 0.32 (3) and 0.22 (4) for 30S, 0.27 (2) and 0.39 (3) for 34Ar, respectively, and allows the extraction of the ratio of neutron to proton transition matrix elements (Mn/Mp)/(N/Z) for 2+ states: 2.35 (37) for 20O, 0.93 (20) for 30S and 1.35 (28) for 34Ar. Therefore the proton rich nuclei 30S and 34Ar show a 2+ excitation of isoscalar character whereas the excitation of 20O is of isovector character. In order to perform a microscopic analysis of the data, we have developed a QRPA model, using three Skyrme interaction: SIII, SG2, SLy4. This model reproduces measured B(EL) values for the oxygen, sulfur and argon isotopic chains, whereas RPA calculations, which do not take pairing into account, underestimate these values. In the case of the QRPA model the energies of the first 2+ state are overestimated by about 1 MeV, but the evolution along the isotopic chains is well reproduced. (Mn/Mp)/(N/Z) ratios for the first 2+ state deduced from the microscopic analysis using QRPA are 1.98 for 20O, 1.05 for 30S and 1.00 for 34Ar, in agreement with the conclusions of the phenomenological analysis. However important discrepancies are observed between the two types of analysis for other isotopes, in particular neutron rich argon and sulfur nuclei. (author)

  3. Chain-Length Distribution and Hydrogen Isotopic Fraction of n-alkyl Lipids in Aquatic and Terrestrial Plants: Implications for Paleoclimate Reconstructions

    Science.gov (United States)

    Gao, L.; Littlejohn, S.; Hou, J.; Toney, J.; Huang, Y.

    2008-12-01

    Recent studies demonstrate that in lacustrine sediments, aquatic plant lipids (e.g., C22-fatty acid) record lake water D/H ratio variation, while long-chain fatty acids (C26-C32, major components of terrestrial plant leaf waxes), record D/H ratios of precipitation (especially in arid regions). However, there are insufficient literature data for the distribution and hydrogen isotopic fractionation of n-alkyl lipids in aquatic and terrestrial plants. In this study, we determined the chain-length distributions and D/H ratios of n-alkyl lipids from 17 aquatic plant species (9 emergent, 4 floating and 4 submerge species) and 13 terrestrial plant species (7 grasses and 6 trees) from Blood Pond, Massachusetts. Our results are consistent with previous studies and provide a solid basis for the paleoclimatic reconstruction using D/H ratios of aquatic and terrestrial plant biomarkers. In addition, systematic hydrogen isotopic analyses on leaf waxes, leaf, stem and soil waters from trees and grasses significantly advance our understanding of our previously observed large D/H ratio difference between tree and grass leaf waxes. Our data indicate that the observed difference is not due to differences in leaf water D/H ratios. In comparison with grasses, trees use greater proportion of D-enriched residual or stored carbohydrates (as opposed to current photosynthetic carbohydrates) for leaf wax biosynthesis, resulting in higher leaf wax D/H ratios. The residual carbohydrates are enriched in deuterium because of the preferential consumption of light-hydrogen substrates during plant metabolism.

  4. [Effects of anthropogenic organic matter inputs on stable carbon and nitrogen isotopes in organisms from microbial food chain in Taihu Lake].

    Science.gov (United States)

    Zeng, Qing-Fei; Kong, Fan-Xiang; Zhang, En-Lou; Tan, Xiao

    2007-08-01

    Stable isotope analyses of carbon and nitrogen were used to evaluate autochthonous versus allochthonous contribution to the main microbial food loop components in the four sampling sites based on different trophic status in Taihu Lake. On average, the delta13 C and delta15 N values of organic matter (OM) sources (bacteria, cladocera, particulate and sedimentary organic matter) and the delta13 C of dissolved inorganic carbon (DIC), which are the main components in microbial food chain, showed the lowest values at estuary location compared with the other three sites, reflecting a strong influence by terrestrially derived nutrients and organic matter. The mean delta13 C value of dissolved organic matter (DOM) that we measured was close to the estimated terrestrial delta13 C - 26 per thousandd, suggesting an allochthonous-derived organic C pool. Particulate organic matter (POM) was supposed to be mainly dominated by algae under the assumption of a constant fractionation from DIC to phytoplankton of 22 per thousand. Cladocera had a lower delta13 C than the average delta13 C of POM (0.2 per thousand) and bacteria (2.5 per thousand), supposing a lipid accumulation or selective feeding a more delta13 C-depleted algal fraction (pico- and nano-plankton, isotopes can help to elucidate sources and sinks of organic matter in Taihu Lake, which are characterized by a great spatial variability and complexity. PMID:17926391

  5. Laser spectroscopic studies along the Al isotopic chain and the isomer-shift of the self-conjugate 26Al nucleus

    CERN Multimedia

    We propose to measure the isomer shift in the self-conjugate $^{26}$Al ($\\textit{N = Z}$ = 13) nucleus along with the isotope shifts of $^{24-33}$Al using bunched-beam collinear laser spectroscopy at the COLLAPS beam line at ISOLDE. These isomer and isotope shifts allow the extraction of precise mean-square charge radii, in particular the dierence in charge radius between the $\\textit{I}$ = 5$^{+}$; $\\textit{T}$ = 0 ground state and $\\textit{I}$= 0$^{+}$;$\\textit{T}$= 1 isomer in $^{26}$Al. This charge radius dierence, in comparison with the odd-even staggering in the Al-chain, is an excellent probe to study proton-neutron pairing correlations, as was previously illustrated for $\\overset{38}{19}$K$_{19}$ [1]. Furthermore, accurate knowledge of the mean-square charge radius in $^{26m}$Al is essential to reliably calculate its isospin-symmetry breaking correction which is important to extract the CKM matrix element V$_{ud}$ from the 0$^{+}$ $\\rightarrow$ 0$^{+}$ superallowed $\\beta$-decay data. Finally, the ch...

  6. Decay properties of 68,69,70Mn: Probing collectivity up to N=44 in Fe isotopic chain

    Directory of Open Access Journals (Sweden)

    G. Benzoni

    2015-12-01

    Full Text Available The β decays Mn68→Fe68, Mn69→Fe69 and Mn70→Fe70 have been measured at the RIBF facility at RIKEN using the EURICA γ spectrometer combined with an active stopper consisting of a stack of Si detectors. The nuclei were produced as fission fragments from a beam of 238U at a bombarding energy of 345 MeV/nucleon impinging on a Be target and selected using the BigRIPS separator. Half-lives and β-delayed neutron emission probabilities have been extracted for these decays, together with first experimental information on excited states populated in 69,70Fe. The data indicate a continuously increasing deformation for Fe isotopes up to A=70. This is interpreted, as for Cr isotopes, in terms of the interplay between the quadrupole correlations of the ν1d5/2 and ν0g9/2 orbitals and the monopole component of the π0f7/2–ν0f5/2 interaction.

  7. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    Institute of Scientific and Technical Information of China (English)

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  8. Proton scattering from unstable nuclei {sup 20}O, {sup 30}S, {sup 34}Ar: experimental study and models; Diffusion de protons sur les noyaux instables {sup 20}O, {sup 30}S, {sup 34}Ar: etude experimentale et developpement de modeles

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Elias [Institut de Physique Nucleaire, CNRS - IN2P3, Universite Paris - Sud, 91406 Orsay Cedex (France)

    2000-01-28

    Elastic and inelastic proton scattering from the unstable nuclei {sup 20}O, {sup 30}S and {sup 34}Ar were measured in inverse kinematics at the Grand Accelerateur National d'Ions Lourds. Secondary beams of {sup 20}O at 43 MeV/A, {sup 30}S at 53 MeV/A and {sup 34}Ar at 47 MeV/A impinged on a (CH{sub 2}){sub n} target. Recoiling protons were detected in the silicon strip array MUST. Energies and angular distributions of the first 2{sup +} and 3{sup -} states were measured. A phenomenological analysis yields values of the deformation parameters {beta}{sub 2} and {beta}{sub 3} of 0.55 (6) and 0.35 (5) for {sup 20}O, 0.32 (3) and 0.22 (4) for {sup 30}S, 0.27 (2) and 0.39 (3) for {sup 34}Ar, respectively, and allows the extraction of the ratio of neutron to proton transition matrix elements (M{sub n}/M{sub p})/(N/Z) for 2{sup +} states: 2.35 (37) for {sup 20}O, 0.93 (20) for {sup 30}S and 1.35 (28) for {sup 34}Ar. Therefore the proton rich nuclei {sup 30}S and {sup 34}Ar show a 2{sup +} excitation of isoscalar character whereas the excitation of {sup 20}O is of isovector character. In order to perform a microscopic analysis of the data, we have developed a QRPA model, using three Skyrme interaction: SIII, SG2, SLy4. This model reproduces measured B(EL) values for the oxygen, sulfur and argon isotopic chains, whereas RPA calculations, which do not take pairing into account, underestimate these values. In the case of the QRPA model the energies of the first 2{sup +} state are overestimated by about 1 MeV, but the evolution along the isotopic chains is well reproduced. (M{sub n}/M{sub p})/(N/Z) ratios for the first 2{sup +} state deduced from the microscopic analysis using QRPA are 1.98 for {sup 20}O, 1.05 for {sup 30}S and 1.00 for {sup 34}Ar, in agreement with the conclusions of the phenomenological analysis. However important discrepancies are observed between the two types of analysis for other isotopes, in particular neutron rich argon and sulfur nuclei. (author)

  9. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    International Nuclear Information System (INIS)

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  10. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    International Nuclear Information System (INIS)

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  11. Modification of stearic acid in Ar and Ar-O{sub 2} pulsed DC discharges

    Energy Technology Data Exchange (ETDEWEB)

    Bernardelli, E.A.; Souza, T.; Maliska, A.M.; Kleinjohann, K.J.; Bendo, T. [Federal University of Santa Catarina (UFSC), Florianopolis, SC (Brazil); Mafra, M. [Nancy-Universite (France). Institut Jean Lamour; CNRS, Nancy (France); Belmonte, T. [Federal University of Technology from Parana (UTFPR), Curitiba, PR (Brazil)

    2010-07-01

    Stearic acid (C{sub 1}8H{sub 36}O{sub 2}) was treated into Ar and Ar-O{sub 2}(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O{sub 2} plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O{sub 2} in all states) strongly enhance the etching process with regards to A{sup *} species, regardless of their concentration. After treatment by Ar and Ar-O{sub 2} plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O{sub 2} plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  12. High-precision 40Ar/39Ar Age of the Janisjärvi Impact Structure (Russia)

    Science.gov (United States)

    Jourdan, F.; Renne, P. R.; Reimold, U. W.

    2007-12-01

    The ~14 km Jänisjärvi impact structure occurs within the Svecofennian Proterozoic terrains, in the southeastern part of the Baltic shield, Karelia, Russia. Previous K/Ar and 40Ar/39Ar studies were interpreted to give ages of 700 ± 5 Ma and 698 ± 22 Ma respectively, both results being difficult to interpret. Recent paleomagnetic results challenged those ages and propose instead ages of either 500 Ma or 850-900 Ma. In order to better constrain the age of the Jänisjärvi impact structure, we present new 40Ar/39Ar data for melt rocks from the crater. We obtained five concordant isochron ages (based on a total decay constant of 5.543 x 10-10/y and an age of 28.03 Ma for the FCs standard) that yield a combined isochron age of 682 ± 4 Ma (2 sigma) with a MSWD of 1.2, P = 0.14 and 40Ar/36Ar intercept of 475 ± 3. We suggest that this date indicates the age of the impact and therefore can be used in conjunction with existing paleomagnetic results to refine the position of the Baltica paleocontinent at this time. Argon isotopic results imply that melt homogenization has been achieved at the hundred-micron scale certainly because of the low-silica content of the molten target rock that allows fast 40Ar* diffusion in the melt. However, the large range of F(40Ar*inherited) (3 to 8 percents) observed for seven grains show that complete isotopic homogenization was not reached at the centimeter and perhaps millimeter scale. This result is in good agreement with previous Rb and Sr isotopic data.

  13. 40Ar/39Ar-Dating of deformation of transform-shear stage in evolution of the Early Caledonides in Western Sangilen (South-Eastern Tuva)

    International Nuclear Information System (INIS)

    Detail structural-metamorphic and isotopic investigations into borders of the Muguro-Chinchilig tectonic block are conducted. 40Ar/39Ar-isotope dating was conducted by the graduated warming-up with biotite for different zones. Carried studies demonstrate that in the boundary of 465 million years intensive shift disturbances entailing fragmentation of the Muguro-Chinchilig tectonic block and disturbances in entirety of its separate parts in borders of the Sangilen plateau (South-Eastern Tuva) were stated

  14. A new approach to cosmogenic corrections in 40Ar/39Ar chronometry: Implications for the ages of Martian meteorites

    Science.gov (United States)

    Cassata, W. S.; Borg, L. E.

    2016-08-01

    Anomalously old 40Ar/39Ar ages are commonly obtained from Shergottites and are generally attributed to uncertainties regarding the isotopic composition of the trapped component and/or the presence of excess 40Ar. Old ages can also be obtained if inaccurate corrections for cosmogenic 36Ar are applied. Current methods for making the cosmogenic correction require simplifying assumptions regarding the spatial homogeneity of target elements for cosmogenic production and the distribution of cosmogenic nuclides relative to trapped and reactor-derived Ar isotopes. To mitigate uncertainties arising from these assumptions, a new cosmogenic correction approach utilizing the exposure age determined on an un-irradiated aliquot and step-wise production rate estimates that account for spatial variations in Ca and K is described. Data obtained from NWA 4468 and an unofficial pairing of NWA 2975, which yield anomalously old ages when corrected for cosmogenic 36Ar using conventional techniques, are used to illustrate the efficacy of this new approach. For these samples, anomalous age determinations are rectified solely by the improved cosmogenic correction technique described herein. Ages of 188 ± 17 and 184 ± 17 Ma are obtained for NWA 4468 and NWA 2975, respectively, both of which are indistinguishable from ages obtained by other radioisotopic systems. For other Shergottites that have multiple trapped components, have experienced diffusive loss of Ar, or contain excess Ar, more accurate cosmogenic corrections may aid in the interpretation of anomalous ages. The trapped 40Ar/36Ar ratios inferred from inverse isochron diagrams obtained from NWA 4468 and NWA 2975 are significantly lower than the Martian atmospheric value, and may represent upper mantle or crustal components.

  15. Combined U-Th/He and 40Ar/39Ar geochronology of post-shield lavas from the Mauna Kea and Kohala volcanoes, Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Aciego, S.M.; Jourdan, F.; DePaolo, D.J.; Kennedy, B.M.; Renne, P.R.; Sims, K.W.W.

    2009-10-01

    Late Quaternary, post-shield lavas from the Mauna Kea and Kohala volcanoes on the Big Island of Hawaii have been dated using the {sup 40}Ar/{sup 39}Ar and U-Th/He methods. The objective of the study is to compare the recently demonstrated U-Th/He age method, which uses basaltic olivine phenocrysts, with {sup 40}Ar/{sup 39}Ar ages measured on groundmass from the same samples. As a corollary, the age data also increase the precision of the chronology of volcanism on the Big Island. For the U-Th/He ages, U, Th and He concentrations and isotopes were measured to account for U-series disequilibrium and initial He. Single analyses U-Th/He ages for Hamakua lavas from Mauna Kea are 87 {+-} 40 ka to 119 {+-} 23 ka (2{sigma} uncertainties), which are in general equal to or younger than {sup 40}Ar/{sup 39}Ar ages. Basalt from the Polulu sequence on Kohala gives a U-Th/He age of 354 {+-} 54 ka and a {sup 40}Ar/{sup 39}Ar age of 450 {+-} 40 ka. All of the U-Th/He ages, and all but one spurious {sup 40}Ar/{sup 39}Ar ages conform to the previously proposed stratigraphy and published {sup 14}C and K-Ar ages. The ages also compare favorably to U-Th whole rock-olivine ages calculated from {sup 238}U - {sup 230}Th disequilibria. The U-Th/He and {sup 40}Ar/{sup 39}Ar results agree best where there is a relatively large amount of radiogenic {sup 40}Ar (>10%), and where the {sup 40}Ar/{sup 36}Ar intercept calculated from the Ar isochron diagram is close to the atmospheric value. In two cases, it is not clear why U-Th/He and {sup 40}Ar/{sup 39}Ar ages do not agree within uncertainty. U-Th/He and {sup 40}Ar/{sup 39}Ar results diverge the most on a low-K transitional tholeiitic basalt with abundant olivine. For the most alkalic basalts with negligible olivine phenocrysts, U-Th/He ages were unattainable while {sup 40}Ar/{sup 39}Ar results provide good precision even on ages as low as 19 {+-} 4 ka. Hence, the strengths and weaknesses of the U-Th/He and {sup 40}Ar/{sup 39}Ar methods are

  16. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Science.gov (United States)

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  17. ARS Biodiesel Research Initiatives

    Science.gov (United States)

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  18. 40Ar/39Ar dating of the Late Cretaceous

    International Nuclear Information System (INIS)

    . Finally, using advances with terrestrial carbon isotope and planktonic foraminifera records within central Hokkaido, Northwest Pacific, sections from the Cretaceous Yezo group were correlated to that of European and North American counterparts. Datable ash layers throughout the Kotanbetsu and Shumarinai section were analysed using both 40Ar/39Ar and U-Pb methods. We successfully dated two ash tuff layers falling either side of the Turonian - Coniacian boundary, yielding an age range for the boundary between 89.31 ± 0.11 Ma and 89.57 ± 0.11 Ma or a boundary age of 89.44 ± 0.24 Ma. Combining these U-Pb ages with recent published ages we are able to reduce the age limit once more and propose an age for the Turonian - Coniacian boundary as 89.62 ± 0.04 Ma. (author)

  19. Ar-40/Ar-39 age constraints for the Jaramillo Normal Subchron and the Matuyama-Brunhes geomagnetic boundary

    Science.gov (United States)

    Izett, Glen A.; Obradovich, John D.

    1994-02-01

    Our mid-Pleistocene Ar-40/Ar-39 age recalibration of the geomagnetic polarity timescale is nearly in accord with the oxygen isotope, climate record calibration of the astronomical timescale proposed by Johnson (1982) and Shackleton et al. (1990). Ar-40/Ar-39 ages of a normally magnetized rhyolite dome in the Valles caldera, northern Mexico, yielded a weighted-mean age of 1.004 +/- 0.019 Ma. A K-Ar age of 0.909 +/- 0.019 Ma for this rock by Doell and Dalrymple (1966) was the linchpin for the recognition and calibration of the Jaramillo Normal Subchron (JNS). Other Ar-40/Ar-39 ages from the Valles caldera and Ar-40/Ar-39 ages of Ivory Coast tektites indicate that the JNS began at about 1.11 Ma and ended before 0.92 Ma, probably near 0.97 Ma. The Matuyama-Brunhes boundary occurred between 0.79 Ma and 0.76 Ma on the basis of Ar-40/Ar-39 sanidine ages from (1) three reversely magnetized rhyolite domes of the Valles caldera (0.793 +/- 0.018 Ma, 0.794 +/- 0.007 Ma, and 0.812 +/- 0.023 Ma) and pumice (0.789 +/- 0.006 Ma) from the reversely magnetized Oldest Toba Tuff of Sumatra and (2) pumice (0.764 +/- 0.005 Ma and 0.757 +/- 0.009 Ma) from the lower and upper units of the normally magnetized Bishop Tuff. The age of the boundary may be close to 0.77 Ma as deduced from rates of sedimentation in ancient Lake Bonneville, Utah.

  20. 39Ar measurements on samples extracted from ocean water. Final report

    International Nuclear Information System (INIS)

    The penetration into the ocean of disturbance at the atmosphere-ocean interface is studied by the analysis of transient tracers like bomb-produced 14C, 3H and anthropogenic 85Kr and freons, and of radioactive isotopes produced by cosmic radiation in the atmosphere, like pre-nuclear 14C and 39Ar. This paper discusses the use of 39Ar and gives examples of measurements of 39Ar taken in the Atlantic and Pacific Oceans

  1. Ars Electronica tulekul / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  2. 西藏邦铺钼铜矿区He、Ne和Ar同位素及成矿流体示踪%He, Ne and Ar Isotopic Composition and Origin of Ore-forming Fluids of Bangpu Mo-Cu Mine Area, Tibet

    Institute of Scientific and Technical Information of China (English)

    温泉; 温春齐; 霍艳; 周雄; 费光春; 黄于鉴

    2012-01-01

    Bangpu Cu—Mo ore area is located in the east oi the Gangdisi porphyry copper zone in Tibet. It is a typical copper-molybdenum metal ore deposit with large type porphyry. Noble gas isotopes in the fluid inclusions in the molybdenite of Mo-Cu ore body and in the pyrite of Pb-Zn ore body were tested. The results show that the contents of 4He, 20Ne, 40Ar, 34Kr and 132Xe in the fluid inclusions of the molybdenite in Mo-Cu ore body are higher than these of the pyrite in Pb-Zn ore body. The partial ratio in the former is lower than that in the latter, such as 3He/4He is 0.347 and 5.80, 21Ne/22Ne is 0.027 2 and 0.045 8, 40Ar/36Ar is 381.9 and 743.3, respectively. It shows that the fluid of the deposit may belong to crust-mantle mixed source, the fluid source of molybdenite maybe come from the crust-derived fluid or atmospheric water, pyrite fluid source mayhe come from mantle -derived fluid. This result is consistent with the investigation of the quartz fluid inclusions of hydrogen and oxygen isotopes.%邦铺钼铜多金属矿区位于西藏冈底斯斑岩铜矿带东段,是典型的大型斑岩型钼铜多金属矿床.对该矿床钼铜矿体和铅锌矿体的辉钼矿和黄铁矿流体包裹体进行了稀有气体同位素测试.测试显示,辉钼矿流体包裹体中4He,20Ne,40Ar,84Kr和132Xe含量均高于铅锌矿体的黄铁矿;但部分比值前者却低于后者,3He/4He分别为0.347和5.80,21Ne/22Ne分别为0.0272和0.0458,40Ar/36Ar分别为381.9和743.3.研究认为,该矿床流体可能属壳幔混源,辉钼矿流体来源以壳源流体或大气水为主,黄铁矿流体来源以幔源流体为主.这与石英矿物流体包裹体氢氧同位素研究一致.

  3. 40Ar/39Ar dating of Quaternary volcanic ashes by multi-collection noble gas mass spectrometry: protocols, precision and intercalibration

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie;

    for single crystal 40Ar/39Ar dating of Quaternary samples because of: (i) improved source sensitivity; (ii) ion-counting electron multipliers, which have low signal to noise ratios enabling precise measurement of very small 36Ar signals - resulting in accurate correction for atmospheric-derived 40Ar; (iii......) higher mass resolution allows hydrocarbon interferences to be pseudo resolved for the different argon isotopes; and (iv) multi-collection, allowing more data to be gathered in a fixed time in comparison with single-collector peak-switching measurements. We evaluate (i) protocols for detector inter...

  4. ARABIC LIGHT STEMMER (ARS

    Directory of Open Access Journals (Sweden)

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  5. Feasibility of observing the {\\alpha} decay chains from isotopes of SHN with Z = 128, Z = 126, Z = 124 and Z = 122

    CERN Document Server

    Santhosh, K P; Nithya, C

    2016-01-01

    Taking the Coulomb and proximity potential model for deformed nuclei (CPPMDN) as the interacting potential for the post-scission region, the alpha decay properties of 34 isotopes of the superheavy nuclei with Z = 128 within the range 306 $\\leq$ A $\\leq$ 339 have been studied, considering both the parent and daughter nuclei to be deformed. The manuscript also deals with the decay properties of the isotopes of Z = 126 (within 288 $\\leq$ A $\\leq$ 339), Z = 124 (within 284 $\\leq$A $\\leq$ 339) and Z = 122 (within 280 $\\leq$ A $\\leq$ 339). The alpha decay half lives thus evaluated has been compared with the values evaluated using other theoretical models and it was seen that, our theoretical alpha decay half lives matches well with these values. Through the present study, we have underlined and have established the fact that, among the 192 isotopes considered in the present study, only those isotopes $^{321-324,328-335}$128, $^{318-320,323-327}$126, $^{305-308,315-322}$124 and $^{298-307,311-314}$122 can be synthes...

  6. Production yields of noble-gas isotopes from ISOLDE UC$_{x}$/graphite targets

    CERN Document Server

    Bergmann, U C; Catherall, R; Cederkäll, J; Diget, C A; Fraile-Prieto, L M; Franchoo, S; Fynbo, H O U; Gausemel, H; Georg, U; Giles, T; Hagebø, E; Jeppesen, H B; Jonsson, O C; Köster, U; Lettry, Jacques; Nilsson, T; Peräjärvi, K; Ravn, H L; Riisager, K; Weissman, L; Äystö, J

    2003-01-01

    Yields of He, Ne, Ar, Kr and Xe isotopic chains were measured from UC$_{x}$/graphite and ThC$_{x}$/graphite targets at the PSB-ISOLDE facility at CERN using isobaric selectivity achieved by the combination of a plasma-discharge ion source with a water-cooled transfer line. %The measured half-lives allowed %to calculate the decay losses of neutron-rich isotopes in the %target and ion-source system, and thus to obtain information on the in-target %productions from the measured yields. The delay times measured for a UC$_x$/graphite target allow for an extrapolation to the expected yields of very neutron-rich noble gas isotopes, in particular for the ``NuPECC reference elements'' Ar and Kr, at the next-generation radioactive ion-beam facility EURISOL. \\end{abstract} \\begin{keyword} % keywords here, in the form: keyword \\sep keyword radioactive ion beams \\sep release \\sep ion yields \\sep ISOL (Isotope Separation On-Line) \\sep uranium and thorium carbide targets. % PACS codes here, in the form: \\PACS code \\sep code...

  7. Diagenetic and Metallogenic Sources of Furong Tin Deposit,Qitianling:Constraints from Lu-Hf for Zircon and He-Ar Isotope for Fluid Inclusions%骑田岭芙蓉锡矿的成岩和成矿物质来源:锆石Lu-Hf 同位素和矿物包裹体He-Ar同位素证据

    Institute of Scientific and Technical Information of China (English)

    单强; 曾乔松; 李建康; 卢焕章; 侯茂洲; 于学元; 吴传军

    2014-01-01

    Determination of zircon U-Pb isotopic date and Lu-Hf isotopic composition of various granitoids in the Qitianling plutons,south China show,there are two-staged granites:the earlier hornblende granitite with 160.0 ±2.7 Ma of zircon U-Pb concordant age and the later granitite with 156.5 ±1.8 Ma of zircon U-Pb concordant age.Metamietimation of zircons appear in the later mineralizing granitite,those zircon is intensively riched in LREE,U and Th,and characteristics of hydrothermal zircon.Lu-Hf isotopic compositions of zircons from four granites show that diagenetic substance are derived from the lower crust, which original magmas were resulted from partial melting of the lower crust in the palaeo-Proterzoic(1 .3~1 .5 Ga),with some mantle substance adding.He-Ar isotopic compositions for fluid inclusions of pyrite and garnet from the Qitianling Furong tin deposit also show a lower ratio of 3 He/4 He(0.059~0.432), which ranges from those between the crust and mantle, suggests mantle fluids are involved in mineralization for the deposit (less than 10% for the amount).%本文分析测试了骑田岭花岗岩芙蓉锡矿的各类花岗岩的锆石 U-Pb 同位素年龄和Lu-Hf同位素组成。本区有两期花岗岩,早期角闪石黑云母花岗岩锆石U-Pb谐和年龄为160.0±2.7 Ma,晚期黑云母花岗岩的锆石U-Pb谐和年龄为156.5±1.8 Ma。在晚期矿化的黑云母花岗岩中出现了蜕晶化锆石,蜕晶化锆石强烈富集LREE和U、Th,是典型热液锆石的特征。四个花岗岩锆石的Lu-Hf同位素组成说明骑田岭花岗岩的成岩物质主要来源于下地壳,它们的原始岩浆源于中元古代(1.3~1.5 Ga)下地壳物质的部分熔融,并有部分地幔物质的参与。还分析测定了骑田岭芙蓉锡矿黄铁矿、石榴子石流体包裹体的 He-Ar 同位素组成,其3 He/4 He 比值较低(0.059~0.432),介于地壳和地幔流体3 He/4 He 比值之间,表明芙蓉锡矿的成

  8. Nano-Mole Scale Side-Chain Signal Assignment by 1H-Detected Protein Solid-State NMR by Ultra-Fast Magic-Angle Spinning and Stereo-Array Isotope Labeling

    KAUST Repository

    Wang, Songlin

    2015-04-09

    We present a general approach in 1H-detected 13C solid-state NMR (SSNMR) for side-chain signal assignments of 10-50 nmol quantities of proteins using a combination of a high magnetic field, ultra-fast magic-angle spinning (MAS) at ~80 kHz, and stereo-array-isotope-labeled (SAIL) proteins [Kainosho M. et al., Nature 440, 52–57, 2006]. First, we demonstrate that 1H indirect detection improves the sensitivity and resolution of 13C SSNMR of SAIL proteins for side-chain assignments in the ultra-fast MAS condition. 1H-detected SSNMR was performed for micro-crystalline ubiquitin (~55 nmol or ~0.5mg) that was SAIL-labeled at seven isoleucine (Ile) residues. Sensitivity was dramatically improved by 1H-detected 2D 1H/13C SSNMR by factors of 5.4-9.7 and 2.1-5.0, respectively, over 13C-detected 2D 1H/13C SSNMR and 1D 13C CPMAS, demonstrating that 2D 1H-detected SSNMR offers not only additional resolution but also sensitivity advantage over 1D 13C detection for the first time. High 1H resolution for the SAIL-labeled side-chain residues offered reasonable resolution even in the 2D data. A 1H-detected 3D 13C/13C/1H experiment on SAIL-ubiquitin provided nearly complete 1H and 13C assignments for seven Ile residues only within ~2.5 h. The results demonstrate the feasibility of side-chain signal assignment in this approach for as little as 10 nmol of a protein sample within ~3 days. The approach is likely applicable to a variety of proteins of biological interest without any requirements of highly efficient protein expression systems.

  9. Application of liquid chromatography-mass spectrometry to measure the concentrations and study the synthesis of short chain fatty acids following stable isotope infusions

    NARCIS (Netherlands)

    Meesters, R.J.W.; Eijk, H.M.H. van; Have, G.A.M. ten; Graaf, A.A. de; Venema, K.; Rossum, B.E.J. van; Deutz, N.E.P.

    2007-01-01

    A new method involving zinc sulphate deproteinization was developed to study short chain fatty acids (SCFA) production in the colon and subsequent occurrence of SCFA in blood. SCFA were baseline separated in a 30 min cycle using ion-exclusion chromatography and detected by mass spectrometry. Concent

  10. Testing coeffcients of AR and bilinear time series models by a graphical approach

    Institute of Scientific and Technical Information of China (English)

    IP; WaiCheung

    2008-01-01

    AR and bilinear time series models are expressed as time series chain graphical models, based on which, it is shown that the coefficients of AR and bilinear models are the conditional correlation coefficients conditioned on the other components of the time series. Then a graphically based procedure is proposed to test the significance of the coeffcients of AR and bilinear time series. Simulations show that our procedure performs well both in sizes and powers.

  11. Generalized Isoscaling of Isotopic Distributions

    CERN Document Server

    Shomin, R; Bjarki, O; Gelbke, C K; Kunde, G J; Lemmon, R C; Lynch, W G; Magestro, D; Popescu, R; Van der Molen, A; Verde, G; Westfall, G D; Xi Hong Fei; Friedman, W A; Imme, G; Maddalena, V; Nociforo, C; Raciti, G; Riccobene, G; Romano, F; Saija, A; Sfienti, C; Fritz, S; Gross, C; Odeh, T; Schwarz, C; Nadasen, A; Sisan, D R; Rao, K A G

    2002-01-01

    Generalized isoscaling relationships are proposed that may permit one to relate the isotopic distributions of systems that may not be at the same temperature. The proposed relationships are applied to multifragmentation excitation functions for central Kr+Nb and Ar+Sc collisions.

  12. 40Ar/ 39Ar and RbSr analyses from ductile shear zones from the Atacama Fault Zone, northern Chile: the age of deformation

    Science.gov (United States)

    Scheuber, Ekkehard; Hammerschmidt, Konrad; Friedrichsen, Hans

    1995-11-01

    The influence of deformation on the K-Ar and the Rb-Sr isotope system is investigated. It is assumed that, due to the diffusion processes involved, deformation has a similar effect on isotopic equilibrium as has temperature. In order to examine the influence of deformation on the K-Ar and the Rb-Sr isotope systems two shear zones from the Atacama Fault Zone (AFZ), situated in the north Chilean Coastal Cordillera, have been investigated. The AFZ, which was active as a sinistral strike-slip fault during the Mesozoic, has two sets of shear zones, one formed under amphibolite (SZ1), one under greenschist facies conditions (SZ2), Rb-Sr and 40Ar/ 39Ar age determinations were conducted on samples from cross sections of each set. In SZ1 the hornblendes and bioties from a weakly deformed sample reveal cooling ages of 153-152 and 150 ± 1 Ma, respectively. Biotite from the center of the shear zone of SZ1 gave an isochron of 143.9 ± 0.3 Ma (MSWD = 0.04) which is interpreted as the age of deformation which produced resetting of the mineral system. In SZ2 hornblendes yielded 40Ar/ 39Ar plateau (cooling) ages of ˜ 138 Ma. Biotites from undeformed samples gave Rb-Sr and 40Ar/ 39Ar total degassing ages of 130 ± 1 Ma, whereas biotite from the mylonitic rocks yielded 126-125 Ma which dates the time of deformation. Sr isotope homogenization occurred in the mylonitic rocks, and is most likely a result of deformation. The formation of SZ1 can be correlated to the Araucanian (= Nevadan) phase. The deformation in SZ2 is related to the onset of uplift and cooling of the Coastal Cordilleran magmatic arc.

  13. Duration of formation of magmatic system of polyphase paleozoic alkaline complexes of the Central Kola: U-Pb, Rb-Sr, Ar-Ar data

    International Nuclear Information System (INIS)

    Attempt was made for the determination of duration of all abyssal system formation in the central part of the Kola peninsula. System of isotope methods inclosing Rb-Sr-isochronic dating, 40Ar/39Ar-age analysis of rocks as well as U-Th-Pb-dating is applied. Formation of the Khibiny-Lovozero-Kurga volcano-plutonic system is proposed to have a multiphase character. Summary scheme of the order of events is performed

  14. A set of engineered Escherichia coli expression strains for selective isotope and reactivity labeling of amino acid side chains and flavin cofactors.

    Directory of Open Access Journals (Sweden)

    Jennifer Mehlhorn

    Full Text Available Biological reactions are facilitated by delicate molecular interactions between proteins, cofactors and substrates. To study and understand their dynamic interactions researchers have to take great care not to influence or distort the object of study. As a non-invasive alternative to a site-directed mutagenesis approach, selective isotope labeling in combination with vibrational spectroscopy may be employed to directly identify structural transitions in wild type proteins. Here we present a set of customized Escherichia coli expression strains, suitable for replacing both the flavin cofactor and/or selective amino acids with isotope enriched or chemically modified substrates. For flavin labeling we report optimized auxotrophic strains with significantly enhanced flavin uptake properties. Labeled protein biosynthesis using these strains was achieved in optimized cultivation procedures using high cell density fermentation. Finally, we demonstrate how this approach is used for a clear assignment of vibrational spectroscopic difference signals of apoprotein and cofactor of a flavin containing photoreceptor of the BLUF (Blue Light receptors Using FAD family.

  15. Influence of deformation and fluids on Ar retention in white mica: Dating the Dover Fault, Newfoundland Appalachians

    Science.gov (United States)

    Kellett, Dawn A.; Warren, Clare; Larson, Kyle P.; Zwingmann, Horst; van Staal, Cees R.; Rogers, Neil

    2016-06-01

    White mica 40Ar/39Ar analyses may provide useful constraints on the timing of tectonic processes, but complex geological and thermal histories can perturb Ar systematics in a variety of ways. Ductile shear zones represent excellent case studies for exploring the link(s) between dynamic re-/neo-crystallization of white mica and coeval enhanced fluid flow, and their effect on 40Ar/39Ar dates. White mica 40Ar/39Ar dates were collected from compositionally similar granites that record different episodes of deformation with proximity to the Dover Fault, a terrane-bounding strike-slip shear zone in the Appalachian orogen, Newfoundland, Canada. 40Ar/39Ar data were collected in situ by laser ablation and by step heating single crystals. Results were compared to each other and against complementary U-Pb zircon and monazite, and K-Ar fault gouge analysis. Although step-heat 40Ar/39Ar is a widely applied method in orogenic settings, this dataset shows that relatively flat step-heat 40Ar/39Ar spectra are in contradiction with wide spreads in in-situ40Ar/39Ar dates from the same samples, and that plateau dates in some cases yielded mixed dates of equivocal geological significance. This result indicates that the step-wise release of Ar from white mica likely homogenizes and obscures spatially-controlled Ar isotope reservoirs in white mica from sheared rocks. In contrast, in situ laser ablation 40Ar/39Ar analysis preserves the spatial resolution of 40Ar reservoirs that have been variably reset by deformation and fluid interaction. This study therefore suggests that laser ablation is the best method for dating the timing of deformation recorded by white mica. Final interpretation of results should be guided by microstructural analysis, estimation of deformation temperature, chemical characterization of white mica, and complementary chronometers. Overall the dataset shows that granitic protoliths were emplaced between 430 and 422 Ma (U-Pb zircon). High strain deformation along the

  16. Alpine orogenic evolution from subduction to collisional thermal overprint: The 40Ar/39Ar age constraints from the Valaisan Ocean, central Alps

    DEFF Research Database (Denmark)

    Wiederkehr, Michael; Sudo, Masafumi; Bousquet, Romain;

    2009-01-01

    in general. The timing of high-pressure metamorphism, subsequent retrogression and following Barrow-type overprint was studied by 40Ar/39Ar dating of biotite and several white mica generations that are well characterized in terms of mineral chemistry, texture and associated mineral assemblages. Four distinct...... age populations of white mica record peak pressure conditions (42–40 Ma) and several stages of subsequent retrograde metamorphic evolution (36–25 Ma). Biotite isotopic analyses yield consistent apparent ages that cluster around 18–16 Ma for the Barrow-type thermal overprint. The recorded isotopic data...

  17. Biomagnification of organochlorine pollutants in farmed and wild gilthead sea bream (Sparus aurata) and stable isotope characterization of the trophic chains

    Energy Technology Data Exchange (ETDEWEB)

    Serrano, Roque [Research Institute for Pesticides and Water (IUPA). Avda Sos Baynat, s/n. University Jaume I, 12071 Castellon (Spain)], E-mail: serrano@qfa.uji.es; Blanes, Miguel A.; Lopez, Francisco J. [Research Institute for Pesticides and Water (IUPA). Avda Sos Baynat, s/n. University Jaume I, 12071 Castellon (Spain)

    2008-01-25

    Organochlorine pollutants (pesticides and polychlorinated biphenyls) were analysed in farmed and wild gilthead sea bream (Sparus aurata) tissues (white muscle and liver) from the Western Mediterranean (Spain) and in their diets. Determination was carried out by gas chromatography coupled to tandem mass spectrometry after clean up of the fatty extracts by normal phase HPLC, with detection limits around 0.1 ng/g. Carbon and nitrogen stable isotope ratios were also determined in the samples. Organochlorine compounds concentration was found to be uniform throughout the year in farmed fish, in both white muscle and liver. In contrast, wild fish showed contamination profiles that reflect environmental factors and the biological cycle. Although biomagnification factors for white muscle and liver were found to be 2.4 and 3.0, respectively for farmed fish, and 0.15 and 0.54 for wild specimens, wild fish presented higher levels of organochlorine contaminants than farmed fish. Nitrogen stable isotopes determination in muscle from wild and farmed sea bream during the year gave us a profile related to the biological cycle. {delta}{sup 15}N mean values from farmed fish were 2.0 per mille higher than from wild fish throughout the year that corresponding to close to one trophic step. {delta}{sup 13}C values were stable during the year, and also more enriched in the case of farmed fish. The low levels of contaminants found in the feed supplied to farmed fish explain the organochlorine concentrations in their tissues which remain below wild fish, in spite of the intensive culture conditions and higher trophic level of cultured specimens.

  18. Biomagnification of organochlorine pollutants in farmed and wild gilthead sea bream (Sparus aurata) and stable isotope characterization of the trophic chains

    International Nuclear Information System (INIS)

    Organochlorine pollutants (pesticides and polychlorinated biphenyls) were analysed in farmed and wild gilthead sea bream (Sparus aurata) tissues (white muscle and liver) from the Western Mediterranean (Spain) and in their diets. Determination was carried out by gas chromatography coupled to tandem mass spectrometry after clean up of the fatty extracts by normal phase HPLC, with detection limits around 0.1 ng/g. Carbon and nitrogen stable isotope ratios were also determined in the samples. Organochlorine compounds concentration was found to be uniform throughout the year in farmed fish, in both white muscle and liver. In contrast, wild fish showed contamination profiles that reflect environmental factors and the biological cycle. Although biomagnification factors for white muscle and liver were found to be 2.4 and 3.0, respectively for farmed fish, and 0.15 and 0.54 for wild specimens, wild fish presented higher levels of organochlorine contaminants than farmed fish. Nitrogen stable isotopes determination in muscle from wild and farmed sea bream during the year gave us a profile related to the biological cycle. δ15N mean values from farmed fish were 2.0 per mille higher than from wild fish throughout the year that corresponding to close to one trophic step. δ13C values were stable during the year, and also more enriched in the case of farmed fish. The low levels of contaminants found in the feed supplied to farmed fish explain the organochlorine concentrations in their tissues which remain below wild fish, in spite of the intensive culture conditions and higher trophic level of cultured specimens

  19. Argon isotope fractionation induced by stepwise heating

    Science.gov (United States)

    Trieloff, Mario; Falter, Martina; Buikin, Alexei I.; Korochantseva, Ekaterina V.; Jessberger, Elmar K.; Altherr, Rainer

    2005-03-01

    Noble gas isotopes are widely used to elucidate the history of the rocks in which they have been trapped, either from distinct reservoirs or by accumulation following radioactive decay. To extract noble gases from their host rocks, stepwise heating is the most commonly used technique to deconvolve isotopically different components, e.g., atmospheric, in situ radiogenic, or excess radiogenic from mantle or crustal reservoirs. The accurate determination of the isotopic composition of these different components is of crucial importance, e.g., for ages obtained by 40Ar- 39Ar stepheating plateaus. However, diffusion theory-based model calculations predict that the stepwise thermal extraction process from mineral phases induces isotope fractionation and, hence, adulterates the original composition. Such effects are largely unconsidered, as they are small and a compelling experimental observation is lacking. We report the first unequivocal evidence for significant mass fractionation of argon isotopes during thermal extraction, observed on shungite, a carbon-rich Precambrian sedimentary rock. The degree of fractionation, as monitored by 38Ar/ 36Ar and 40Ar/ 36Ar ratios, very well agrees with theoretical predictions assuming an inverse square root dependence of diffusion coefficient and atomic mass, resulting in easier extraction of lighter isotopes. Hence, subatmospheric 40Ar/ 36Ar ratios obtained for argon extracted at low temperatures may not represent paleoatmospheric argon. Shungite argon resembles modern atmospheric composition, but constraints on the timing of trapping appear difficult to obtain, as shungites are multicomponent systems. In 40Ar- 39Ar stepwise heating, the isotope fractionation effect could cause systematic underestimations of plateau ages, between 0.15 and 0.4% depending on age, or considerably higher if samples contain appreciable atmospheric Ar. The magnitude of this effect is similar to the presently achieved uncertainties of this increasingly

  20. Newly combined 40Ar/39Ar and U-Pb ages of the Upper Cretaceous timescale from Hokkaido, Japan

    Science.gov (United States)

    Gaylor, J. R.; Heredia, B. D.; Quidelleur, X.; Takashima, R.; Nishi, H.; Mezger, K.

    2011-12-01

    The main targets for GTS next project (www.gtsnext.eu) are to develop highly refined geological time scales, including the Upper Cretaceous. The Cretaceous period is characterised by numerous global anoxic events in the marine realm, rich ammonitic fossil assemblages and specialised foraminifera. However, lack of age diagnostic macro and micro fossils in the North Pacific sections has made it difficult to link these with global sections such as the Western Interior Basin (North America). Using advances with terrestrial C-isotope and planktic foraminifera records within Central Hokkaido we are able to correlate these sections globally. The Cretaceous Yezo group in Central Hokkaido comprises deep marine mudstones and turbidite sandstones interbedded with acidic volcanic tuffs. Using various sections within the Yezo group, we radiometrically dated tuffs at the main stage boundaries in the Upper Cretaceous. The samples derive from the Kotanbetsu, Shumarinai, Tiomiuchi and the Hakkin river sections, spanning the time from the Albian-Cenomanian up until the Campanian-Santonian boundaries, and were dated using 40Ar/39Ar, K/Ar and U-Pb techniques. Recent age constraints in the Hokkaido counterparts (Kotanbetsu sections) show good coherence between radiometric chronometers on the various Upper Cretaceous stage boundaries. These additional ages together with our isotope ages from the different sections around the Hokkaido basin are well linked by the various faunal assemblages and C-isotope curves. The combined radio isotope ages contribute to previous attempts (such as those focused in the Western Interior Basin) supporting the synchronicity of events such as global oceanic anoxic events. Finally, the ages obtained here also compliment the previous C-isotope and planktic foraminifera records allowing for a more precise climatic history of the Northwest Pacific during the Cretaceous. The research within the GTSnext project is funded by the European Community's Seventh

  1. Ars Poetica : [luuletused] / Mats Traat

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  2. Pulsed discharge production Ar* metastables

    Science.gov (United States)

    Han, Jiande; Heaven, Michael C.; Emmons, Daniel; Perram, Glen P.; Weeks, David E.; Bailey, William F.

    2016-03-01

    The production of relatively high densities of Ar* metastables (>1012 cm-3) in Ar/He mixtures, at total pressures close to 1 atm, is essential for the efficient operation of an optically pumped Ar* laser. We have used emission spectroscopy and diode laser absorption spectroscopy measurements to observe the production and decay of Ar* in a parallel plate pulsed discharge. With discharge pulses of 1 μs duration we find that metastable production is dominated by processes occurring within the first 100 ns of the gas break-down. Application of multiple, closely spaced discharge pulses yields insights concerning conditions that favor metastable production. This information has been combined with time-resolved measurements of voltage and current. The experimental results and preliminary modeling of the discharge kinetics are presented.

  3. Argon isotopes as tracers for martian atmospheric loss

    Science.gov (United States)

    Slipski, Marek; Jakosky, Bruce M.

    2016-07-01

    Recent measurements of the present-day Ar abundance and isotopic ratios in the martian atmosphere by the SAM instrument suite onboard the Curiosity rover can be used to constrain the atmospheric and volatile evolution. We have examined the role of volcanic outgassing, escape to space via sputtering, crustal erosion, impact delivery, and impact erosion in reproducing the Ar isotope ratios from an initial state 4.4 billion years ago. To investigate the effects of each of these processes, their timing, and their intensity we have modeled exchanges of Ar isotopes between various reservoirs (mantle, crust, atmosphere, etc.) throughout Mars' history. Furthermore, we use present-day atmospheric measurements to determine the parameter space consistent with observations. We find that significant loss to space (at least 48% of atmospheric 36Ar) is required to match the observed 36Ar/38Ar ratio. Our estimates of volcanic outgassing do not supply sufficient 40Ar to the atmosphere to match observations, so in our model at least 31% of 40Ar produced in the crust must have also been released to the atmosphere. Of the total 40Ar introduced into the atmosphere about 25% must have been lost to space. By adding the present-day isotopic abundances with our results of total integrated Ar loss we find a "restored" value of atmospheric 40Ar/36Ar, which represents what that ratio would be if the total integrated Ar loss had remained in the atmosphere. We determine the restored value to be ∼900-1500. This is below the present martian atmospheric value (1900 ± 300), but 3-5 times greater than the terrestrial value.

  4. Radiogenic age and isotopic studies

    International Nuclear Information System (INIS)

    This is one of an annual collection of reports presenting data from the Geochronology Section of the Continental Geoscience Division of the Geological Survey of Canada (GSC). The main purpose of this collection is to make geochronological and other radiogenic isotope data produced by the section available promptly to the geological community. Reports make full presentation of the data, relate these to field settings and make comparatively short interpretations. Other geochronological and isotope data produced in the laboratory but published in outside journals or separate GSC publications are summarized at the end of this report. Reports in this issue cover methods for Rb-Sr and Sm-Nd isotopic analyses; 40Ar-39Ar ages for the New Quebec Crater and for basaltic rocks; U-Pb ages for a differentiated mafic sill in the Ogilvie Mountains, plutonic rocks in the Contwoyto-Nose Lakes are, zircons from the Anton Complex, the Clinton-Colden gabbro-anorthosite intrusion, the Himag plutonic suite, the Campbell granite, the Central Gneiss Belt, Silurian granites, a metarhyolite, plagiogranite and gabbro, and the Wage shear zone; Rb-Sr ages for granitic rocks; K-Ar and Rb-Sr geochronology of granites; a compilation of K-Ar ages; ages of archean and proterozoic mylonites and pre-Misi granitoid domes; and reconnaissance geochronology of Baffin Island

  5. Determination of recharge modes of aquifers by use of chemical and isotopic tracers. Case study of the contact zone between Western High-Atlas Chain and Souss Plain (SW Morocco

    Directory of Open Access Journals (Sweden)

    Tagma, T.

    2008-06-01

    Full Text Available Determination of the origin of recharge of the unconfined aquifer in the right side of the Souss wadi between Agadir and Taroudant (South-western of Morocco was based on the use of hydrochemical and isotopic analysis of groundwater, surface water and springs of the contact zone between the High-Atlas Chain and the Souss plain.The correspondence in the space evolution of the various chemical elements of evaporitic origin (SO42-, Cl-, Sr2+ in groundwater, piedmont springs, and surface water reveals the existence of recharge water from the adjacent High-Atlas Chain.The various recharge modes of the different aquifers (High Atlas and Souss plain determined by isotopic analysis, shows that the source of groundwater for the unconfined Souss aquifer seems to be composite between a direct infiltration on the High-Atlas tributaries and a remote recharge from the bordering High Atlas aquifers.La determinación del origen de los aportes de agua de la capa freática de la ribera derecha del rio Souss entre Agadir y Taroudant (Suroeste de Marruecos se ha basado en la hidroquímica y el análisis isotópico de las aguas subterráneas, aguas superficiales y manantiales de la zona de contacto entre el Alto Atlas y la llanura de Souss.La correspondencia en la evolución espacial de los diferentes elementos químicos de origen evaporítico (SO42-, Cl-, Sr2+ en las aguas subterráneas, manantiales de pie de monte y aguas superficiales, revela la existencia de una recarga de agua procedente de la cadena del Alto Atlas. El análisis de los modos de recarga de los diferentes acuíferos (Alto Atlas y llanura de Souss determinado por análisis isotópico, demuestra que la alimentación de la capa freática de Souss a partir del Alto Atlas parece ser mixta, compuesta por una infiltración directa de los afluentes del Alto Atlas y una alimentación lejana desde los acuiferos que limitan con el borde del Alto Atlas.

  6. Study of the N=28 shell closure by one neutron transfer reaction: astrophysical application and {beta}-{gamma} spectroscopy of neutron rich nuclei around N=32/34 and N=40; Etude de la fermeture de couche N=28 autour du noyau {sub 18}{sup 46}Ar{sub 28} par reaction de transfert d'un neutron: application a l'astrophysique et Spectroscopie {beta}-{gamma} de noyaux riches en neutrons de N=32/34 et N=40

    Energy Technology Data Exchange (ETDEWEB)

    Gaudefroy, L

    2005-09-15

    The study of the N=28 shell closure has been presented as well as its astrophysical implications. Moreover the structure of neutron rich nuclei around N=32/34 and 40 was studied. The N=28 shell closure has been studied trough the one neutron transfer reaction on {sup 44,46}Ar nuclei. Excitation energies of states in {sup 45,47}Ar nuclei have been obtained, as well as their angular momenta and spectroscopic factors. These results were used to show that N=28 is still a good magic number in the argon isotopic chain. We interpreted the evolution of the spin-orbit partner gaps in terms of the tensor monopolar proton-neutron interaction. Thanks to this latter, we showed it is not necessary to summon up a reduction of the intensity of the spin-orbit force in order to explain this evolution in N=29 isotopes from calcium to argon chains. The neutron capture rates on {sup 44,46}Ar have been determined thanks to the results of the transfer reaction. Their influence on the nucleosynthesis of {sup 46,48}Ca was studied. We proposed stellar conditions to account for the abnormal isotopic ratio observed in the Allende meteorite concerning {sup 46,48}Ca isotopes. The beta decay and gamma spectroscopy of neutron rich nuclei in the scandium to cobalt region has been studied. We showed that beta decay process is dominated by the {nu}f{sub 5/2} {yields} {pi}f{sub 7/2} Gamow-Teller transition. Moreover, we demonstrated that the {nu}g{sub 9/2} hinders this process in the studied nuclei, and influences their structure, by implying the existence of isomers. Our results show that N=34 is not a magic number in the titanium chain and the superior ones. (author)

  7. Eruption of the Continental Flood Basalts at ~259 Ma in the Emeishan Large Igneous Province, SW China: Evidence from Laser Microprobe 40Ar/39Ar Dating

    Institute of Scientific and Technical Information of China (English)

    HOU Zengqian; CHEN Wen; LU Jiren

    2006-01-01

    A suite of continental flood basalts sampled over a vast exposure and stratigraphic thickness in the Emeishan large igneous province (LLP), SW China was investigated for laser microprobe 40Ar/39Ar dating. There are two 40Ar/39Ar age groups for these basalts, corresponding to 259-246 Ma and 177-137 Ma, respectively. A well-defined isochron gives an eruption age of huge quantities of mafic magmas at 258.9±3.4 Ma, which is identical to previous dating and paleontological data. Much younger 40Ar/39Ar ages for some basalts with low-greenschist metamorphic facies probably recorded a late thermo-tectonic event caused by collision between the Yangtze and Qiangtang continental blocks during the Mesozoic, which resulted in the reset of argon isotope system. The 40Ar/39Ar age data, we present here, combined with previous dating and paleontological data, suggest relatively short duration (about 3 Ma) of mafic volcanism, which have important implication on mantle plume genesis of the Emeishan continental flood basalts in the LIP.

  8. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Science.gov (United States)

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  9. Guided-ion beam measurements of Ar+ + Ar symmetric charge-transfer cross sections at ion energies ranging from 0.2 to 300 eV

    International Nuclear Information System (INIS)

    Guided-ion beam (GIB) measurements of the Ar+ + Ar symmetric charge-transfer (SCT) system are presented for ion energies ranging from 0.2 to 300 eV. Two methods are applied to distinguish primary and secondary ions: (i) based on isotopic-labeling, (ii) based on significant laboratory velocity differences. The absolute cross sections measured with these methods are in excellent agreement at energies above 1 eV. The experimental results are compared with semi-classical calculations performed with various published Ar2+ potentials. The calculations including spin-orbit effects lie within 10% of the isotope-selected and attenuation measurements at all investigated ion energies. The present results lie significantly above the simple Rapp and Francis model. Important errors in the latter approach are pointed out and a correct one-electron model is proposed. First measurements of the differential cross section at 0.5 eV collision energy are briefly mentioned. (orig.)

  10. Molybdenite Re-Os and muscovite 40Ar/39Ar dating of the Xihuashan tungsten deposit, central Nanling district, South China

    Science.gov (United States)

    Hu, Rui-Zhong; Wei, Wen-Feng; Bi, Xian-Wu; Peng, Jian-Tang; Qi, You-Qiang; Wu, Li-Yan; Chen, You-Wei

    2012-10-01

    The Xihuashan tungsten deposit in the central Nanling region, South China, is an important vein-type ore deposit hosted in Cambrian strata and Mesozoic granitic intrusions. Wolframite and molybdenite are the principal ore minerals. The gangue minerals are mainly quartz and muscovite. Wolframite and molybdenite are products of the first stage hydrothermal activity, whereas muscovite formed dominantly at the second stage. Molybdenite Re-Os and muscovite 40Ar/39Ar dating have been carried out to investigate the age of mineralization. Re-Os isotopic dating for molybdenite associated with wolframite yield a precise, well-constrained isochron age of 157.8 ± 0.9 Ma (MSWD = 1.5). Ar-Ar isotopic analyses of muscovite yield a plateau age of 152.8 ± 1.6 Ma, in agreement with an inverse isochron age of 152.8 ± 1.6 Ma, which is ~ 5 mys younger than the Re-Os age. The molybdenite Re-Os age is interpreted as the age of tungsten mineralization. This age coincides well with the zircon U-Pb age of the host granitic intrusion reported previously. The ~ 5 mys difference between molybdenite Re-Os and muscovite 40Ar/39Ar ages probably represents the duration of hydrothermal activity. The results show that the Xihuashan tungsten deposit is one of many important tungsten-tin deposits formed during 150 to 160 Ma associated with large-scale lithospheric extension in South China.

  11. Chronology and shock history of the Bencubbin meteorite: A nitrogen, noble gas, and Ar-Ar investigation of silicates, metal and fluid inclusions

    Science.gov (United States)

    Marty, Bernard; Kelley, Simon; Turner, Grenville

    2010-11-01

    We have investigated the distribution and isotopic composition of nitrogen and noble gases, and the Ar-Ar chronology of the Bencubbin meteorite. Gases were extracted from different lithologies by both stepwise heating and vacuum crushing. Significant amounts of gases were found to be trapped within vesicles present in silicate clasts. Results indicate a global redistribution of volatile elements during a shock event caused by an impactor that collided with a planetary regolith. A transient atmosphere was created that interacted with partially or totally melted silicates and metal clasts. This atmosphere contained 15N-rich nitrogen with a pressure ⩾3 × 10 5 hPa, noble gases, and probably, although not analyzed here, other volatile species. Nitrogen and noble gases were re-distributed among bubbles, metal, and partly or totally melted silicates, according to their partition coefficients among these different phases. The occurrence of N 2 trapped in vesicles and dissolved in silicates indicates that the oxygen fugacity ( fO2) was greater than the iron-wüstite buffer during the shock event. Ar-Ar dating of Bencubbin glass gives an age of 4.20 ± 0.05 Ga, which probably dates this impact event. The cosmic-ray exposure age is estimated at ˜40 Ma with two different methods. Noble gases present isotopic signatures similar to those of "phase Q" (the major host of noble gases trapped in chondrites) but elemental patterns enriched in light noble gases (He, Ne and Ar) relative to Kr and Xe, normalized to the phase Q composition. Nitrogen isotopic data together with 40Ar/ 36Ar ratios indicate mixing between a 15N-rich component (δ 15N = +1000‰), terrestrial N, and an isotopically normal, chondritic N. Bencubbin and related 15N-rich meteorites of the CR clan do not show stable isotope (H and C) anomalies, precluding contribution of a nucleosynthetic component as the source of 15N enrichments. This leaves two possibilities, trapping of an ancient, highly fractionated

  12. $^{110,116}$Cd($\\alpha,\\alpha$)$^{110,116}$Cd elastic scattering and systematic investigation of elastic $\\alpha$ scattering cross sections along the $Z$ = 48 isotopic and $N$ = 62 isotonic chains

    CERN Document Server

    Kiss, G G; Fülöp, Zs; Gyürky, Gy; Elekes, Z; Farkas, J; Somorjai, E; Yalcin, C; Galaviz, D; Güray, R T; Özkan, N; Görres, J

    2013-01-01

    The elastic scattering cross sections for the reactions $^{110,116}$Cd($\\alpha,\\alpha$)$^{110,116}$Cd at energies above and below the Coulomb barrier are presented to provide a sensitive test for the alpha-nucleus optical potential parameter sets. Additional constraints for the optical potential are taken from the analysis of elastic scattering excitation functions at backward angles which are available in literature. Moreover, the variation of the elastic alpha scattering cross sections along the $Z = 48$ isotopic and $N = 62$ isotonic chain is investigated by the study of the ratios of the of $^{106,110,116}$Cd($\\alpha,\\alpha$)$^{106,110,116}$Cd scattering cross sections at E$_{c.m.} \\approx$ 15.6 and 18.8 MeV and the ratio of the $^{110}$Cd($\\alpha,\\alpha$)$^{110}$Cd and $^{112}$Sn($\\alpha,\\alpha$)$^{112}$Sn reaction cross sections at E$_{c.m.} \\approx$ 18.8 MeV, respectively. These ratios are sensitive probes for the alpha-nucleus optical potential parameterizations. The potentials under study are a basic...

  13. Analysis list: AR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  14. Analysis list: Ar [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscien...cedbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscien

  15. 40Ar/39Ar Dating of the Brunhes-Matuyama Geomagnetic Field Reversal.

    Science.gov (United States)

    Baksi, A K; Hsu, V; McWilliams, M O; Farrar, E

    1992-04-17

    Magnetostratigraphic studies are widely used in conjunction with the geomagnetic polarity time scale (GPTS) to date events in the range 0 to 5 million years ago. A critical tie point on the GPTS is the potassium-argon age of the most recent (Brunhes-Matuyama) geomagnetic field reversal. Astronomical values for the forcing frequencies observed in the oxygen isotope record in Ocean Drilling Project site 677 suggest that the age of this last reversal is 780 ka (thousand years ago), whereas the potassium-argon-based estimate is 730 ka. Results from 4039; Ar incremental heating studies on a series of lavas from Maui that straddle the Brunhes-Matuyama reversal give an age of 783 + 11 ka, in agreement with the astronomically derived value. The astronomically based technique appears to be a viable tool for dating young sedimentary sequences. PMID:17743111

  16. Whole-rock Ar-Ar dating for low-grade metavolcanics within the Dabie orogen and its geological significance

    Institute of Scientific and Technical Information of China (English)

    GAO Tianshan; TANG Jiafu; SANG Haiqing; HU Shiling; QIAN Cunchao

    2006-01-01

    The genetic relationship between low- grade and ultrahigh-pressure (UHP) metamorphic units in the interior of the Dabie orogen has been controversial with respect to preservation of volcanic texture during continental subduction to mantle depths. In order to resolve this issue, whole-rock Ar-Ar dating was carried out for greenschist-facies metatuff that is in contact with UHP eclogite in Yuexi County, Anhui Province. One sample gave a plateau age of 784.4±2.0 Ma and an isochron age of 785.0± 4.7 Ma, and the other sample a plateau age of 770.9± 2.0 Ma and an isochron age of 769.5±3.1 Ma. It appears that the Ar isotopic system was not disturbed since the volcanic eruption at the middle Neoproterozoic. Because of the low closure temperature of Ar diffusion in volcanic rocks, retention of the Neoproterozoic ages indicates that the low-grade metavolcanics did not experience high-grade metamorphism up to eclogite-facies conditions during the Triassic subduction of continental crust. Furthermore, the Neoproterozoic Ar-Ar ages are also in agreement with protolith ages of UHP metaigneous rocks in the Dabie orogen. Therefore, the metatuff is interpreted as a tectonic relict that was scraped off during the Triassic subduction and thus was not subducted to mantle depths like the adjacent eclogite. This lends support to the model for crustal detachment between cover and basement during continental collision. A tectonic mélange model is proposed to explain the occurrence of contrasting grades of metamorphic rock within the UHP metamorphic zone.

  17. Isotopic geology

    International Nuclear Information System (INIS)

    Born from the application to geology of nuclear physics techniques, the isotopic geology has revolutionized the Earth's sciences. Beyond the dating of rocks, the tracer techniques have permitted to reconstruct the Earth's dynamics, to measure the temperatures of the past (giving birth to paleoclimatology) and to understand the history of chemical elements thanks to the analysis of meteorites. Today, all domains of Earth sciences appeal more or less to the methods of isotopic geology. In this book, the author explains the principles, methods and recent advances of this science: 1 - isotopes and radioactivity; 2 - principles of isotope dating; 3 - radio-chronological methods; 4 - cosmogenic isotope chronologies; 5 - uncertainties and radio-chronological results; 6 - geochemistry of radiogenic isotopes; 7 - geochemistry of stable isotopes; 8 - isotopic geology and dynamical analysis of reservoirs. (J.S.)

  18. Isotopic clusters

    International Nuclear Information System (INIS)

    Spectra of isotopically mixed clusters (dimers of SF6) are calculated as well as transition frequencies. The result leads to speculations about the suitability of the laser-cluster fragmentation process for isotope separation. (Auth.)

  19. "Ars Electronica 2009" / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  20. AR DOC: Augmented reality documentaries

    DEFF Research Database (Denmark)

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  1. Ionothermal synthesis and crystal structures of metal phosphate chains

    NARCIS (Netherlands)

    Wragg, D.; Le Ouay, B.; Beale, A.M.; O'Brien, M.G.; Slawin, A.M.Z.; Warren, J.E.; Prior, T.J.; Morris, R.E.

    2013-01-01

    We have prepared isostructural aluminium and gallium phosphate chains by ionothermal reactions in 1-ethyl-3-methylimidazolium bromide and 1-ethylpyridinium bromide under a variety of conditions. The chains can be prepared as pure phases or along with three dimensional framework phases. The chains ar

  2. 40Ar/39Ar dated climatic and hydrological variability between MIS20 and MIS18 at Sulmona Basin (central Italy)

    Science.gov (United States)

    Zanchetta, Giovanni; Giaccio, Biagio; Eleonora, Reagattieri; Nomade, Sebastien; Renne, Paul R.; Sprain, Courtney J.; Drysdale, Russell N.; Tzedakis, Polychronis C.; Messina, Paolo; Scardia, Giancarlo; Sposato, Andrea

    2015-04-01

    Understanding spatial-temporal variability, magnitude and different expressions of Quaternary millennial-scale palaeoclimatic changes is one of the frontier challenges of modern palaeoclimatology. Addressing this issue requires the acquisition of regionally representative, and ideally independently-dated, records of climatic variability. Multiproxy record (stable isotopes, XRF, MS, %CaCO3) from lacustrine succession of Sulmona basin (central Italy), highlights climatic and hydrological variability at orbital to millennial scales between MIS20 and MIS18. The record highlights the presence of interesting millennial scale variability within MIS19, considered to be the best orbital analogue of the current interglacial. The presence of several tephra layers precisely dated by 40Ar/39Ar technique, allow placement of the record within a robust time frame. Assembling a high-resolution paleoclimatic record for MIS19 anchored to a high-precision 40Ar/39Ar chronology, it is possible to show that the MIS 19c interglacial started shortly before the boreal summer insolation and obliquity maximum/precession minimum at 790-788 ka, and ended 11.6 ± 2.3 kyr later, when orbital parameters assumed a configuration similar to the present one.

  3. A compact isotope identification telescope with a wide dynamic range

    Institute of Scientific and Technical Information of China (English)

    徐瑚珊; 诸永泰; 等

    1996-01-01

    A compact ΔE-E telescope,used to complete the isotope identification for lighter projectile-like fragments in intermediate energy heavy ion collisions.is developed.By detecting the fragments emitted from 30MeV/u 40Ar induced reactions.it can identify isotopes of up to element aluminum(Z=13).

  4. Further support for a Cretaceous age for the feathered-dinosaur beds of Liaoning,China:New 40Ar/39Ar dating of the Yixian and Tuchengzi Formations

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    We report new 40Ar/39Ar dating results obtained from total fusion and incremental-heating analyses of sanidine and biotite from three tuffs found interbedded within the fossil-bearing deposits of Liaoning, northeast China. The first is a new sample of the Bed 6 Sihetun tuff from the Yixian Formation, previously dated by our team as middle Early Cretaceous, and recently considered by Lo et al., partially reset due to metamorphism from a nearby basaltic sill. The second is the Yixian Bed 9 tuff from Hengdaozi considered by Lo et al. to be unaffected by metamorphism and whose age, based on total fusion 40Ar/39Ar dating of biotite, argues for a Jurassic age for the Yixian Formation.The third tuff is a previously undated tuff from the upper part of the underlying Tuchengzi Formation. Single crystal total fusion 40Ar/39Ar analyses of the Sihetun sanidine showed homogeneous radiogenic Ar, Ca/K ratios, excellent reproducibility and gave a mean age of 125.0 ± 0.18 (1SD) ±0.04 (SE) Ma. Single sanidine crystal total fusion 40Ar/39Aranalyses of the Hengdaozi tuff gave a mean age of 125.0 +0.19 (1SD) ± 0.04 (SE) Ma, which is indistinguishable from the Sihetun tuff. The Tuchengzi Formation tuff gave a mean age of 139.4 ± 0.19 (1SD) ± 0.05 (SE) Ma. Detailed laser incremental-heating analyses of biotite from Sihetun, Hengdaozi, and Tuchengzi tuffs show disturbed Ar release patterns and evidence of trapped argon components. We conclude from these analyses that the total fusion dates on biotite by Lo et al. are erroneously old and isotopic dating of both biotite and sanidine from tuffs of the Yixian Formation point to a middle Early Cretaceous age. The upper part of the Tuchengzi Formation can be referred to the Early Cretaceous.``

  5. ARS - Helsinki - 2006 / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  6. Ars Industrialis, arsindustrialis.org

    Directory of Open Access Journals (Sweden)

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  7. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  8. AR-39Ar-40 dating of basalts and rock breccias from Apollo 17 and the malvern achondrite

    Science.gov (United States)

    Kirsten, T.; Horn, P.

    1977-01-01

    The principles and the potential of the Ar-39/Ar-40 dating technique are illustrated by means of results obtained for 12 Apollo 17 rocks. Emphasis is given to methodical problems and the geological interpretation of lunar rock ages. Often it is ambigious to associate a given lunar breccia with a certain formation, or a formation with a basin. In addition, large-scale events on the Moon have not necessarily reset radiometric clocks completely. One rock fragment has a well-defined plateau age of 4.28 b.y., but the ages of two Apollo 17 breccias define an upper limit for the formation age of the Serenitatis basin at 4.05 b.y. Ages derived from five mare basalts indicate cessation of mare volcanism at Taurus-Littrow approximately 3.78 b.y. ago. Ca/Ar-37 exposure ages show that Camelot Crater was formed by an impact approximately 95 m.y. ago. After a short summary of the lunar timetable as it stands at the end of the Apollo program, we report about Ar-39/Ar-40 and rare gas studies on the Malvern meteorite. This achondrite resembles lunar highland breccias in texture as well as in rare-gas patterns. It was strongly annealed at some time between 3.4 and 3.8 b.y. ago. The results indicate that very similar processes have occurred on the Moon and on achondritic parent bodies at comparable times, leading to impact breccias with strikingly similar features, including the retention of rare-gas isotopes from various sources.

  9. Medical isotopes and emerging nuclear medicine technologies

    International Nuclear Information System (INIS)

    This presentation discusses medical isotopes and the emerging nuclear medicine technologies as well as the impact of Chalk River reactor shutdown on patient management and diseases. It outlines the chain of supply of isotopes across the globe and isotope shortage impact. It recommends the following mitigating strategies: modifications of scanning techniques, adjustment of patient scheduling, optimization of Tc-99m generator use, patient prioritization, alternate procedures and PET scanning.

  10. Falling chains

    Science.gov (United States)

    Wong, Chun Wa; Yasui, Kosuke

    2006-06-01

    The one-dimensional fall of a folded chain with one end suspended from a rigid support and a chain falling from a resting heap on a table is studied. Because their Lagrangians contain no explicit time dependence, the falling chains are conservative systems. Their equations of motion are shown to contain a term that enforces energy conservation when masses are transferred between subchains. We show that Cayley's 1857 energy nonconserving solution for a chain falling from a resting heap is incorrect because it neglects the energy gained when a link leaves a subchain. The maximum chain tension measured by Calkin and March for the falling folded chain is given a simple if rough interpretation. Other aspects of the falling folded chain are briefly discussed.

  11. Occurrences of Excess 40Ar in Hydrothermal Tourmaline:Interpretations from 40Ar-39Ar Dating Results by Stepwise Heating

    Institute of Scientific and Technical Information of China (English)

    QIU Huaning; PU Zhiping; DAI Tongmo

    2007-01-01

    The occurrences of excess 40Ar within a hydrothermal tourmaline is discussed in term of the analysis data of syngenetic muscovite and tourmaline from the Lushui hydrothermal tin-tungsten deposit in western Yunnan, China, using the 40Ar-39Ar stepwise heating technique. About 80% excess 40Ar was released in the last step when the tourmaline was fused, corresponding to a release of only ~3% 39Ar (K), which indicates that most excess 40Ar was held in the mineral lattice rather than in the channels parallel to the Z-axis. This suggests that the excess 40Ar was incorporated during crystallization and not diffused into the tourmaline during the post-crystallization history.

  12. The Ar-Ar age and petrology of Miller Range 05029: Evidence for a large impact in the very early solar system

    Science.gov (United States)

    Weirich, J. R.; Wittmann, A.; Isachsen, C. E.; Rumble, D.; Swindle, T. D.; Kring, D. A.

    2010-12-01

    Miller Range (MIL) 05029 is a slowly cooled melt rock with metal/sulfide depletion and an Ar-Ar age of 4517 ± 11 Ma. Oxygen isotopes and mineral composition indicate that it is an L chondrite impact melt, and a well-equilibrated igneous rock texture with a lack of clasts favors a melt pool over a melt dike as its probable depositional setting. A metallographic cooling rate of approximately 14 °C Ma-1 indicates that the impact occurred at least approximately 20 Ma before the Ar-Ar closure age of 4517 Ma, possibly even shortly after accretion of its parent body. A metal grain with a Widmanstätten-like pattern further substantiates slow cooling. The formation age of MIL 05029 is at least as old as the Ar-Ar age of unshocked L and H chondrites, indicating that endogenous metamorphism on the parent asteroid was still ongoing at the time of impact. Its metallographic cooling rate of approximately 14 °C Ma-1 is similar to that typical for L6 chondrites, suggesting a collisional event on the L chondrite asteroid that produced impact melt at a minimum depth of 5-12 km. The inferred minimum crater diameter of 25-60 km may have shattered the 100-200 km diameter L chondrite asteroid. Therefore, MIL 05029 could record the timing and petrogenetic setting for the observed lack of correlation of cooling rates with metamorphic grades in many L chondrites.

  13. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian;

    2011-01-01

    , but more precise (±0.10%) than, the previous 40Ar/39Ar age determined by intercalibration with astronomically tuned tephras from the Melilla Basin (Morocco). Using this proposed age for FCs, combined with measurements using the A1Ts as the neutron fluence monitor, a weighted mean Bishop Tuff 40Ar/39Ar...

  14. New geochemical and isotopic constraints on the genesis of the Oliveira Azeméis granitoid melts (Porto-Tomar Shear Zone, Iberian Variscan Chain, Central-Western Portugal)

    Science.gov (United States)

    Santos, J. F.; Mendes, M. H.; Gonçalves, A. C.; Moita, P.

    2012-04-01

    The Porto-Tomar Shear Zone (PTSZ) is a very important tectonic structure that separates, in central-western Portugal, two of the major tectonic units of the Iberian Variscan Chain: the Ossa-Morena Zone, to the west, and the Central Iberian Zone, to the east. The Oliveira de Azeméis area lies in the northern sector of the PTZC and it is characterized by the occurrence of strongly deformed granitoids. Country rocks are dominantly pelitic metasediments which, according to recent geological mapping (Pereira et al., 2007), belong to the Precambrian Lourosa Formation and the Ordovician São João de Ver Formation. Using Rb-Sr whole-rock isotopic data, Pinto (1979) proposed an age of 379±12 Ma for the Oliveira de Azeméis granitoids. In this work, new results were obtained on these granitoids in the area between the villages of Travanca and Curval, especially in the Sacramento quarry. In this critical outcrop, strongly deformed two-mica granite (displaying S-C structures, with dextral NNW-SSE shear planes) pass into diatexites and metatexites with garnet, cordierite and sillimanite-bearing melanosomes. Leucosomes seem to have mainly granitic s.s. compositions, but cm-thick bands of leucotonalite were also found. Major element geochemistry of granite samples shows the following ranges: 71.4% ≤ SiO2 ≤ 74.2%; 0.74% ≤Fe2O3t ≤ 2.48%; 0.35% ≤ MgO ≤ 0.60%; 0.49% ≤ CaO ≤ 1.32%; 2.90% ≤ Na2O ≤ 3.11%; 4.70% ≤ K2O ≤ 5.47%; 1.17 ≤ ASI ≤ 1.36. Trace element data reveal a strong fractionation between highly incompatible LILE and less incompatible HFSE (248 ≤ PM normalized Rb/Y ≤ 671) and between LREE and HREE (18.6 ≤ PM normalized La/Lu ≤ 54.7). These features, in particular the peraluminous composition, the high K contents and the distinct rare-earth fractionation suggest that the Oliveira de Azeméis granites are mostly the result of partial melting of metasediments with a large pelitic component and that garnet is a likely residual phase

  15. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Directory of Open Access Journals (Sweden)

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  16. Chronostratigraphy of Monte Vulture volcano (southern Italy): secondary mineral microtextures and 39Ar-40Ar systematics

    Science.gov (United States)

    Villa, Igor M.; Buettner, Annett

    2009-12-01

    The eruptive history of Monte Vulture has been the subject of several geochronological investigations during the past decades, which reliably dated only a small number of eruptions. Understanding the causes of sub-optimum data yield in the past requires an interdisciplinary approach. We re-analyzed samples from previous works and present new data on samples from the main volcano-stratigraphic units of Monte Vulture, so as to provide an improved, consistent chronostratigraphic database. Imaging of minerals by cathodoluminescence and backscattered electrons reveals that heterochemical, high-temperature deuteric reaction textures are ubiquitous. Such observations are common in metamorphic rocks but had not frequently been reported from volcanic rocks. In view of the mineralogical complexity, we base our chronological interpretation on isochemical steps, defined as steps for which the Cl/K and/or the Ca/K ratios are constant. Isochemical steps carry the isotopic signature of chemically homogeneous mineral phases and therefore allow a well-constrained age interpretation. Comparison of old and new 39Ar-40Ar data proves the reproducibility of age spectra and their shapes. This quantifies the analytical reliability of the irradiation and mass-spectrometric analyses. Anomalous age spectra are a reproducible property of some specific samples and correlate with mineralogical anomalies. The present data allow us to fine-tune the age of the volcanostratigraphic units of Monte Vulture during the known interval of main volcanic activity from ca. 740 to 610 ka. After a very long stasis, the volcanic activity in the Monte Vulture area resumed with diatremic eruptions, one of which (Lago Piccolo di Monticchio, the site of a palynological-paleoclimatological drilling) was dated at ca. 140 ka.

  17. PF-AR upgrading project

    CERN Document Server

    Kasuga, T

    2002-01-01

    The upgrading project of the dedicated pulse X-ray source PF-AR has been completed by the end of the 2001 fiscal year. Machine commissioning exclusively using the injector linac was successfully accomplished in the beginning of January 2002. After fine tuning of the machine and cleaning of the vacuum system with the beams from the middle of January to the middle of March, routine operation for users has begun in April. The historical details, commissioning and results of the project are reported. (author)

  18. Unwrapping Chains

    CERN Document Server

    Cambou, A D; Hamm, E; Hanna, J A; Menon, N; Santangelo, C D; Walsh, L

    2012-01-01

    A loop of chain can move along its own tangents, maintaining a steady shape. An open-ended chain undergoing a nontrivial motion must change its shape. One consequence is that chains pulled around objects will fail to follow the contours of the objects, unwrapping themselves instead. This short note accompanies a fluid dynamics video submission (83068) to the APS DFD Gallery of Fluid Motion 2012.

  19. Potash-rich volcanic rocks and lamprophyres in western Shandong Province: 40Ar39Ar dating and source tracing

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Highly precise 40Ar39Ar dating results demonstrate that the ages of potash-rich volcanic rocks in western Shandong Province are 114.7-124.3 Ma, and that of the lamprophyres is 119.6 Ma. The potash-rich volcanic rocks have relatively high (87Sr/86Sr)i ratios ( 0.708715-0.711418)and distinctly negative εNd values ( -11.47 - -17.54), and are enriched in radiogenic lead (206Pb/204pb=17.341-17.622,207pb/204Pb=15.525-15.538, 208Pb/204pb = 37.563-37.684).Similarly, the lamprophyres also have quite low εNd values ( -11.57 - -19.64). Based on the fact that the Sr, Nd and Pb isotopic compositions of potash-rich volcanic rocks are very consistent with that of the clinopyroxene separates, and by integrating comprehensive analyses of their tectonic settings,and extensive comparisons of the Sr, Nd isotopic compositions with that of the related simultaneous rocks, it is concluded that the potash-rich volcanic rocks and lamprophyres in western Shandong Province were most possibly derived from the partial melting of enriched mantle which was caused by source contamination and metasomatism of subducted continental crustal materials.``

  20. Falling chains

    CERN Document Server

    Wong, C W; Wong, Chun Wa; Yasui, Kosuke

    2006-01-01

    The one-dimensional falling motion of a bungee chain suspended from a rigid support and of a chain falling from a resting heap on a table is studied. Their Lagrangians are found to contain no explicit time dependence. As a result, these falling chains are conservative systems. Each of their Lagrange's equations of motion is shown to contain a term that enforces energy conservation when masses are transferred between subchains. We show in particular that Cayley's 1857 energy nonconserving solution for a chain falling from a resting heap is incorrect because it neglects the energy gained when the transferred link is emitted by the emitting subchain. The maximum chain tension measured by Calkin and March for the falling bungee chain is given a simple if rough interpretation. In the simplified one-dimensional treatment, the kinetic energy of the center of mass of the falling bungee chain is found to be converted by the chain tension at the rigid support into the internal kinetic energy of the chain. However, as t...

  1. Ars discendi, ars docendi : programme Pascal

    OpenAIRE

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  2. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    DEFF Research Database (Denmark)

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian....... XRD-data indicated that some mineral separates prepared for Ar-Ar stepwise heating analysis were monomineralic, whereas others were composed of two white micas (muscovite with paragonite or margarite), or biotite and chlorite. In monomineralic samples 37Ar/39Ar and 38Ar/39Ar (proportional to Ca....../K and Cl/K ratios) did not change and the resulting ages can be interpreted unambiguously. In mineral separates containing two white micas, Ca/K and Cl/K ratios were variable, reflecting non-simultaneous laboratory degassing of the two heterochemical Ar-reservoirs. These ratios were used to identify each...

  3. Radiogenic age and isotopic studies: report 9. Current research 1995-F

    International Nuclear Information System (INIS)

    'Radiogenic Age and Isotopic Studies' is an annual collection of research presentations containing U-Pb, Sm-Nd, Rb-Sr, and 40Ar-39Ar data generated by the Geochronology Laboratory under the auspices of the Continental Geoscience Division, Geological Survey of Canada. Report 9 contains 5 papers from regions across Canada, followed by a compilation of 40Ar-39Ar and K-Ar ages. Authors herein present data, relate results to field settings, and make brief interpretations. Readers are thus reminded that much of the research encompassed represents 'work-in-progress' and that more extensive publications may follow at a later date

  4. Compilation Tool Chains and Intermediate Representations

    DEFF Research Database (Denmark)

    Mottin, Julien; Pacull, François; Keryell, Ronan;

    2014-01-01

    In SMECY, we believe that an efficient tool chain could only be defined when the type of parallelism required by an application domain and the hardware architecture is fixed. Furthermore, we believe that once a set of tools is available, it is possible with reasonable effort to change hardware ar...

  5. Isotopic fractionation of argon during stepwise release from shungite

    International Nuclear Information System (INIS)

    In previous attempts to determine the 40Ar/36Ar ratio in the ancient atmosphere, the only direct measurement yielding a value below the atmospheric value of today is for argon released at low temperatures from a pre-Cambrian shungite, an amorphous carbon mineral The present work confirms a low value for 40Ar/36Ar in gas released from a type I shungite at low temperatures. But quantitative scrutiny of the accompanying 38AR/36Ar ratios and the enhanced ratio of 40Ar/36Ar for the fractions released at high temperatures shows convincingly that the effect seen here is an artifact of the stepwise heating and the argon diffusion mobilized thereby. The low 40Ar/36Ar previously obtained is very likely from the same cause rather than reflecting the isotopic composition of the pre-Cambrian atmosphere. The vitreous character of and the sharp, conchoidal fractures seen in the specimens of type I shungite suggest that the substance may exhibit simple volume diffusion over macroscopic dimensions as glasses do. If so, the diffusion parameters (D infinitely = 3 x 10-4 cm2/s and E = 11 kcal/mole) obtained from the data imply rapid exchange with the atmosphere for any argon initially trapped in centimenter-thick veins of the material. (orig.)

  6. Ars grammatica de Dionisio Tracio

    Directory of Open Access Journals (Sweden)

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  7. Modification of surface properties of polyethylene by Ar plasma discharge

    Energy Technology Data Exchange (ETDEWEB)

    Svorcik, V. [Department of Solid State Engineering, Institute of Chemical Technology, Technicka 5, 166 28 Prague (Czech Republic)]. E-mail: vaclav.svorcik@vscht.cz; Kotal, V. [Department of Solid State Engineering, Institute of Chemical Technology, Technicka 5, 166 28 Prague (Czech Republic); Slepicka, P. [Department of Solid State Engineering, Institute of Chemical Technology, Technicka 5, 166 28 Prague (Czech Republic); Blahova, O. [Department of Mechanics, Faculty of Applied Sciences, University of West Bohemia, Univerzitni 22, 306 14 Plzen (Czech Republic); Spirkova, M. [Institute of Macromolecular Chemistry, Academy of Sciences of the Czech Republic, Heyrovskeho Sq. 2, 162 06 Prague (Czech Republic); Sajdl, P. [Department of Power Engineering, Institute of Chemical Technology, 166 28 Prague (Czech Republic); Hnatowicz, V. [Nuclear Physics Institute, Academy of Sciences of the Czech Republic, 250 68 Rez (Czech Republic)

    2006-03-15

    Polyethylene (PE) surface was modified by Ar plasma discharge. The changes of surface morphology and surface wettability (characterized by contact angle) were followed using AFM microscopy and standard goniometry, respectively. The changes of chemical structure of PE polymeric chain were characterized by FTIR and XPS techniques. A nanoindenter was used to study mechanical properties (microhardness, elasticity module and microscratch test) of modified PE. After exposition to the plasma discharge a fast decline of the contact angle is observed. The decline depends on the discharge power and the time elapsed from the plasma exposition. FTIR and XPS measurements indicate an oxidation of degraded polymeric chains and creation of hydroxyl, carbonyl, ether, ester and carboxyl groups. Surface morphology of modified PE depends on the plasma discharge power and exposure time. Maximum microhardness and elastic module, observed on PE specimens exposed to plasma discharge for 240 s, may be connected with PE crosslinking initiated by plasma discharge.

  8. 40Ar/39Ar Interlaboratory Calibration into the Holocene.

    Science.gov (United States)

    Heizler, M. T.; Jicha, B.; Koppers, A. A. P.; Miggins, D. P.

    2015-12-01

    Advances in 40Ar/39Ar analytical precision for very young rocks requires collaborative efforts amongst argon geochronology labs to demonstrate age reproducibility commensurate with high precision. NM Tech (NMT), the University of Wisconsin (UW) and Oregon State University (OSU) have each dated Quaternary flux monitor standard AC-2 sanidine (~1.185 Ma), a blind sanidine described as being 50-100 ka (BS) and sanidine from the Qixiangshan (QIX) flow (~10 ka), Changbaishan volcano, China. The samples were irradiated in a single package with FC-2 sanidine (28.201 Ma) as the flux monitor and the irradiated material was distributed amongst the labs. Heizler was present during analysis at both OSU and UW and Jicha attended OSU during analysis. Physical presence was key towards gaining understanding of individual protocols and prompted valuable discussions. Analyses were carried out on single crystals using total fusion and/or step heating approaches. Age agreement was achieved within 2s uncertainty that ranged between (0.03-0.3%, 0.13-0.37% and 1.8-2.6%) for AC-2, BS and QIX, respectively. Each lab found AC-2 to vary somewhat beyond a normal distribution and to yield an age relative to FC-2 of ~1.185 Ma that is ~1.3% (~5-10 sigma) lower than some published estimates. A key cause of the variation between this study and previous results may be variable gas pressure equilibration times between extraction line and mass spectrometer coupled with variable choices to estimate time zero by other laboratories. The majority of our efforts concentrated on the QIX sanidine where prior data obtained by our labs revealed a factor of two spread in age (~11 and 23 ka) based on experiments carried out by total fusion and bulk incremental heating. By conducting single crystal age spectrum analysis we were able to mitigate effects of melt inclusion hosted excess argon and xenocrystic contamination towards obtaining analytical agreement with apparent ages near 10 ka. However, philosophical

  9. K/Ar radiometric dating of basaltic rocks in Transdanubia, Hungary

    International Nuclear Information System (INIS)

    K/Ar datings were made on 39 types of Pliocene-Pleistocene basaltic rocks from Transdanubia, Hungary. The isotopic tracer technique and the isochron method for dating are presented. The radiometric data were evaluated in view of the geological position and petrographic type and character of the samples. In addition to the conventional K/Ar dates, the 40Ar/36Ar-K/36Ar isochron dates were also calculated for presumably cogenetic samples. According to the present determinations, the age of basalts erupted near Pula at the end of the middle part of the Upper Pannonian Formation is 4.15+-0.17 m.y. The basalts of some hills in the area could be assigned to the upper part of the Upper Pannonian Formation. The average K/Ar age of the Pleistocene basic volcanic rock at village Bar is 2.02+-0.14 m.y., and its isochron age is 2.11+-0.17 m.y. (author)

  10. Leatherback Isotopes

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — SWFSC is currently working on a project identifying global marine isotopes using leatherback turtles (Dermochelys coriacea) as the indicator species. We currently...

  11. Isotopic chirality

    Energy Technology Data Exchange (ETDEWEB)

    Floss, H.G. [Univ. of Washington, Seattle, WA (United States)

    1994-12-01

    This paper deals with compounds that are chiral-at least in part, due to isotope substitution-and their use in tracing the steric course of enzyme reaction in vitro and in vivo. There are other applications of isotopically chiral compounds (for example, in analyzing the steric course of nonenzymatic reactions and in probing the conformation of biomolecules) that are important but they will not be discussed in this context.

  12. Isotopic Paleoclimatology

    Science.gov (United States)

    Bowen, R.

    Paleotemperature scales were calculated by H. C. Urey and others in the 1950s to assess past temperatures, and later work using the stable isotopes of oxygen, hydrogen, and carbon employed standards such as Peedee belemnite (PDB) and Standard Mean Ocean Water (SMOW). Subsequently, subjects as diverse as ice volume and paleotemperatures, oceanic ice and sediment cores, Pleistocene/Holocene climatic changes, and isotope chronostratigraphy extending back to the Precambrian were investigated.

  13. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  14. Study of the symbiotic star AR Pavonis

    Directory of Open Access Journals (Sweden)

    C. Quiroga

    2001-01-01

    Full Text Available We present a study of the optical spectra and linear polarization of the eclipsing binary AR Pavonis. The optical spectra were obtained between 1990 and 1998, and polarimetric data between 1995 and 1998. From spectroscopic variations along the orbital motion we analized the nature of the system. Polarimetric studies indicate that AR Pav has intrinsic polarization.

  15. Radiogenic age and isotopic studies

    International Nuclear Information System (INIS)

    This is one of an annual collection of reports presenting data from the Geochronology Section of the Continental Geoscience Division of the Geological Survey of Canada (GSC). The main purpose of this collection is to make geochronological and other radiogenic isotope data produced by the section available promptly to the geological community. Reports make full presentation of the data, relate these to field settings and make comparatively short interpretations. Other geochronological and isotope data produced in the laboratory but published in outside journals or separate GSC publications are summarized at the end of this report. Report 5 contains 24 papers from most regions of Canada, but particularly from British Columbia. The Geochronology Laboratory has, over the years, provided substantial U-Pb dating for the Cordilleran Division of the Geological Survey of Canada in Vancouver, and the results of a number of these studies are presented this year. A compilation of K-Ar ages is given. (figs., tabs., refs.)

  16. Radiogenic age and isotopic studies

    International Nuclear Information System (INIS)

    This is one of an annual collection of reports presenting data from the Geochronology Section of the Continental Geoscience Division of the Geological Survey of Canada (GSC). The main purpose of this collection is to make geochronological and other radiogenic isotope data produced by the section available promptly to the geological community. Reports make full presentation of the data, relate these to field settings and make comparatively short interpretations. Other geochronological and isotope data produced in the laboratory but published in outside journals or separate GSC publications are summarized at the end of this report. Reports in this issue give U-Pb zircon ages for rocks in Newfoundland, Yukon Territory, Manitoba, Ontario, and the Northwest Territories; present a compilation of K-Ar ages; and discuss Precambrian activity in New Brunswick, the geochronology of rock from the Northwest Territories, and reconnaissance Nd studies of rocks from the Northwest Territories. (figs., tabs., refs.)

  17. The Coronae of AR Lac

    CERN Document Server

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  18. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    CERN Document Server

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  19. 40Ar/39Ar and K-Ar data bearing on the metamorphic and tectonic history of western New England.

    Science.gov (United States)

    Sutter, J.F.; Ratcliffe, N.M.; Mukasa, S.B.

    1985-01-01

    40Ar/39Ar ages of coexisting biotite and hornblende from Proterozoic Y gneisses of the Berkshire and Green Mt massifs, as well as 40Ar/39Ar and K/Ar mineral and whole-rock ages from Palaeozoic metamorphic rocks, suggest that the thermal peaks for the dominant metamorphic recrystallization in western New England occurred 465 + or - 5 m.y. (Taconian). 40Ar/39Ar age data from a poorly-defined terrain along the eastern strip of the area suggests that the area has been retrograded during a metamorphism that peaked at least 376 + or - 5 m.y. (Acadian). Available age and petrological data from western New England indicate the presence of at least three separate metamorphic-structure domains of Taconic age: 1) a small area of relict high-P and low-T metamorphism, 2) a broad area of normal Barrovian metamorphism from chlorite to garnet grade characterized by a gentle metamorphic gradient and, 3) a rather narrow belt of steep-gradient, Barrovian series metamorphic rocks. Areas of maximum metamorphic intensity within the last domain coincide with areas of maximum crustal thickening in the later stage of Taconic orogeny. -L.di H

  20. Spatial evaluation of Ar-systematics in rocks from the British Channel Islands: a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Sherlock, S.; Kelley, S. P.

    2010-12-01

    The Ar-Ar method is a powerful tool for constraining thermal histories of metamorphic and plutonic rocks, most commonly undertaken on potassium rich mineral separates rather than whole rocks. While this approach usually yields reasonable thermal histories, it is rarely as precise as dating volcanics, and such rocks are also frequently contaminated by excess argon, artificially elevating the Ar-Ar ages. Understanding the evolution of excess argon represents a challenge; whilst it is possible to discern the ‘sink’ as the host mineral now contaminated by excess argon, examining the ‘source’ and ‘transport’ mechanism is more challenging. The approach we have taken here is to combine measurements of potassium rich and potassium poor minerals to understand the argon reservoirs and argon transfer between minerals, grain boundaries and fluids. Considering the system as a whole provides a method for understanding the complete history of the rock and thus assessing any interactions which may impact on the interpretation of ages and thermal history [Kelley, 2002, Chem. Geol. 188]. Here we have studied a series of plutonic and metamorphic basement samples from the British Channel Islands with different ages and post-emplacement histories, namely Icart Gneiss, Perelle Quartz Diorite, L’Ancresse Granodiorite, and Bordeaux Diorite. The formation age of Icart Gneiss is ~2000 Ma [D’Lemos et al., 1990, Geol. Soc. Spec. Pub. 51]. Ar-Ar ages of hornblendes and biotites from quartz diorites on Guernsey and Sark range between 606 and 596 Ma [Dallmeyer et al. 1991, J. Geol. Soc. London 148], whilst U-Pb zircon ages are in the range 710 to 613 Ma [Dallmeyer et al. 1991; Samson & D’Lemos 1998, J. Geol. Soc. London 155; Miller et al. 1999, Tectonophysics 132]. Detailed petrograpic (microscope, electron microprobe) investigations established the crystallization and deformation history of the samples, and revealed that post-magmatic alteration is unevenly distributed. This

  1. Precision Mass Measurement of Argon Isotopes

    CERN Multimedia

    Lunney, D

    2002-01-01

    % IS388\\\\ \\\\ A precision mass measurement of the neutron-deficient isotopes $^{32,33,34}$Ar is proposed. Mass values of these isotopes are of importance for: a) a stringent test of the Isobaric-Multiplet- Mass-Equation, b) a verification of the correctness of calculated charge-dependent corrections as used in super-allowed $\\beta$- decay studies aiming at a test of the CVC hypothesis, and c) the determination of the kinematics in electron-neutrino correlation experiments searching for scalar currents in weak interaction. The measurements will be carried out with the ISOLTRAP Penning trap mass spectrometer.

  2. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Science.gov (United States)

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  3. 40Ar/39Ar Dating of Zn-Pb-Ag Mineralization in the Northern Brooks Range, Alaska

    Science.gov (United States)

    Werdon, Melanie B.; Layer, Paul W.; Newberry, Rainer J.

    2004-01-01

    completely recrystallized. The 40Ar/39Ar age spectra and inverse isochron plots of the multicomponent whole-rock sandstone samples are more complex than those of single minerals. However, different minerals have different Ca/K and Cl/K ratios and closure temperatures, and these properties were used to identify portions of spectra dominated by argon release from specific minerals. 40Ar/39Ar laser step-heating analyses of Late Devonian sandstone whole rocks produced spectra that record a two-stage resetting history: a Carboniferous hydrothermal event first and later Mesozoic to Tertiary events, which are in agreement with geologic constraints. The 40Ar/39Ar ages and the similar mineralogy, lead isotope composition, and relative stratigraphic positions support the interpretation that the shale-hosted massive sulfide deposits and most vein-breccia occurrences are temporally and genetically related, and that they are different expressions of Carboniferous basinal dewatering.

  4. Chain Gang

    Science.gov (United States)

    2006-01-01

    6 August 2006 This Mars Global Surveyor (MGS) Mars Orbiter Camera (MOC) image shows a chain of clustered and battered craters. These were formed by secondary impact. That is, somewhere to the south (beyond the bottom of this image), a large impact crater formed. When this occurred, material ejected from the crater was thrown tens to hundreds of kilometers away. This material then impacted the martian surface, forming clusters and chains of smaller craters. Location near: 15.8oN, 35.6oW Image width: 3 km (1.9 mi) Illumination from: upper left Season: Northern Spring

  5. Calibration of Nu-Instruments Noblesse multicollector mass spectrometers for argon isotopic measurements using a newly developed reference gas

    Science.gov (United States)

    Coble, M.A.; Grove, M.; Calvert, A.T.

    2011-01-01

    ACs-2, FCs-2, and TCs-2 demonstrate that calculated 40Ar*/39ArK can be accurately corrected to yield model 40Ar/39Ar ages consistent with those reported by Earthtime 40Ar/39Ar laboratories. Replicate analyses of 8-12 single-crystal sanidine ages are reproduced to within 1-2??? (2?? standard error) under optimal analytical conditions. This calibration technique is applicable over a wide range of isotopic ratios and signal sizes. Finally, the reference gas has the added advantage of facilitating straightforward characterization of electron multiplier dead time over a wide dynamic range. ?? 2011 Elsevier B.V.

  6. Surface Activities of Calix[4] resorcinarenes Bearing Four Hydrophobic Chains and Its Sol ubilization for Organic Compounds

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Calix [4] resorcinarenes bearing four hydrophobic side chains (4] Ar-Rn, [4] Ar-Ph, and [4] Ar-N) orient stably on water oil interface and show high solubilization capacities for organic compounds, such as long-chain alcohols, benzene, toluene and dyes. The capacities are high even near the omc of polyalkylated calix [4] resorcinarenes, but the solubilities of organic compounds(solubilizates) decrease with the increase of the size of the solubilizates. [4] Ar-R6, with a chain-length of six carbons, is the most effective among [4] Ar-Rn,[4] Ar-Ph, and [4] Ar-N; 11-fold mol of hexanol is dissolved in 2×10-3 mol/I [4]Ar-R6. Moreover,[4] Ar-Rn bearing four alkyl side chains solubilizes the chain alcohols of the same chain length mostly. The solubilization capacities are presumably brought by inclusion in a large cavity of the polyalkylated calix[4] resorcinarcnes and by an efficient orientation of the solubilizates.

  7. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  8. COX7AR is a Stress-inducible Mitochondrial COX Subunit that Promotes Breast Cancer Malignancy.

    Science.gov (United States)

    Zhang, Kezhong; Wang, Guohui; Zhang, Xuebao; Hüttemann, Philipp P; Qiu, Yining; Liu, Jenney; Mitchell, Allison; Lee, Icksoo; Zhang, Chao; Lee, Jin-Sook; Pecina, Petr; Wu, Guojun; Yang, Zeng-Quan; Hüttemann, Maik; Grossman, Lawrence I

    2016-01-01

    Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, plays a key role in regulating mitochondrial energy production and cell survival. COX subunit VIIa polypeptide 2-like protein (COX7AR) is a novel COX subunit that was recently found to be involved in mitochondrial supercomplex assembly and mitochondrial respiration activity. Here, we report that COX7AR is expressed in high energy-demanding tissues, such as brain, heart, liver, and aggressive forms of human breast cancer cells. Under cellular stress that stimulates energy metabolism, COX7AR is induced and incorporated into the mitochondrial COX complex. Functionally, COX7AR promotes cellular energy production in human mammary epithelial cells. Gain- and loss-of-function analysis demonstrates that COX7AR is required for human breast cancer cells to maintain higher rates of proliferation, clone formation, and invasion. In summary, our study revealed that COX7AR is a stress-inducible mitochondrial COX subunit that facilitates human breast cancer malignancy. These findings have important implications in the understanding and treatment of human breast cancer and the diseases associated with mitochondrial energy metabolism. PMID:27550821

  9. COX7AR is a Stress-inducible Mitochondrial COX Subunit that Promotes Breast Cancer Malignancy

    Science.gov (United States)

    Zhang, Kezhong; Wang, Guohui; Zhang, Xuebao; Hüttemann, Philipp P.; Qiu, Yining; Liu, Jenney; Mitchell, Allison; Lee, Icksoo; Zhang, Chao; Lee, Jin-sook; Pecina, Petr; Wu, Guojun; Yang, Zeng-quan; Hüttemann, Maik; Grossman, Lawrence I.

    2016-01-01

    Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, plays a key role in regulating mitochondrial energy production and cell survival. COX subunit VIIa polypeptide 2-like protein (COX7AR) is a novel COX subunit that was recently found to be involved in mitochondrial supercomplex assembly and mitochondrial respiration activity. Here, we report that COX7AR is expressed in high energy-demanding tissues, such as brain, heart, liver, and aggressive forms of human breast cancer cells. Under cellular stress that stimulates energy metabolism, COX7AR is induced and incorporated into the mitochondrial COX complex. Functionally, COX7AR promotes cellular energy production in human mammary epithelial cells. Gain- and loss-of-function analysis demonstrates that COX7AR is required for human breast cancer cells to maintain higher rates of proliferation, clone formation, and invasion. In summary, our study revealed that COX7AR is a stress-inducible mitochondrial COX subunit that facilitates human breast cancer malignancy. These findings have important implications in the understanding and treatment of human breast cancer and the diseases associated with mitochondrial energy metabolism. PMID:27550821

  10. Anatomy of an Inversion - Argon Isotopes

    Science.gov (United States)

    Zamick, L.; Sharon, Y. Y.; Robinson, S. J. Q.

    2012-02-01

    Two different interactions give similar results for excitation energies and g factors of 2+1 states for most even-even argon isotopes except 46Ar. This is explained in terms of an inversion in J = ½+ and levels in 47K which is successfully obtained by one of the interactions but not the other. This example shows the possible dangers of nuclear astrophysics extrapolations.

  11. Chain Teleportation

    OpenAIRE

    Lee, Chien-er

    2004-01-01

    By means of the idea of measurements on the crossed space-time nonlocal observables, we extend the mechanism for the two-way quantum teleportation to the chain teleportation among N spatially separated spin-1/2 systems. Since in the process only the local interactions are used, the microcausality is automatically satisfied.

  12. The readout system for the ArTeMis camera

    Science.gov (United States)

    Doumayrou, E.; Lortholary, M.; Dumaye, L.; Hamon, G.

    2014-07-01

    During ArTeMiS observations at the APEX telescope (Chajnantor, Chile), 5760 bolometric pixels from 20 arrays at 300mK, corresponding to 3 submillimeter focal planes at 450μm, 350μm and 200μm, have to be read out simultaneously at 40Hz. The read out system, made of electronics and software, is the full chain from the cryostat to the telescope. The readout electronics consists of cryogenic buffers at 4K (NABU), based on CMOS technology, and of warm electronic acquisition systems called BOLERO. The bolometric signal given by each pixel has to be amplified, sampled, converted, time stamped and formatted in data packets by the BOLERO electronics. The time stamping is obtained by the decoding of an IRIG-B signal given by APEX and is key to ensure the synchronization of the data with the telescope. Specifically developed for ArTeMiS, BOLERO is an assembly of analogue and digital FPGA boards connected directly on the top of the cryostat. Two detectors arrays (18*16 pixels), one NABU and one BOLERO interconnected by ribbon cables constitute the unit of the electronic architecture of ArTeMiS. In total, the 20 detectors for the tree focal planes are read by 10 BOLEROs. The software is working on a Linux operating system, it runs on 2 back-end computers (called BEAR) which are small and robust PCs with solid state disks. They gather the 10 BOLEROs data fluxes, and reconstruct the focal planes images. When the telescope scans the sky, the acquisitions are triggered thanks to a specific network protocol. This interface with APEX enables to synchronize the acquisition with the observations on sky: the time stamped data packets are sent during the scans to the APEX software that builds the observation FITS files. A graphical user interface enables the setting of the camera and the real time display of the focal plane images, which is essential in laboratory and commissioning phases. The software is a set of C++, Labview and Python, the qualities of which are respectively used

  13. 40Ar/ 39Ar mineral ages from basement rocks in the Eastern Kunlun Mountains, NW China, and their tectonic implications

    Science.gov (United States)

    Liu, Yongjiang; Genser, Johann; Neubauer, Franz; Jin, Wei; Ge, Xiaohong; Handler, Robert; Takasu, Akira

    2005-04-01

    40Ar/ 39Ar dating and estimates of regional metamorphic P- T conditions were carried out on the basement rocks of the Eastern Kunlun Mountains, Western China. Samples from the Jinshuikou, Xiaomiao, Kuhai, Wanbaogou, and Nachitai groups revealed distinct metamorphic events and four age groups. The age group in the range from 363 to 439 Ma is interpreted to represent cooling after Middle Silurian-Late Devonian granulite(?) and amphibolite facies metamorphism, which is dominated by low-middle pressure/high temperature conditions. This tectono-thermal event is related to the closure of an oceanic basin or marginal sea. An age group of 212-242 Ma represents cooling after Triassic metamorphic overprint, which is probably associated with magmatic intrusions. This thermal event, together with the Permo-Triassic ophiolite zone along the South Kunlun Fault, relates to the closure of a major ocean (between India and Eurasia) and the eventual N-ward accretion of the Qiangtang block in Permo-Triassic times. The significance of the age group of 104-172 Ma may be related to the ductile deformation along the Xidatan fault due to the northward-directed accretion of the Lhasa block. Biotites from Nachitai record a partial isotopic resetting at ca. 32 Ma that is interpreted to represent a late-stage exhumation caused by further crustal shortening.

  14. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Science.gov (United States)

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  15. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    Index Scriptorium Estoniae

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  16. Isotope Spectroscopy

    CERN Document Server

    Caffau, E; Bonifacio, P; Ludwig, H -G; Monaco, L; Curto, G Lo; Kamp, I

    2013-01-01

    The measurement of isotopic ratios provides a privileged insight both into nucleosynthesis and into the mechanisms operating in stellar envelopes, such as gravitational settling. In this article, we give a few examples of how isotopic ratios can be determined from high-resolution, high-quality stellar spectra. We consider examples of the lightest elements, H and He, for which the isotopic shifts are very large and easily measurable, and examples of heavier elements for which the determination of isotopic ratios is more difficult. The presence of 6Li in the stellar atmospheres causes a subtle extra depression in the red wing of the 7Li 670.7 nm doublet which can only be detected in spectra of the highest quality. But even with the best spectra, the derived $^6$Li abundance can only be as good as the synthetic spectra used for their interpretation. It is now known that 3D non-LTE modelling of the lithium spectral line profiles is necessary to account properly for the intrinsic line asymmetry, which is produced ...

  17. Excess Ar-40 in the Zagami Shergottite: Does It Reveal Crystallization History?

    Science.gov (United States)

    Bogard, Donald D.; Park, Jisun

    2007-01-01

    The Zagami basaltic shergottite has fine- and coarse-grained (FG & CG) areas, which may reflect partial crystallization in a deep, slowly cooled magma chamber to form Mg-rich pyroxene cores, followed by entrainment of these crystals into a magma that rose and crystallized near the surface. Late-stage melt pockets formed mesostasis and feldspar (maskelynite) having a range of compositions, but low water abundance. Higher I(sub Sr) in the FG portion may result from the second stage having incorporated old crustal rocks that failed to reach isotopic equilibrium. Zagami, like other shergottites, contains excess Ar-40(sub xs) beyond that expected from internal decay of K-40 during its Sm-Nd age of 177 Myr. We suggest that at least a portion of this Ar-40(sub xs) in Zagami and some other shergottites was inherited from the magma, much as is the case of MORBs on Earth. We made Ar-39-Ar-40 age determinations on feldspar and pyroxene separates from both the FG and CG portions of Zagami. If Zagami experienced an evolving fractional crystallization history, including possible crustal contamination of the magma, that might be indicated in differing amounts of Ar-40(sub xs) between mineral phases and between FG and CG portions.

  18. Ars ornata / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  19. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Index Scriptorium Estoniae

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  20. Differential AR algorithm for packet delay prediction

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Different delay prediction algorithms have been applied in multimedia communication, among which linear prediction is attractive because of its low complexity. AR (auto regressive) algorithm is a traditional one with low computation cost, while NLMS (normalize least mean square) algorithm is more precise. In this paper, referring to ARIMA (auto regression integrated with moving averages) model, a differential AR algorithm (DIAR) is proposed based on the analyses of both AR and NLMS algorithms. The prediction precision of the new algorithm is about 5-10 db higher than that of the AR algorithm without increasing the computation complexity.Compared with NLMS algorithm, its precision slightly improves by 0.1 db on average, but the algorithm complexity reduces more than 90%. Our simulation and tests also demonstrate that this method improves the performance of the average end-to-end delay and packet loss ratio significantly.

  1. "Ars Ornata" Mediterrania / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  2. 40Ar-39Ar Age of K-feldspar from K- feldspar Granite in the Qiaohuote Copper Deposit, Bayanbulak, Xinjiang, and Its Geological Significance

    Institute of Scientific and Technical Information of China (English)

    WANG Zhiliang; MAO Jingwen; YANG Jianmin; CHEN Wen; ZHANG Zuoheng

    2004-01-01

    By using the 40Ar-39Ar chronological method to date K-feldspar from K-feldspar granite in the Qiaohuote copper district, the authors obtained a plateau age of 274.78±0.44 Ma and an isochron age of 272.7±3.0 Ma. Because there is no tectonic deformation overprinted or hydrothermal alteration in the K-feldspar granite intrusion after its emplacement, the 40Ar-39Ar age represents the crystallization age of K-feldspar in K-feldspar granite, i.e. the late crystallization age of the K-feldspar granite intrusion, which indicates that the K-feldspar granite formed in the intraplate extensional stage during the Early Permian. Moreover, based on the spatial relationship between the K-feldspar granite intrusion and copper orebodies, variations of copper ore grade, REE characteristics of K-feldspar granite and copper ores, and H and O isotopic compositions of fluid inclusions in copper ores, the metallogenesis of the Qiaohuote copper deposit is directly related to intrusive activities of the K-feldspar granite, and thus the crystallization age of K-feldspar in the granite approximately approaches the metallogenic epoch of the Qiaohuote copper deposit.

  3. Droplet Digital PCR Based Androgen Receptor Variant 7 (AR-V7) Detection from Prostate Cancer Patient Blood Biopsies

    Science.gov (United States)

    Ma, Yafeng; Luk, Alison; Young, Francis P.; Lynch, David; Chua, Wei; Balakrishnar, Bavanthi; de Souza, Paul; Becker, Therese M.

    2016-01-01

    Androgen receptor splice variant V7 (AR-V7) was recently identified as a valuable predictive biomarker in metastatic castrate-resistant prostate cancer. Here, we report a new, sensitive and accurate screen for AR-V7 mRNA expression directly from circulating tumor cells (CTCs): We combined EpCAM-based immunomagnetic CTC isolation using the IsoFlux microfluidic platform with droplet digital polymerase chain reaction (ddPCR) to analyze total AR and AR-V7 expression from prostate cancer patients CTCs. We demonstrate that AR-V7 is reliably detectable in enriched CTC samples with as little as five CTCs, even considering tumor heterogeneity, and confirm detection of AR-V7 in CTC samples from advanced prostate cancer (PCa) patients with AR-V7 detection limited to castrate resistant disease status in our sample set. Sensitive molecular analyses of circulating tumor cells (CTCs) or circulating tumor nucleic acids present exciting strategies to detect biomarkers, such as AR-V7 from non-invasive blood samples, so-called blood biopsies. PMID:27527157

  4. Droplet Digital PCR Based Androgen Receptor Variant 7 (AR-V7 Detection from Prostate Cancer Patient Blood Biopsies

    Directory of Open Access Journals (Sweden)

    Yafeng Ma

    2016-08-01

    Full Text Available Androgen receptor splice variant V7 (AR-V7 was recently identified as a valuable predictive biomarker in metastatic castrate-resistant prostate cancer. Here, we report a new, sensitive and accurate screen for AR-V7 mRNA expression directly from circulating tumor cells (CTCs: We combined EpCAM-based immunomagnetic CTC isolation using the IsoFlux microfluidic platform with droplet digital polymerase chain reaction (ddPCR to analyze total AR and AR-V7 expression from prostate cancer patients CTCs. We demonstrate that AR-V7 is reliably detectable in enriched CTC samples with as little as five CTCs, even considering tumor heterogeneity, and confirm detection of AR-V7 in CTC samples from advanced prostate cancer (PCa patients with AR-V7 detection limited to castrate resistant disease status in our sample set. Sensitive molecular analyses of circulating tumor cells (CTCs or circulating tumor nucleic acids present exciting strategies to detect biomarkers, such as AR-V7 from non-invasive blood samples, so-called blood biopsies.

  5. Geometry behind chordal Loewner chains

    CERN Document Server

    Contreras, Manuel D; Gumenyuk, Pavel

    2010-01-01

    Loewner Theory is a deep technique in Complex Analysis affording a basis for many further important developments such as the proof of famous Bieberbach's conjecture and well-celebrated Schramm's Stochastic Loewner Evolution (SLE). It provides analytic description of expanding domains dynamics in the plane. Two cases have been developed in the classical theory, namely the {\\it radial} and the {\\it chordal} Loewner evolutions, referring to the associated families of holomorphic self-mappings being normalized at an internal or boundary point of the reference domain, respectively. Recently there has been introduced a new approach [arXiv:0807.1594v1, arXiv:0807.1715v1, arXiv:0902.3116v1] bringing together, and containing as quite special cases, radial and chordal variants of Loewner Theory. In the framework of this approach we address the question what kind of systems of simply connected domains can be described by means of Loewner chains of chordal type. As an answer to this question we establish a necessary and ...

  6. The mass of $^{32}Ar$ and $^{33}Ar$ for fundamental tests

    CERN Document Server

    Blaum, K; Beck, D; Bollen, G; Herfurth, F; Kellerbauer, A G; Kluge, H J; Sauvan, E; Schwarz, S

    2003-01-01

    Masses of the short-lived radionuclides ^32Ar (T_1/2=98 ms) and ^33Ar (T_1/2=173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10_-8 (deltam=1.8 keV) and 1.4 x 10_-8 (deltam=0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaric-multiplet mass equation IMME. Furthermore, the improved accuracy for the mass of ^32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for ^44Ar and ^45Ar, and a 20sigma deviation for ^44Ar from the literature value was found and interpreted.

  7. 40Ar/39Ar Data for White Mica, Biotite, and K-Feldspar Samples from Low-Grade Metamorphic Rocks in the Westminster Terrane and Adjacent Rocks, Maryland

    Science.gov (United States)

    Kunk, Michael J.; McAleer, Ryan

    2008-01-01

    This report contains reduced 40Ar/39Ar data of white mica and K-feldspar mineral separates and matrix of a whole rock phyllite, all from low-grade metamorphic rocks of the Westminster terrane and adjacent strata in central Maryland. This report presents these data in a preliminary form, but in more detail than can be accommodated in todays professional journals. Also included in this report is information on the location of the samples and a brief description of the samples. The data contained herein are not interpreted in a geological context, and care should be taken by readers unfamiliar with argon isotopic data in the use of these results; many of the individual apparent ages are not geologically meaningful. This report is primarily a detailed source document for subsequent publications that will integrate these data into a geological context.

  8. Catch Chain

    OpenAIRE

    Talbert, Robert

    2010-01-01

    Catch Chain is a book of poems that traces the journey of a Corrections Officer who attempts to combat issues of isolation, inhumane treatment of inmates and societal rejection in jails by embarking upon a cross-country road trip. However, the same issues the officer initially wrestled with begin cropping up in different cities, on various highways and in a multitude of states. The excitement and adventure of the open road runs parallel to the recurring imprisonment of the guard's mind.

  9. Noble gas isotopic composi-tions of deep carbonate rocks from the Tarim Basin

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Abundances and isotopic compositions of noble gases (He, Ne, Ar, Kr) with various existence states in carbonate rocks from the Tacanl Well have been investigated by means of the stepwise heating technique. The elemental abundance patterns of noble gases in the samples show the enrichment of heavy noble gases and depletion of 20Ne relative to the atmosphere, which are designated as type- I and are similar to that observed in water, natural gases and sedimentary rocks. The 3He/4He ratios of deep carbonate samples at lower and medium temperature (300-700℃) and a majority of samples at higher temperature (1100-1500℃) steps are very similar to those of natural gases in the same strata in this area, this feature of radiogenic crustal helium shows that the Tazhong Uplift is relatively stable.However, significant helium and argon isotopic anomalies are found at the 1100℃ step in the Middle-Upper Ordoviclan carbonate rock, suggesting the incorporation of manfie-derived volatiles, this may be due to minor igneous minerals contained in sedimentary carbonate rocks. The 40Ar/36Ar ratios in the Cambrian carbonate rock are slightly higher than those in Ordovician carbonate rocks, which may reflect the influence of the chronologic accumulation effect of crust radiogenic 40Ar. Argon isotopes of various existence states in source rocks are much more different, both 38Ar/36Ar and 40Ar/36Ar ratios at the higher temperature steps are higher than those at the lower temperature steps.``

  10. Water isotope characteristics of landfalling atmospheric rivers in California

    Science.gov (United States)

    Mix, H.; Reilly, S. P.; Martin, A.; Kawzenuk, B.

    2015-12-01

    Atmospheric rivers (ARs) are a defining feature of mid-latitude water vapor transport, responsible for 30-50% of the precipitation delivered to the western US on an annual basis. Despite the growing number of intra-event stable isotope studies, water isotope time series has only been examined for a single AR event to date. Here, we present hourly oxygen and hydrogen isotopes in precipitation for two AR events: 1) A December 10-12 event, collected in Santa Clara, CA; and 2) Four precipitation time series collected during the February 6-8 AR event in Cazadero, CA. During the December event, δ18O values decrease steadily from ~ -2 to ~ -20 ‰, with the exception of the 6 hours leading to the passage of the cold front at the surface. During this period, d-excess values decreases by 10-15 ‰, consistent with a transition between multiple moisture sources. Three of four February precipitation events exhibit V-shapes of up to 6 ‰ in δ18O values. Such patterns have been observed in a prior AR event as well as other mid-latitude cyclones, and may reflect changes in post-condensation exchange related to cold front passage. Future work will incorporate additional meteorological in-situ and satellite-derived observations in order to gain insight into the atmospheric river dynamics.

  11. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    International Nuclear Information System (INIS)

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  12. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  13. Robust 24 ± 6 ka 40Ar/39Ar age of a low-potassium tholeiitic basalt in the Lassen region of NE California

    Science.gov (United States)

    Turrin, Brent D.; Muffler, L. J. Patrick; Clynne, Michael A.; Champion, Duane E.

    2007-01-01

    40Ar/39Ar ages on the Hat Creek Basalt (HCB) and stratigraphically related lava flows show that latest Pleistocene tholeiitic basalt with very low K2O can be dated reliably. The HCB underlies ∼ 15 ka glacial gravel and overlies four andesite and basaltic andesite lava flows that yield 40Ar/39Ar ages of 38 ± 7 ka (Cinder Butte; 1.65% K2O), 46 ± 7 ka (Sugarloaf Peak; 1.85% K2O), 67 ± 4 ka (Little Potato Butte; 1.42% K2O) and 77 ± 11 ka (Potato Butte; 1.62% K2O). Given these firm age brackets, we then dated the HCB directly. One sample (0.19% K2O) clearly failed the criteria for plateau-age interpretation, but the inverse isochron age of 26 ± 6 ka is seductively appealing. A second sample (0.17% K2O) yielded concordant plateau, integrated (total fusion), and inverse isochron ages of 26 ± 18, 30 ± 20 and 24 ± 6 ka, all within the time bracket determined by stratigraphic relations; the inverse isochron age of 24 ± 6 ka is preferred. As with all isotopically determined ages, confidence in the results is significantly enhanced when additional constraints imposed by other isotopic ages within a stratigraphic context are taken into account.

  14. Monazite and allanite U-Th-Pb vs mica 39Ar-40Ar ages in equilibrated metasediments: closure behavior and closure temperatures

    Science.gov (United States)

    Allaz, J.; Engi, M.; Berger, A.; Janots, E.; Villa, I. M.

    2009-12-01

    The art of geochronology implies identification of processes, so as to correctly interpret an isotopic age as (1) crystallization, (2) cooling, or (3) meaningless owing to inheritance and/or late mineral recrystallization. We address here a field calibration of 39Ar-40Ar ages against U-Th-Pb ages. We demonstrate that detailed petrological, micro-textural and micro-chemical investigations are a necessary prerequisite for meaningful geochronology. The Barrovian metamorphism in the Alps results from the collision of Europe and Apulia and reaches its thermal maximum (upper amphibolite facies) in the Central Alps. Age estimates for the Alpine orogeny have long been controversial, despite a multitude of studies. Based on the resetting of Rb-Sr and K-Ar ages in muscovite from polymetamorphic gneisses, Jäger [1] had proposed an age of 38±2 Ma for the Barrovian metamorphism, corresponding to a “closure temperature TC” (following [2]) of 350 °C for K-Ar in muscovite. However, a uniform Eocene age for the metamorphism in the Central Alps was in conflict already with early monazite and xenotime U-Pb ages from the same area, namely 30 Ma in the southern, and ~20 Ma in the northern part (e.g. [3]). A recent study [4] both confirmed the young monazite ages in the north (SHRIMP U-Pb of 18-19 Ma near Tmax = 570 °C), and demonstrated that ca. 30 Ma ago this part of the belt was still heating up, as allanite grew prograde near 440 °C. These results once more prove isotopic inheritance, and therefore underestimation of mica K-Ar TC, in Jäger’s [1] samples. To avoid isotopic inheritance problems we selected only Mesozoic metasediments from the northern Central Alps. We screened all samples by PTAX: many had undergone a variety of retrogression reactions and calculations show petrological disequilibrium; we favored those in near-ideal petrological equilibrium. 39Ar-40Ar ages for mica separates from equilibrium samples yield ages between 18.93±0.83 and 15.79±0.11 Ma for

  15. The rare gases isotopes used in geophysical studies

    International Nuclear Information System (INIS)

    Rare gas isotopes are largely used in many studies regarding the different aspects of the geophysical and geochemical processes happening at geological and cosmological time scale. In the Herculane Spa area (southwestern part of Romania) there is a long and deep fissure following the Cerna river canyon as well as many transversal fissures. The geothermal water sources (springs), always accompanied by large amounts of gases, are met where these fissures cross. The presence of granite rocks at the surface is another remarkable characteristic of this area. Between 1980-1990 a series of measurements were made especially regarding the helium concentration in the gases released from these geothermal sources. Nitrogen and methane are the main components of released gases, and high helium and radon concentrations were also found. The composition of the gases was determined by using a Dempster mass spectrometer, and the radon from gases (together with the rate of exhalation from the ground) was determined by gamma spectrometry. The argon isotopes were analyzed by means of quadrupole mass spectrometer (AMP-4). Near transversal fissures, the radon exhalation rates have higher values compared to the other measurements in this area. The ratio 4 He/20 Ne > 400 is a very good indicator of the fact that these gases are pure (they do not contain atmospheric air) and they come from depth. The ratios 4 He/40 Ar and 40 Ar/36 Ar suggest that the helium in these sources may have a not negligible part of primordial helium arising from the earth mantle. Still, only the ratio 3 He/4 He can make difference. A table is given containing the ratios 4 He/20 Ne, 4 He/N2, 4 He/40 Ar, 40 Ar/N2, 40 Ar/36 Ar and 38 Ar/36 Ar as measured in four places from Cerna and Mehadica Valleys. (authors)

  16. Isotope uptake dynamics in the Ostwald ripening model of recrystallization

    OpenAIRE

    Lakshtanov, Evgeny; Lakshtanov, Leonid

    2011-01-01

    The article is withdrawn since we decided not to publish it in the present form but to divide it in two parts. One of these parts concerns the mathematical aspects of Return Radius calculation and the rewritten article is already available arXiv:1201.4492 The second part will discuss the modelling of the Isotope Uptake and is still in preparation

  17. A late Miocene-early Pliocene chain of lakes fed by the Colorado River: Evidence from Sr, C, and O isotopes of the Bouse Formation and related units between Grand Canyon and the Gulf of California

    Science.gov (United States)

    Roskowski, J.A.; Patchett, P.J.; Spencer, J.E.; Pearthree, P.A.; Dettman, D.L.; Faulds, J.E.; Reynolds, A.C.

    2010-01-01

    We report strontium isotopic results for the late Miocene Hualapai Limestone of the Lake Mead area (Arizona-Nevada) and the latest Miocene to early Pliocene Bouse Formation and related units of the lower Colorado River trough (Arizona-California-Nevada), together with parallel oxygen and carbon isotopic analyses of Bouse samples, to constrain the lake-overflow model for integration of the Colorado River. Sr iso topic analyses on the basal 1-5 cm of marl, in particular along a transect over a range of altitude in the lowest-altitude basin that contains freshwater, brackish, and marine fossils, document the 87Sr/86Sr of first-arriving Bouse waters. Results reinforce the similarity between the 87Sr/86Sr of Bouse Formation carbonates and present-day Colorado River water, and the systematic distinction of these values from Neogene marine Sr. Basal Bouse samples show that 87Sr/86Sr decreased from 0.7111 to values in the range 0.7107-0.7109 during early basin filling. 87Sr/86Sr values from a recently identified marl in the Las Vegas area are within the range of Bouse Sr ratios. 87Sr/86Sr values from the Hualapai Limestone decrease upsection from 0.7195 to 0.7137, in the approach to a time soon after 6 Ma when Hualapai deposition ceased and the Colorado River became established through the Lake Mead area. Bouse Formation ??18O values range from -12.9??? to +1.0??? Vienna Pee Dee belemnite (VPDB), and ??13C between -6.5??? and +3.4??? VPDB. Negative ??18O values appear to require a continental origin for waters, and the trend to higher ??18O suggests evaporation in lake waters. Sr and stable isotopic results for sectioned barnacle shells and from bedding planes of the marine fish fossil Colpichthys regis demonstrate that these animals lived in saline freshwater, and that there is no evidence for incursions of marine water, either long-lived or brief in duration. Lack of correlation of Sr and O isotopic variations in the same samples also argue strongly against systematic

  18. Spectroscopy of element 115 decay chains

    Energy Technology Data Exchange (ETDEWEB)

    Rudolph, Dirk [Lund University, Sweden; Forsberg, U. [Lund University, Sweden; Golubev, P. [Lund University, Sweden; Sarmiento, L. G. [Lund University, Sweden; Yakushev, A. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Andersson, L.-L. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Di Nitto, A. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Duehllmann, Ch. E. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Gates, J. M. [Lawrence Berkeley National Laboratory (LBNL); Gregorich, K. E. [Lawrence Berkeley National Laboratory (LBNL); Gross, Carl J [ORNL; Hessberger, F. P. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Herzberg, R.-D [University of Liverpool; Khuyagbaatar, J. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Kratz, J. V. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Rykaczewski, Krzysztof Piotr [ORNL; Schaedel, M. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Aberg, S. [Lund University, Sweden; Ackermann, D. [GSI-Hemholtzzentrum fur Schwerionenforschung, Darmstadt, Germany; Block, M. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Brand, H. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Carlsson, B. G. [Lund University, Sweden; Cox, D. [University of Liverpool; Derkx, X. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Eberhardt, K. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Even, J. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Fahlander, C. [Lund University, Sweden; Gerl, J. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Jaeger, E. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Kindler, B. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Krier, J. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Kojouharov, I. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Kurz, N. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Lommel, B. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Mistry, A. [University of Liverpool; Mokry, C. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Nitsche, H. [Lawrence Berkeley National Laboratory (LBNL); Omtvedt, J. P. [Paul Scherrer Institut, Villigen, Switzerland; Papadakis, P. [University of Liverpool; Ragnarsson, I. [Lund University, Sweden; Runke, J. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Schaffner, H. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Schausten, B. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Thoerle-Pospiech, P. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Torres, T. [Gesellschaft fur Schwerionenforschung (GSI), Germany; Traut, T. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Trautmann, N. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany; Tuerler, A. [Paul Scherrer Institut, Villigen, Switzerland; Ward, A. [University of Liverpool; Ward, D. E. [Lund University, Sweden; Wiehl, N. [Johannes Gutenberg-Universitaet Mainz, Mainz, Germany

    2013-01-01

    A high-resolution a, X-ray and -ray coincidence spectroscopy experiment was conducted at the GSI Helmholtzzentrum fu r Schwerionenforschung. Thirty correlated a-decay chains were detected following the fusion-evaporation reaction 48Ca + 243Am. The observations are consistent with previous assignments of similar decay chains to originate from element Z = 115. The data includes first candidates of fingerprinting the decay step Mt --> Bh with characteristic X rays. For the first time, precise spectroscopy allows the derivation of excitation schemes of isotopes along the decay chains starting with elements Z > 112. Comprehensive Monte-Carlo simulations accompany the data analysis. Nuclear structure models provide a first level interpretation.

  19. Argon systematics of neutron irradiated submarine basalt glasses from the deep south rift zone of Loihi seamount and the {sup 40}Ar/{sup 36}Ar ratio of the Hawaiian plume source

    Energy Technology Data Exchange (ETDEWEB)

    Trieloff, M.; Falter, M. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Jessberger, E.K. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany)]|[Muenster Univ. (Germany). Inst. fuer Planetologie

    1998-12-31

    Submarine basalt glasses from Loihi seamount dredged at the southern rift zone between 3 and 5 km depth were studied. These glasses contain neon with the highest {sup 20}Ne/{sup 22}Ne ratios measured so far in submarine volcanics and constrain a well defined correlation line in a Ne-3-isotope plot (Valbracht et al., 1997). Within this study that focussed on argon isotopes an increased resolution regarding temperature and crushing steps was used: High {sup 40}Ar/{sup 36}Ar ratios at intermediate temperatures and in several crushing steps were measured which are related to argon from vesicle populations containing the most pristine mantle signature. This argon is highly improbable to be related to olivine phenocrysts and a possible contamination by MORB type noble gases. Our best constraint on the argon isotopic composition of the Loihi glasses is {sup 40}Ar/{sup 36}Ar=6590{+-}840, providing a lower limit of >5750 for the Hawaiian lower mantle source, further attesting its partially degassed nature concerning primordial noble gases. The argon distribution in the investigated Loihi glasses shows characteristic features very similar to MORB glasses. The isotopic composition of vesicle argon released by crushing covers the complete range between the atmospheric and the mantle endmember. In low vesicularity glasses mantle argon shows a nearly perfect correlation with the glass dissolved, neutron induced argon isotopes in the course of stepheating, while in glasses of higher vesicularity mantle argon partitioned into the vesicles. This is independently confirmed by the comparison of the argon yield by crushing and heating. On the other hand, the stepheating release pattern of the atmospheric component does hardly correlate with glass dissolved argon, independent on vesicularity. A significant fraction of the atmospheric contaminant is related to vesicles and pyroxene microlites, and is moreover associated with microdefects or, alternatively, is inhomogeneously distributed

  20. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    OpenAIRE

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This is an Operating System Setup Guide. This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  1. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    International Nuclear Information System (INIS)

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  2. Laser Isotope Enrichment for Medical and Industrial Applications

    Energy Technology Data Exchange (ETDEWEB)

    Leonard Bond

    2006-07-01

    Laser Isotope Enrichment for Medical and Industrial Applications by Jeff Eerkens (University of Missouri), Jay Kunze (Idaho State University), and Leonard Bond (Idaho National Laboratory) The principal isotope enrichment business in the world is the enrichment of uranium for commercial power reactor fuels. However, there are a number of other needs for separated isotopes. Some examples are: 1) Pure isotopic targets for irradiation to produce medical radioisotopes. 2) Pure isotopes for semiconductors. 3) Low neutron capture isotopes for various uses in nuclear reactors. 4) Isotopes for industrial tracer/identification applications. Examples of interest to medicine are targets to produce radio-isotopes such as S-33, Mo-98, Mo-100, W-186, Sn-112; while for MRI diagnostics, the non-radioactive Xe-129 isotope is wanted. For super-semiconductor applications some desired industrial isotopes are Si-28, Ga-69, Ge-74, Se-80, Te-128, etc. An example of a low cross section isotope for use in reactors is Zn-68 as a corrosion inhibitor material in nuclear reactor primary systems. Neutron activation of Ar isotopes is of interest in industrial tracer and diagnostic applications (e.g. oil-logging). . In the past few years there has been a sufficient supply of isotopes in common demand, because of huge Russian stockpiles produced with old electromagnetic and centrifuge separators previously used for uranium enrichment. Production of specialized isotopes in the USA has been largely accomplished using old ”calutrons” (electromagnetic separators) at Oak Ridge National Laboratory. These methods of separating isotopes are rather energy inefficient. Use of lasers for isotope separation has been considered for many decades. None of the proposed methods have attained sufficient proof of principal status to be economically attractive to pursue commercially. Some of the authors have succeeded in separating sulfur isotopes using a rather new and different method, known as condensation

  3. Modeling Augmented Reality User Interfaces with SSIML/AR

    Directory of Open Access Journals (Sweden)

    Arnd Vitzthum

    2006-06-01

    Full Text Available Augmented Reality (AR technologies open up new possibilities especially for task-focused domains such as assembly and maintenance. However, it can be noticed that there is still a lack of concepts and tools for a structured AR development process and an application specification above the code level. To address this problem we introduce SSIML/AR, a visual modeling language for the abstract specification of AR applications in general and AR user interfaces in particular. With SSIML/AR, three different aspects of AR user interfaces can be described: The user interface structure, the presentation of relevant information depending on the user’s current task and the integration of the user interface with other system components. Code skeletons can be generated automatically from SSIML/AR models. This enables the seamless transition from the design level to the implementation level. In addition, we sketch how SSIML/AR models can be integrated in an overall AR development process.

  4. 胶东金青顶金矿床成矿流体来源的黄铁矿微量元素及He-Ar同位素证据%Trace element and He-Ar isotopic evidence of pyrite for the source of oreforming fluids in the Jinqingding gold deposit, eastern Shandong Province

    Institute of Scientific and Technical Information of China (English)

    张运强; 李胜荣; 陈海燕; 张秀宝; 周起凤; 崔举超; 宋玉波; 郭杰

    2012-01-01

    The Jinqingding gold deposit with identified reserves of more than 50t is currently the largest lode gold deposit in terms of single vein gold resources and is also a superlarge gold deposit located in the middle part of the Muping- Rushan gold belt in Jiaodong; nevertheless, the genetic type and source of ore-forming fluids in the gold deposit constitute a problem that needs urgent solution. A study of trace elements and REE compositions and features of gold-bearing pyrite from No. II ore body of the Jinqingding gold deposit reveals that the pyrite displays hydrothermal characteristics with Co/Ni ratios from 2.317 to 11.734 (7.17 on average). The HFSE indicates that the ore-forming fluid originally belonged to the F-rich system and generally evolved into the Cl- rich system at the chief metallogenic stage, and the distribution patterns of REE shows that the source of matallogenic materials was not mainly from Mesozoic Kunyunshan monzonitic granite. According to an analysis of the characteristic parameters (3He/4He =0.1-2.2 Ra (0.60 Ra on average)),40Ar/36Ar =462.7-1507.5 (831 on average), it is considered that the source of matallogenic materials was mainly derived from the lower crust and was contaminated by meteoric water during the intrusion, and the mantle fluids were involved in the metallogenic process.%金青顶金矿床是目前国内最大的石英单脉型金矿,其金储量超过50 t,规模为大型.对该矿床成矿流体性质和来源的研究十分必要.笔者通过Ⅱ号矿体主要载金矿物黄铁矿微量元素的研究发现,其Co/Ni为2.317~11.734(平均7.17),显示主要为热液成因;高场强元素(HFSE)特征显示,成矿早期以富F流体为主,主成矿期以富C1流体为主;稀土配分模式显示成矿物质并不是直接来源于围岩昆嵛山二长花岗岩.对黄铁矿流体包裹体He、Ar同位素特征的研究表明,3He/4He、40Ar/36Ar分别为0.1~2.2 Ra(平均值0.60 Ra),462.7~1 507.5(平均值831),显示成

  5. 40Ar-39Ar dating and tectonic implications of volcanic rocks recovered at IODP Hole U1342A and D on Bowers Ridge, Bering Sea

    Science.gov (United States)

    Sato, Keiko; Kawabata, Hiroshi; Scholl, David W.; Hyodo, Hironobu; Takahashi, Kozo; Suzuki, Katsuhiko; Kumagai, Hidenori

    2016-03-01

    During the Integrated Ocean Drilling Program (IODP), a total of 41.54 m of basement rock, consolidated volcaniclastic sediment, was recovered beneath a thin sediment cover. The drilled site is at the eastern end of the crestal area of Bowers Ridge, a north and westward sweeping offshoot of the Aleutian Arc into the Bering Sea. The volcanic sequence recovered from Holes U1342A and U1342D was divided into six major lithologic units. We used the single grain 40Ar-39Ar dating method performed by step-wise heated laser fusion technique to date andesites of Unit 1. Thereby two ages of Oligocene volcanism (34-32 Ma, 28-26 Ma) were distinguished each other according to our 40Ar-39Ar data. These ages refute a hypothesized Cretaceous origin in the North Pacific as an exotic arc massif or sector of the Hawaiian-Emperor chain and indicate that the Bowers Ridge is a Bering-Sea formed arc or remnant arc that ceased forming in the latest Oligocene to the earliest Miocene time.

  6. GEOCHRONOMETRY & ISOTOPE GEOLOGY

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    <正>20091213 Deng Xiaodong(State Key Laboratory of Geological Processes and Mineral Resources, China University of Geosciences, Wuhan 430074,China);Li Jianwei 40Ar/ 39Ar Geochronology of Weathering Crust: Significance,Problems,and Prospect(Geo-

  7. Accurate and precise 40Ar/39Ar dating by high-resolution, multi-collection, mass spectrometry

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie

    analog enabling precise measurement of very small 36Ar signals for accurate correction for atmospheric-derived 40Ar; (iii) higher mass resolution allows pseudo resolution of hydrocarbon isobaric interferences from 36Ar through to 40Ar; (iv) multi-collection, allowing more data to be gathered in a fixed...

  8. Neutrino Capture Reactions on $^{40}$Ar

    CERN Document Server

    Suzuki, Toshio

    2012-01-01

    Gamow-Teller (GT) strength in $^{40}$Ar is studied by shell-model calculations with monopole-based universal intearction, which has tensor components of $\\pi$\\rho$-meson exchanges. Calculated GT strength is found to be consistent with the experimental data obtained by recent ($p, n$) reactions. Neutrino capture cross sections on $^{40}$Ar for solar neutrinos from $^{8}$B are found to be enhanced compared with previous calculations. The reaction cross sections for multipoles other than $0^{+}$ and $1^{+}$ are obtained by random-phase approximation (RPA). Their contributions become important for neutrino energies larger than 50 MeV.

  9. Improved Ar(II) transition probabilities

    OpenAIRE

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  10. AR-扩增实境

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  11. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Science.gov (United States)

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  12. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Science.gov (United States)

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  13. Retrograde metamorphism of the eclogite in North Qaidam, western China:Constraints by joint 40Ar/39Ar in vacuo crushing and stepped heating

    Institute of Scientific and Technical Information of China (English)

    Rongguo Hu; Jan Wijbrans; Fraukje Brouwer; Linghao Zhao; Min Wang; Huaning Qiu

    2015-01-01

    Two amphiboles and a syn-metamorphic quartz vein from the Yuka terrane, North Qaidam, western China, have been analyzed by joint 40Ar/39Ar crushing in vacuo and stepwise heating techniques. The crushing in vacuo results provide information to directly constrain the timing of fluid activity and the age of amphibolite-facies retrogression. The stepwise heating results could further be used to decipher the thermal history of the UHP rocks. Amphiboles from amphibolites and quartz vein within garnet-amphibolite lens analyzed by in vacuo crushing yield similarly shaped age spectra and exhibit rela-tively flat age plateaus for the last several steps. The characteristics of gas release patterns and geochronological data testify to the presence of significant excess 40Ar within the fluid inclusions. The age plateaux with weighted mean ages (WMA) ranges from 488 to 476 Ma for amphiboles and 403 Ma for quartz (2s). These data points constitute amphibole WMA yielding excellent isochrons with isochron ages of 469 and 463 Ma with initial 40Ar/36Ar ratios of 520 and 334, respectively. The isochron ages are interpreted to represent initial amphibolite-facies retrogression. The data points constituting the quartz age plateaux give an isochron age of 405 Ma with initial 40Ar/36Ar ratio of 295, recording a significant aqueous fluid flow episode during the early Devonian. Age spectra obtained by stepwise heating of amphibole residues remaining after crushing experiments are characterized by younger and relatively complex age spectra, which are probably influenced by the combined effects of resetting argon and/or mineral inclusions. Nevertheless, we note that the spectra shapes have features in common: excluding the last two steps, minimum apparent ages are found at temperatures of around 500 ?C, corresponding to 319 and 249 Ma, perhaps representing the time of isotopic resetting or resulting from release gas from mineral inclusions of, e.g., biotite or feldspar. Maximum apparent ages

  14. Sm-Nd and Ar-Ar Studies of DHO 908 and 489: Implications for Lunar Crustal History

    Science.gov (United States)

    Nyquist, L. E.; Shih, C. Y.; Reese, Y. D.; Park, J.; Bogard, D. D.; Garrison, D. H.; Yamaguchi, A.

    2011-01-01

    It is widely assumed that ferroan anorthosites (FANs) formed as flotation cumulates on a global lunar magma ocean (LMO). A corollary is that all FANs are approximately contemporaneous and formed with the same initial Nd-143/Nd-144 ratio. Indeed, a whole rock isochron for selected FANs (and An93 anorthosite) yields an isochron age of 4.42 +/- 0.13 Ga and initial Nd-143/Nd-144, expressed in epsilon-units, of epsilon(sub Nd,CHUR) = 0.3+/-0.3 relative to the CHondritic Uniform Reservoir , or epsilon(sub Nd,HEDPB)=-0.6+/-0.3 relative to the HED Parent Body. These values are in good agreement with the age (T) = 4.47+/-0.07 Ga, and epsilon(sub Nd,HEDPB) =-0.6 +/- 0.5 for FAN 67075. We also have studied anorthositic clasts in the Dhofar 908 and 489 lunar highland meteorites containing clasts of magnesian anorthosites (MAN) with Mg# approximately 75. Because of their relatively high Mg#, magnesian anorthosites should have preceded most FANs in crystallization from the LMO if both are LMO products. Thus, it is important to determine whether the Nd-isotopic data of MAN and FAN are consistent with a co-magmatic origin. We previously reported Sm-Nd data for white clast Dho 908 WC. Mafic minerals in this clast were too small to be physically separated for an isochron. However, we estimated initial Nd-143/Nd-144 for the clast by combining its bulk ("whole rock") Sm-Nd data with an Ar-39-Ar-40 age of 4.42+/-.04 Ga. Here we report additional Sm-Nd data for bulk samples of Dho 908 and its pair Dho 489.

  15. Constraints on Earth degassing history from the argon isotope composition of Devonian atmosphere

    Science.gov (United States)

    Stuart, F. M.; Mark, D.

    2012-04-01

    The primordial and radiogenic isotopes of the noble gases combine to make them a powerful tool for determining the time and tempo of the outgassing of the Earth's interior. The outgassing history of the Earth is largely constrained from measurements of the isotopic composition of He, Ne, Ar and Xe in samples of modern mantle, crust and atmosphere. There have been few unequivocal measurement of the isotopic composition of noble gases in ancient atmosphere. We have re-visited whether ancient Ar is trapped in the ~400 Ma Rhynie chert [1]. We have analysed samples of pristine Rhynie chert using the ARGUS multi-collector mass spectrometer calibrated against the new determination of atmospheric Ar isotope ratios [2]. 40Ar/36Ar ratios are low, with many lower than the modern air value (298.8). Importantly these are accompanied by atmospheric 38Ar/36Ar ratios indicating that the low 40Ar/36Ar are not due to mass fractionation. We conclude that the Rhynie chert has captured Devonian atmosphere-derived Ar. The data indicate that the Devonian atmosphere 40Ar/36Ar was at least 3 % lower than the modern air value. Thus the Earth's atmosphere has accumulated at least 5 ± 0.2 x 1016 moles of 40Ar in the last 400 million years, at an average rate of 1.24 ± 0.06 x 108 mol 40Ar/year. This overlaps the rate determined from ice cores for the last 800,000 years [3] and implies that there has been no resolvable temporal change in Earth outgassing rate since mid-Palaeozoic times. The new data require the Earth outgassed early, and suggests that pristine samples of Archaean and Proterozoic chert may prove useful as palaeo-atmosphere tracers. [1] G. Turner, J. Geol. Soc. London 146, 147-154 (1989) [2] D. Mark, F.M. Stuart, M. de Podesta, Geochim. Cosmochim. Acta 75, 7494-7501 [3] M. Bender et al., Proc. Nat. Acad. Sci. 105, 8232-8237 (2008)

  16. "Ars Dictaminis" and Modern Rhetorical Practice.

    Science.gov (United States)

    Sewell, Ernestine P.

    Although not all the problems of writing are solved by practice in letter writing, a review of the classical texts on "ars dictaminis"--letter writing--creates a strong argument for its increased use as an exercise in college composition classrooms. By incorporating the lessons of dictamen as a device for achieving rhetorical modes--narration,…

  17. 78 FR 9448 - Arkansas Disaster #AR-00061

    Science.gov (United States)

    2013-02-08

    ... ADMINISTRATION Arkansas Disaster AR-00061 AGENCY: U.S. Small Business Administration. ACTION: Notice SUMMARY: This is a Notice of the Presidential declaration of a major disaster for Public Assistance Only for the... Disaster Assistance, U.S. Small Business Administration, 409 3rd Street SW., Suite 6050, Washington,...

  18. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Index Scriptorium Estoniae

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  19. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    International Nuclear Information System (INIS)

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  20. 40Ar/39Ar geochronology of the Faku tectonites: Implications for the tectonothermal evolution of the Faku block, northern Liaoning

    Institute of Scientific and Technical Information of China (English)

    ZHANG; Xiaohui; WANG; Hui; LI; Tiesheng

    2005-01-01

    For lack of reliable isotopic chronological data, the metamorphic rock series in the Faku region of northern Liaoning has long been regarded as the platform basement. Recent studies reveal that these deformed and metamorphosed rocks, with a variety of protoliths of plutonic intrusions and supracrustal volcanic and sedimentary rocks, were genetically related to later ductile shearing events, and they, together with the syntectonic intrusions, constituted the large-scale Faku tectonites. In this paper, we report new 40Ar/39Ar data on hornblende, biotite, and K-feldspar from typical granitic mylonites in this suite of tectonites. The plateau age 256 Ma of FK53 hornblende and the high-temperature plateau age 262 Ma of Fk51-1 biotite should represent the cooling ages when the granites, formed as a result of Paleozoic oceanic crustal subduction beneath the continental crust or collision of multiple micro-continental blocks, were exhumed into shallow crustal levels. The plateau age 231 Ma of FK51-1 boitite and the apparent age 227 Ma of Fk51-2 K-feldspar are interpreted to record the time of ductile deformation occurring under greenschist facies conditions, i.e. the formation age of the Faku tectonites, while the age gradient from 197 Ma to 220 Ma of Fk51-2 K-feldspar probably record the subsequent stable uplift-cooling process. The tectonic exhumation event indicated by the plateau age 180 Ma of Fk51-2 K-feldspar may be associated with the onset of paleo-Pacific subduction beneath the North China plate. In addition, the U-Pb dating of FK54 zircon from later-intruded granite yields the age of crystallization of this super-unit intrusion at 159 Ma, thus establishing an upper limit for the formation age of the Faku tectonites, while the plateau age 125 Ma of Fk54 K-feldspar most likely corresponds to the rapid cooling and tectonic denudation event associated with the final collision between the Siberian plate and the North China plate. These isotopic ages provide important

  1. Theoretical prediction on vibrational spectra of [Ar…Ar-H]+

    Institute of Scientific and Technical Information of China (English)

    李巍; 赵新生

    2003-01-01

    Centrosymmetric linear [Ar-H-Ar]+ and asymmetric linear [Ar…Ar-H]+ are two stable configurations of [Ar2H]+. Based on the global potential energy surface of [Ar2H]+ provided by our group recently, we calculated the vibrational spectra of [Ar…Ar-H]+ with total angular momentum J = 0 by time-dependent quantum mechanical method, and the influence of quantum tunneling effect on vibrational spectra was found. With the help of the observation on the eigenstate functions and the modified potential energy surface, assignments were made to the spectra. The strong coupling between the excited bending mode of [Ar-H-Ar]+ and the vibrational states of [Ar…Ar-H]+ was discussed.

  2. Using Isotopes for Design and Monitoring of Artificial Recharge Systems

    International Nuclear Information System (INIS)

    Over the past years, the IAEA has provided support to a number of Member States engaged in the implementation of hydrological projects dealing with the design and monitoring of artificial recharge (AR) systems, primarily situated in arid and semiarid regions. AR is defined as any engineered system designed to introduce water to, and store water in, underlying aquifers. Aquifer storage and recovery (ASR) is a specific type of AR used with the purpose of increasing groundwater resources. Different water management strategies have been tested under various geographical, hydrological and climatic regimes. However, the success of such schemes cannot easily be predicted, since many variables need to be taken into account in the early stages of every AR project. As often occurs in the case of the assessment and management of groundwater and aquifers, information on hydrological behaviour and response to human-made actions is difficult to obtain and often very costly, especially if only conventional hydrological methods are used. Classical methods in AR and ASR are meant to provide information on changes in the volume and quality of the artificially introduced water to ensure its sustainability. Although the use of isotopes and geochemical tracers to plan and monitor AR and ASR has been limited, there is a growing number of publications reporting the successful application of tracers in the different phases of AR and ASR schemes. This publication discusses several theoretical aspects important to the understanding, planning and monitoring of AR and ASR schemes and presents a selected number of examples illustrating the usefulness of isotopes and other tracers. One section presents the list of available isotope tracers, indicating the type of information that can be obtained from each. The case studies presented in this publication illustrate the use of these tools in the different stages of AR and ASR schemes. The publication is expected to be of interest to hydrologists

  3. Chain reaction

    International Nuclear Information System (INIS)

    Chain Reaction is a work of recent American political history. It seeks to explain how and why America came to depend so heavily on its experts after World War II, how those experts translated that authority into political clout, and why that authority and political discretion declined in the 1970s. The author's research into the internal memoranda of the Atomic Energy Commission substantiates his argument in historical detail. It was not the ravages of American anti-intellectualism, as so many scholars have argued, that brought the experts back down to earth. Rather, their decline can be traced to the very roots of their success after World War II. The need to over-state anticipated results in order to garner public support, incessant professional and bureaucratic specialization, and the sheer proliferation of expertise pushed arcane and insulated debates between experts into public forums at the same time that a broad cross section of political participants found it easier to gain access to their own expertise. These tendencies ultimately undermined the political influence of all experts. (author)

  4. Time-space mapping of Easter Chain volcanism

    Science.gov (United States)

    O'Connor, John M.; Stoffers, Peter; McWilliams, Michael O.

    1995-12-01

    New 40Ar/ 39Ar and published K sbnd Ar ages show that the locus of volcanism along the Easter Volcanic Chain (EVC) has shifted systematically from the Nazca Ridge, at about 26 m.y., to the recently active Sala y Gomez Island/Easter Island region. This indicates a plume rather than a hotline (i.e., mantle roll) origin for the EVC. The time-space distribution of ages, combined with published ages for the Galapagos and Juan Fernandez volcanic chains, is used to reconstruct Nazca plate velocities over the past 26 m.y. A plume now located in the region of Sala y Gomez Island is most compatible with these data. West of the plume, the EVC records neither Nazca nor Pacific plate motions. This section of the EVC may be related to westward channeling of plume material to the Pacific-Nazca spreading boundary region.

  5. Isotope ratio measurement of uranium in safeguards environmental samples by inductively-coupled plasma mass spectrometry (ICP-MS)

    Energy Technology Data Exchange (ETDEWEB)

    Magara, Masaaki; Sakakibara, Takaaki; Kurosawa, Setsumi; Takahashi, Masato; Sakurai, Satoshi; Hanzawa, Yukiko; Esaka, Fumitaka; Watanabe, Kazuo; Usuda, Shigekazu [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-04-01

    In order to measure isotope ratio of uranium in safeguards environmental samples with ICP-MS precisely, production of polyatomic ions of IrAr, PtAr and AuAr was measured and mass bias of ICP-MS is investigated by using isotopic standards of uranium and lead. The intensities of IrAr, PtAr and AuAr relative to the atomic ions were found to be 1.8 x 10{sup -6}, 1.6 x 10{sup -5} and 4.1 x 10{sup -5}, respectively. The production of {sup 193}Ir{sup 40}Ar is too small to interfere with the measurement of {sup 233}U, if the concentration of Ir is the same level as that of {sup 233}U. However, there is possibility that the presence of Pt and Au interferes with the measurement of minor isotopes of uranium and {sup 237}Np. On the other hand, the mass biases of {sup 235}U/{sup 238}U and {sup 208}Pb/{sup 206}Pb were measured with the parameter of {sup 238}U{sup 16}O/{sup 238}U. Since unexpected change of the mass bias during measurements causes frequently erroneous results, the monitoring of {sup 238}U{sup 16}O/{sup 238}U is effective for the precise isotope ratio measurement. (author)

  6. Measurement of 37Ar to support technology for On-site Inspection under the Comprehensive Nuclear-Test-Ban Treaty

    CERN Document Server

    Aalseth, C E; Haas, D A; Hoppe, E W; Hyronimus, B J; Keillor, M E; Mace, E K; Orrell, J L; Seifert, A; Woods, V T

    2010-01-01

    On-Site Inspection (OSI) is a key component of the verification regime for the Comprehensive Nuclear-Test-Ban Treaty (CTBT). Measurements of radionuclide isotopes created by an underground nuclear explosion are a valuable signature of a Treaty violation. Argon-37 is produced from neutron interaction with calcium in soil, 40Ca(n,{\\alpha})37Ar. For OSI, the 35-day half-life of 37Ar provides both high specific activity and sufficient time for completion of an inspection before decay limits sensitivity. This paper presents a low-background internal-source gas proportional counter with an 37Ar measurement sensitivity level equivalent to 45.1 mBq/SCM in whole air.

  7. N 2-Ar-He compositions in fluid inclusions: Indicators of fluid source

    Science.gov (United States)

    Norman, David I.; Musgrave, John A.

    1994-02-01

    A quadrupole mass spectrometer was used to measure bulk samples of conservative gas species N 2, Ar, and He in fluid inclusions from a variety of hydrothermal systems. Analyses of these tracer elements help determine (1) if gases extracted by bulk inclusion analyses can provide accurate measurement of N 2-Ar-He in active and fossil geothermal systems, (2) if hydrothermal fluids associated with paleogeothermal systems in a continental setting follow N 2ArHe systematics similar to th the western Pacific Rim active geothermal systems, specifically New Zealand, and (3) whether different deposit types systematically vary with regard to N 2ArHe. The N 2ArHe ratios of fluid inclusion volatiles released from recently deposited minerals from the Valles system are similar to those of present day Valles thermal waters. Those inclusion samples from deep within the Valles system, below a regional aquitard, increase in N 2. Compositions for inclusions from the Questa and Copper Flat-porphyry deposits are N 2-rich, similar to those of arc-related volcanic gases, whereas those from Taylor Creek Sn deposit appear to be mixtures of magmatic and crustal components. N 2-Ar-He ratios of the Precambrian Tribag deposit suggest a basalt source, but significant levels of self-generated He from U and Th in the inclusion fluids are also possible. Inclusions from two epithermal deposits with low-salinity inclusions have N 2-Ar-He ratios trending towards air-saturated meteoric waters (ASW), and those inclusions with higher salinities indicate minor to no ASW component. The N 2-Ar-He ratios in Fresnillo and Cochiti inclusions, which have magmatic helium isotopic ratios, indicate additions of magmatic gases to meteoric fluids. Inclusions from sediment-hosted deposits that contain hydrocarbon-bearing brines are He-rich, as are meteoric waters with a long residence time in the crust. At relevant pressure-temperature-composition conditions, Henry's Law constants of N 2, Ar, and He

  8. Progress on radiometric dating of Wolfcamp brines using 4He and 40Ar

    International Nuclear Information System (INIS)

    Ground water samples (brines) from deep wells in the Palo Duro Basin, Texas are being analyzed for noble gases in an attempt to obtain radiometric ages for these brines. The brines contain radiogenic 4He and 40Ar produced from the radioactive decay of U, Th, and K. Consideration of hydrochemical data for the brines, various isotopic, chemical, and mineralogical data for the aquifer rocks and noble gas production rates allow estimating the age of the brines to be about 130 million years at two wells. At a third well interaquifer mixing has occurred and the age is presently indeterminate. 9 references, 3 figures, 1 table

  9. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Science.gov (United States)

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  10. Supporting Online Material to the manuscript: "Water isotope diffusion rates from the NorthGRIP ice core for the last 16,000 years - glaciological and paleoclimatic implications."

    CERN Document Server

    Gkinis, Vasileios; Buchardt, Susanne L; White, James W C; Vinther, Bo M

    2014-01-01

    This is the supporting online material for the manuscript arXiv:1404.4201 "Water isotope diffusion rates from the NorthGRIP ice core for the last 16,000 years - glaciological and paleoclimatic implications."

  11. Stable isotope studies

    Energy Technology Data Exchange (ETDEWEB)

    Ishida, T.

    1992-01-01

    The research has been in four general areas: (1) correlation of isotope effects with molecular forces and molecular structures, (2) correlation of zero-point energy and its isotope effects with molecular structure and molecular forces, (3) vapor pressure isotope effects, and (4) fractionation of stable isotopes. 73 refs, 38 figs, 29 tabs.

  12. Method for separating isotopes

    Science.gov (United States)

    Jepson, B.E.

    1975-10-21

    Isotopes are separated by contacting a feed solution containing the isotopes with a cyclic polyether wherein a complex of one isotope is formed with the cyclic polyether, the cyclic polyether complex is extracted from the feed solution, and the isotope is thereafter separated from the cyclic polyether.

  13. Stable isotope studies

    International Nuclear Information System (INIS)

    The research has been in four general areas: (1) correlation of isotope effects with molecular forces and molecular structures, (2) correlation of zero-point energy and its isotope effects with molecular structure and molecular forces, (3) vapor pressure isotope effects, and (4) fractionation of stable isotopes. 73 refs, 38 figs, 29 tabs

  14. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    International Nuclear Information System (INIS)

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  15. Modeling and Measurement of 39Ar Recoil Loss From Biotite as a Function of Grain Dimensions

    Science.gov (United States)

    Paine, J. H.; Nomade, S.; Renne, P. R.

    2004-12-01

    The call for age measurements with less than 1 per mil error puts a demand upon geochronologists to be aware of and quantify a number of problems which were previously negligible. One such factor is 39Ar recoil loss during sample irradiation, a phenomenon which is widely assumed to affect only unusually small crystals having exceptionally high surface/volume ratios. This phenomenon has important implications for thermochronologic studies seeking to exploit a range of closure temperatures arising from variable diffusion radii. Our study focuses on biotite, in which spatial isotope distributions cannot be reliably recovered by stepwise heating and which therefore lack recoil-diagnostic age spectrum behavior. Previous work by Renne et al. [Application of a deuteron-deuteron (D-D) neutron generator to 40Ar/39Ar geochronology, Applied Radiation and Isotopes, in press] used the SRIM code to calculate a ˜20% 39Ar recoil loss from the outermost 0.25 μ m of an infinite slab of phyllosillicate. This result is applied to measured grains of the biotite standard GA1550, a hypabyssal granite from the Mount Dromedary Complex, Australia. We measure the thickness and surface area of 166 grains and approximate the shape of each grain as a cylinder. Grain thickness ranges from 3 to 210 μ m, with an average grain radius of 350 μ m. We predict the amount of 39Ar recoil loss from each grain, finding an expected age error >0.1 % for grains thinner than 150 μ m, a >1% error for grain less than 10 μ m thick, and up to a 3% error for grains less than 3 μ m thick. These modeling results will be tested by analysis of the measured grains after irradiation in the Oregon State University TRIGA reactor. It is important to either account for 39Ar loss in thin biotite grains, or use sufficiently thick ones so that recoil loss is negligible. Our results indicate that only biotite grains thicker than 150 μ m should be used for neutron fluence monitoring in order to avoid bias greater than the

  16. Comparative study of the excitation functions of nuclear reactions induced by light ions (protons and α) and heavy ions (Ne, Ca, Ar) and, after neutron evaporation, leading to platinum and polonium isotopes. Analysis by de-excitation programme allowing for the angular momentum and fission

    International Nuclear Information System (INIS)

    This work is a study on the de-excitation of heavy nuclei from the Pt - Po area obtained by the complete fusion of various projectiles (p, 3He, 4He, 20Ne, 40Ar and 40Ca) and of various targets. The aim was to create from different couples the same compound nucleus of a mass equal to the sum of the masses of the component parts. The excitation energy of the system thus created can vary between 60 and 120 MeV. The experimental study of one or more particular de-excitation channels performed by measuring the cross sections of residual nuclei production for various bombardment energies is a very conventional approach. An in depth examination was made of the effect of the angular momentum given to the compound nucleus by the input channel to the de-excitation processes. Now the population of orbital angular momenta depends essentially on the mass of the projectile at equal velocities. Consequently, the utilization of projectiles extending from the proton to mass 40 covers a wide range. Decay by neutrons is not the only de-excitation method. Fission has a significant role particularly for the Po's and consequently this strongly diminishes the probability (P,xn). The decay of (α,xn) when going from the compound nucleus of 204Po to 182Pt makes it possble to evaluate the importance of the phenomenon and to have an item of experimental information that can be compared to a theoretical calculation. Theoretical calculations using the 'ALICE' code which expresses schematically the reduction in level densities by subtracting from the excitation energy a rotation energy and the 'JULIAN' code which uses a more accurate level density calculation and takes into account the gamma emission competing with the emission of neutrons show that the last programme reports the experimental results whereas the 'ALICE' code does not enable a consistent presentation to be made of all the results by light and heavy ions. Finally, it had to be agreed that the fission does not intervene as

  17. Studies on 40Ar/39Ar thermochronology of strike-slip time of the Tan-Lu fault zone and their tectonic implications

    Institute of Scientific and Technical Information of China (English)

    ZHU; Guang

    2001-01-01

    . Soc. Am.Bull.,1995, 107(5): 520-535.[22]Arita, K., Dallmeyer, R. D., Takasu, A., Tectonothermal evolution of the Lesser Himalaya, Nepal: Constraints from 40Ar/39Ar ages from the Kathmandu Nappe, The Island Arc, 1997, 6: 372-385.[23]Dallmeyer. R. D., Pana, D. I., Neubauer, F. et al., Tectonothermal evolution of the Apuseni Mountains, Romania: Resolution of Variscan versus Apline events with 40Ar/39Ar ages, The Journal of Geology, 1999, 107: 329-352.[24]Hu, S. L., Zou, H. B., Zhou, X. M., 40Ar/39Ar muscovite and hornblende ages respectively from cordierite granite at Shexian, Anhui and albite granite at Dexing, Jiangxi, in Lithospheric Textures and Geological Evolution of the Southeast China (ed., Li, J. L.) (in Chinese), Beijing: Metallurgical Industry Publishing House, 1993, 141-144.[25]Li, X. M., Li, B. X., Zhang, J. et al., Isotopic ages of the Guangdian intrusion in Anhui and dynamometamorphism in the Tan-Lu fault zone, Journal of University of Science and Technology (in Chinese), 1985 (supplement): 254-261.[26]Li. S. G., Hart. S. K., Zheng, S. G. et al., Sm-Nd isotopic age constraint on collision time of North and South blocks, Science in China, Ser. B, 1989, (3): 1391-1400.[27]Li, S. G.. Liu, D. L., Cheng, Y. Z. et al., Formation ages of blueschists in central China, Scientia Geologica Sinica, 1993, 28(1): 21-27.[28]Li. S. G., Li, H. M., Cheng, Y. Z., Chronology of ultra-high- pressure metamorphism of the Dabieshan-Sulu terrane-Zircon U-Pb isotopic system, Science in China, Ser. D (in Chinese), 1997, 27(3): 200-206.[29]Wang, G. Z., Yang, W. R., Time and space pattern of Meso-Cenozoic exhumation of Dabie orogenic belt, tectonochronological evidence, Scientia Geologica Sinica (in Chinese), 1998, 23(5): 461-467.[30]Li, Q., Cheng, W. J., Ma, B. L. et al., Preliminary studies on thermal evolution post collsion of the North China and Yangtze plates, Seismological Geology (in Chinese), 1995, 17(3): 193-203.[31]Engebretson, D. C

  18. Age of the Lava Creek supereruption and magma chamber assembly at Yellowstone based on 40Ar/39Ar and U-Pb dating of sanidine and zircon crystals

    Science.gov (United States)

    Matthews, Naomi E.; Vazquez, Jorge A.; Calvert, Andrew T.

    2015-01-01

    The last supereruption from the Yellowstone Plateau formed Yellowstone caldera and ejected the >1000 km3 of rhyolite that composes the Lava Creek Tuff. Tephra from the Lava Creek eruption is a key Quaternary chronostratigraphic marker, in particular for dating the deposition of mid Pleistocene glacial and pluvial deposits in western North America. To resolve the timing of eruption and crystallization history for the Lava Creek magma, we performed (1) 40Ar/39Ar dating of single sanidine crystals to delimit eruption age and (2) ion microprobe U-Pb and trace-element analyses of the crystal faces and interiors of single zircons to date the interval of zircon crystallization and characterize magmatic evolution. Sanidines from the two informal members composing Lava Creek Tuff yield a preferred 40Ar/39Ar isochron date of 631.3 ± 4.3 ka. Crystal faces on zircons from both members yield a weighted mean 206Pb/238U date of 626.5 ± 5.8 ka, and have trace element concentrations that vary with the eruptive stratigraphy. Zircon interiors yield a mean 206Pb/238U date of 659.8 ± 5.5 ka, and reveal reverse and/or oscillatory zoning of trace element concentrations, with many crystals containing high U concentration cores that likely grew from highly evolved melt. The occurrence of distal Lava Creek tephra in stratigraphic sequences marking the Marine Isotope Stage 16–15 transition supports the apparent eruption age of ∼631 ka. The combined results reveal that Lava Creek zircons record episodic heating, renewed crystallization, and an overall up-temperature evolution for Yellowstone's subvolcanic reservoir in the 103−104 year interval before eruption.

  19. Ar-Ar and U-Pb geochronology of Late Paleozoic basalts in western Guangxi and its constraints on the eruption age of Emeishan basalt magmatism

    Institute of Scientific and Technical Information of China (English)

    FAN Weiming; WANG Yuejun; PENG Touping; MIAO Laicheng; GUO Feng

    2004-01-01

    The Late Paleozoic layered or stratoid-layered basalts in western Guangxi have similar elemental and isotopic compositions to Emeishan high-Ti basalts. Whole-rock 40Ar/39Ar and SHRIMP zircon U-Pb dating were carried out for the representative basalt samples in three typical profiles in the area. Three basalts from the upper segment of Yangxu profile and lower segment of Yufeng and Min'an profiles yield the 40Ar/39Ar plateau ages of 253.6±0.4 Ma (20BS-71),255.4±0.4 Ma (20BS-99) and 256.2±0.8 Ma (20BS-119), respectively. Twenty-three analyses on 23 zircons of the basalt from the upper segment of Yangxu profile give a weighted mean 206pb/238U age of 253.7±6.1 Ma with an MSWD = 2.8.These new and published geochronological data for Emeishan large igneous province (LIP) indicate that the Emeishan LIP was initiated at ~260 Ma, voluminously erupted between 253 and 256 Ma, and possibly ended at ~251-253Ma' The age (251-260 Ma) is generally consistent with that of the associated environmental deterioration and mass extinction events at the end-Guadalupian and Permo-Triassic boundary. These precise geochronological data provide important constraints on the dominantly eruptive time of the Emeishan LIP and understanding of the distribution of Emeishan high-Ti basalts and its mantle plume dynamics.

  20. Re-Os molybdenite and Ar-Ar phlogopite dating of Cu-Fe-Au-Mo (W) deposits in southeastern Hubei, China

    Science.gov (United States)

    Xie, G.-Q.; Mao, J.-W.; Li, R.-L.; Qü, W.-J.; Pirajno, F.; Du, A.-D.

    2007-07-01

    The Cu-Fe-Au-Mo (W) deposits in southeastern Hubei are an important component of the Middle-Lower Yangtze River metallogenic belt. Molybdenite from the Fengshandong Cu- (Mo), Ruanjiawan W-Cu- (Mo), Qianjiawan Cu-Au, Tongshankou Cu-Mo and Tonglüshan Cu- (Fe) deposits yielded Re-Os ages of 144.0 ± 2.1 Ma, 143.6 ± 1.7 Ma, 137.7 ± 1.7 Ma, 142.3 ± 1.8-143.7 ± 1.8 Ma and 137.8 ± 1.7-138.1 ± 1.8 Ma, respectively. Phlogopite from the Tieshan Fe- (Cu) deposit yielded an Ar-Ar age of 140.9 ± 1.2 Ma. These data and other published isotopic ages (Re-Os molybdenite and Ar-Ar mica ages) for the Cu-Fe-Au-Mo (W) deposits in the Middle-Lower Yangtze River metallogenic belt show that Cu-Fe-Au-Mo (W) mineralisation in the Tongling, Anqing, Jiurui and Edong ore districts developed in a narrow time span between 135.5 and 144.9 Ma, reflecting an important regional metallogenic event. An integrated study of available petrological and geochronological data, together with relationships to magmatism and the regional geodynamic framework, indicate that the Cu-Fe-Au-Mo (W) mineralisation in the Middle-Lower Yangtze River belt occurred during a regime of lithospheric extension. This extension is probably related to Late Mesozoic processes of lower crustal delamination and lithospheric thinning in East China.

  1. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Science.gov (United States)

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  2. Isotopic dating of the Chengjiang Fauna-bearing horizon in Central Yunnan Province, China

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Twenty black shale samples, which are free from the influence of weathering, were collected from the Chengjiang Fauna-bearing horizon, central Yunnan Province, yielding a Pb-Pb isochron age of 534±60 Ma. Although this age is younger than both the Rb-Sr isochron age and 40Ar-39Ar age, it should represent the lower isotopic age limit of the Chengjiang Fauna.

  3. Dicty_cDB: FC-AR02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  4. On concentration of $^{42}$Ar in the Earth's atmosphere

    CERN Document Server

    Barabash, A S

    2016-01-01

    Data from the DBA liquid argon ionization chamber experiment have been used to obtain an estimate on the concentration of $^{42}$Ar in the Earth's atmosphere, $6.8^{+1.7}_{-3.2}\\cdot10^{-21}$ atoms of $^{42}$Ar per atom of $^{40}$Ar corresponding to the $^{42}$Ar activity of $1.2^{+0.3}_{-0.5}$ $\\mu$Bq per cubic meter of air.

  5. High-spin yrast levels of 38Ar

    NARCIS (Netherlands)

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  6. Noble gas abundances and isotopic compositions in mantle-derived xenoliths,NE China

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Following the researches of helium isotopic compositions in mantle-derived xenoliths in eastern China,this study reported noble gas abundances and isotopic compositions of mantle-derived xenoliths from Kuandian of Liaoning Province, Huinan of Jilin Province and Hannuoba of Hebei Province. Compared with the middle ocean ridge basalt (MORB) and other continental areas, mantle-derived xenoliths in NE China are characterized by slightly low noble gas abundances, 3He/4He equivalent to or lower than that of MORB, 40Ar/36Ar lower than that of MORB, 38Ar/36Ar and Ne-Kr-Xe isotopic ratios equivalent to those of atmosphere. These results indicate the heterogeneity of subcontinentai lithospheric mantle beneath northeastern China, that is, a MORB reservoir-like mantle beneath Kuandian and an enriched/metasomatized mantle beneath Huinan. Low 40Ar/36Ar ratios in the three studied areas may imply that a subducted atmospheric component has been preserved in the subcontinental lithospheric mantle.``

  7. Antarlides: A New Type of Androgen Receptor (AR) Antagonist that Overcomes Resistance to AR-Targeted Therapy.

    Science.gov (United States)

    Saito, Shun; Fujimaki, Takahiro; Panbangred, Watanalai; Igarashi, Yasuhiro; Imoto, Masaya

    2016-02-18

    Prostate cancer is treated with androgen receptor (AR) antagonists but most patients experience disease progression after long-term treatment with these compounds. Therefore, new AR antagonists are required for patient follow-up treatment. In the course of screening for a new AR antagonist, we isolated the novel compounds antarlides A-E (1-5) from Streptomyces sp. BB47. Antarlides are mutually isomeric with respect to the double bond and have a 22-membered-ring macrocyclic structure. The full stereostructure of 1 was established by chemical modifications, including methanolysis, the Trost method, acetonide formation, and the PGME method. 1-5 inhibited the binding of androgen to ARs in vitro. In addition, 2 inhibited the transcriptional activity of not only wild-type AR but also mutant ARs, which are seen in patients with acquired resistance to clinically used AR antagonists. Therefore, antarlides are a potent new generation of AR antagonists that overcome resistance.

  8. Tracking fluid action in Little Sark Pluton (Channel Islands, UK): a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Schwanethal, J.; Tindle, A. G.; Kelley, S. P.; Sherlock, S. C.

    2011-12-01

    Little Sark pluton (Channel Islands, UK) is a weakly to moderately deformed pluton of quartz diorite composition. Zircon from Little Sark has been dated as 611.4(+2.1/-1.3) Ma [Miller et al. 1991, Tectonophysics, 312], whereas titanite has an age of 606.2±0.6 Ma. Hornblende yields an Ar-Ar age of 606.4±3.4 Ma [Dallmeyer et al., 1991, J. Geol. Soc. London 148]. The rocks show evidence for post-magmatic hydrous alteration including chloritisation of biotite, and sericite formation in feldspar. We investigated the alteration in order to understand its influence on the Ar-Ar system. Detailed petrographic investigations of two samples indicate different deformation levels - S1, (less deformed), and S2 (more deformed). The feldspar is andesine to oligoclase in composition, but contains K-rich areas with patchy and sometimes cleavage guided sericitization. Mafic minerals include hornblende and biotite (the latter partially chloritized). Ar-Ar investigations were carried out using high spatial resolution UV laser ablation gas release in combination with a Nu instruments Noblesse gas mass spectrometer using spots of 80 to 140 μm diameter. Mafic minerals in S1 have highly variable 38Ar/39Ar and 37Ar/39Ar ratios and unusually high atmospheric contents for such old samples, possibly reflecting the presence of fluid inclusions associated with the sericite, particularly in the feldspar. The apparent ages in their entirety range from 429 to 668 Ma. Hornblende yields homogeneous apparent ages, whereas the younger and older ages are measured in both micas and feldspars, whose apparent ages range from 245-670 Ma. The modal age for feldspar is around 400-450 Ma, but this may not have geological meaning. Sample S2 shows many of the same features as S1. Mafic minerals span a slightly smaller age range and feldspars display apparent ages of ~245-645 Ma with a mode around 480 Ma. The alteration of both samples appears to have been accompanied by the introduction of 40Ar-rich fluids

  9. Dicty_cDB: FC-AR12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  10. Dicty_cDB: FC-AR03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  11. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    CERN Document Server

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  12. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Science.gov (United States)

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  13. Fenofibrate down-regulates the expressions of androgen receptor (AR) and AR target genes and induces oxidative stress in the prostate cancer cell line LNCaP

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Hu; Zhu, Chen; Qin, Chao [State Key Laboratory of Reproductive Medicine, Department of Urology, First Affiliated Hospital of Nanjing Medical University, Nanjing (China); Tao, Tao [Department of Neurosurgery, First Affiliated Hospital of Nanjing Medical University, Nanjing (China); Li, Jie; Cheng, Gong; Li, Pu; Cao, Qiang; Meng, Xiaoxin; Ju, Xiaobing; Shao, Pengfei; Hua, Lixin [State Key Laboratory of Reproductive Medicine, Department of Urology, First Affiliated Hospital of Nanjing Medical University, Nanjing (China); Gu, Min, E-mail: medzhao1980@163.com [State Key Laboratory of Reproductive Medicine, Department of Urology, First Affiliated Hospital of Nanjing Medical University, Nanjing (China); Yin, Changjun, E-mail: drcjyin@gmail.com [State Key Laboratory of Reproductive Medicine, Department of Urology, First Affiliated Hospital of Nanjing Medical University, Nanjing (China)

    2013-03-08

    Highlights: ► Fenofibrate induces cell cycle arrest in G1 phase and apoptosis in LNCaP cells. ► Fenofibrate reduces the expressions of androgen receptor in LNCaP cells. ► Fenofibrate induces oxidative stress in the prostate cancer cell line LNCaP. -- Abstract: Fenofibrate, a peroxisome proliferator-androgen receptor-alpha agonist, is widely used in treating different forms of hyperlipidemia and hypercholesterolemia. Recent reports have indicated that fenofibrate exerts anti-proliferative and pro-apoptotic properties. This study aims to investigate the effects of fenofibrate on the prostate cancer (PCa) cell line LNCaP. The effects of fenofibrate on LNCaP cells were evaluated by flow cytometry, reverse transcription-polymerase chain reaction, enzyme-linked immunosorbent assays, Western blot analysis, and dual-luciferase reporter assay. Fenofibrate induces cell cycle arrest in G1 phase and apoptosis in LNCaP cells, reduces the expressions of androgen receptor (AR) and AR target genes (prostate-specific antigen and TMPRSS2), and inhibits Akt phosphorylation. Fenofibrate can induce the accumulation of intracellular reactive oxygen species and malondialdehyde, and decrease the activities of total anti-oxidant and superoxide dismutase in LNCaP cells. Fenofibrate exerts an anti-proliferative property by inhibiting the expression of AR and induces apoptosis by causing oxidative stress. Therefore, our data suggest fenofibrate may have beneficial effects in fenofibrate users by preventing prostate cancer growth through inhibition of androgen activation and expression.

  14. Fenofibrate down-regulates the expressions of androgen receptor (AR) and AR target genes and induces oxidative stress in the prostate cancer cell line LNCaP

    International Nuclear Information System (INIS)

    Highlights: ► Fenofibrate induces cell cycle arrest in G1 phase and apoptosis in LNCaP cells. ► Fenofibrate reduces the expressions of androgen receptor in LNCaP cells. ► Fenofibrate induces oxidative stress in the prostate cancer cell line LNCaP. -- Abstract: Fenofibrate, a peroxisome proliferator-androgen receptor-alpha agonist, is widely used in treating different forms of hyperlipidemia and hypercholesterolemia. Recent reports have indicated that fenofibrate exerts anti-proliferative and pro-apoptotic properties. This study aims to investigate the effects of fenofibrate on the prostate cancer (PCa) cell line LNCaP. The effects of fenofibrate on LNCaP cells were evaluated by flow cytometry, reverse transcription-polymerase chain reaction, enzyme-linked immunosorbent assays, Western blot analysis, and dual-luciferase reporter assay. Fenofibrate induces cell cycle arrest in G1 phase and apoptosis in LNCaP cells, reduces the expressions of androgen receptor (AR) and AR target genes (prostate-specific antigen and TMPRSS2), and inhibits Akt phosphorylation. Fenofibrate can induce the accumulation of intracellular reactive oxygen species and malondialdehyde, and decrease the activities of total anti-oxidant and superoxide dismutase in LNCaP cells. Fenofibrate exerts an anti-proliferative property by inhibiting the expression of AR and induces apoptosis by causing oxidative stress. Therefore, our data suggest fenofibrate may have beneficial effects in fenofibrate users by preventing prostate cancer growth through inhibition of androgen activation and expression

  15. 40Ar- 39Ar dating of detrital muscovite in provenance investigations: a case study from the Adelaide Rift Complex, South Australia

    Science.gov (United States)

    Haines, Peter W.; Turner, Simon P.; Kelley, Simon P.; Wartho, Jo-Anne; Sherlock, Sarah C.

    2004-11-01

    Detrital zircon ages are commonly used to investigate sediment provenance and supply routes. Here, we explore the advantages of employing multiple, complimentary techniques via a case study of the Neoproterozoic and Cambrian of the Adelaide Rift Complex, South Australia. Detrital muscovite Ar-Ar ages are presented from stratigraphic units, or equivalents, that have previously been the subject of U-Pb detrital zircon dating, and, in some cases, whole-rock Sm-Nd isotope studies. The zircon age ranges and whole-rock Sm-Nd isotope data suggest that early Neoproterozoic sediments from near the base of the Adelaide Rift Complex comprise a mixture of detritus derived from the adjacent Gawler Craton (Palaeoproterozoic to earliest Mesoproterozoic) and overlying Gairdner flood basalts. In contrast, detrital muscovites from this level have a broad scatter of Mesoproterozoic infrared (IR) laser total fusion Ar-Ar ages, while UV laser traverses indicate that the age spread reflects partial resetting by multiple heating events, rather than a mixture of sources. Younger Neoproterozoic sediments document replacement of the Gawler Craton by the more distant Musgrave and/or Albany-Fraser Orogens as the main provenance. The Cambrian Kanmantoo Group marks an abrupt change in depositional style and a new sediment source. The Kanmantoo Group have older Nd model ages than underlying strata, yet are dominated by near to deposition-aged (˜500-650 Ma) detrital zircons and muscovites, suggesting rapid cooling and exhumation of a tectonically active provenance region. Although this source remains uncertain, evidence points towards the distant Pan-African orogenic belts. Deposition in the Adelaide Rift Complex was terminated in the late Early Cambrian by the Delamerian Orogeny, and the results of previous detrital mineral dating studies from the Lachlan Fold Belt to the east are consistent with at least partial derivation of these sediments from reworked upper Adelaide Rift Complex (Kanmantoo

  16. Ar + NO microwave plasmas for Escherichia coli sterilization

    Energy Technology Data Exchange (ETDEWEB)

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  17. Loewner Theory in annulus II: Loewner chains

    CERN Document Server

    Contreras, Manuel D; Gumenyuk, Pavel

    2011-01-01

    Loewner Theory, based on dynamical viewpoint, proved itself to be a powerful tool in Complex Analysis and its applications. Recently Bracci et al [Bracci et al, to appear in J. Reine Angew. Math. Available on ArXiv 0807.1594; Bracci et al, Math. Ann. 344(2009), 947--962; Contreras et al, Revista Matematica Iberoamericana 26(2010), 975--1012] have proposed a new approach bringing together all the variants of the (deterministic) Loewner Evolution in a simply connected reference domain. This paper is devoted to the construction of a general version of Loewner Theory for the annulus launched in [ArXiv 1011.4253]. We introduce the general notion of a Loewner chain over a system of annuli and obtain a 1-to-1 correspondence between Loewner chains and evolution families in the doubly connected setting similar to that in the Loewner Theory for the unit disk. Futhermore, we establish a conformal classification of Loewner chains via the corresponding evolution families and via semicomplete weak holomorphic vector fields...

  18. Laser Spectroscopy of Neutron Rich Bismuth Isotopes

    CERN Multimedia

    2002-01-01

    %IS344 :\\\\ \\\\ The aim of the experiment is to measure the optical isotope shifts and hyperfine structures of bismuth isotopes across the N=126 shell closure in order to extract the change in mean square charge radii ($\\delta\\langle r^{2}\\rangle$) and static moments. These include the first isotones of lead to be measured directly above the shell closure and will provide new information on the systematics of the kink ($\\delta\\langle r^{2}\\rangle)$ seen in the lead isotopic chain. After two very successful runs the programme has been extended to include the neutron deficient isotopes below $^{201}$Bi to study the systematics across the $i_{13/2}$ neutron sub-shell closure at N=118.\\\\ \\\\ During the initial 2 runs (9 shifts) the isotope shifts and hyperfine structures of three new isotopes, $ ^{210,212,213}$Bi and the 9$^{-}$ isomer of $^{210}$Bi have been measured. The accuracy of the previous measurements of $^{205,206,208}$Bi have been greatly improved. The samples of $ ^{208,210,210^{m}}$Bi were prepared by c...

  19. Argon defect complexes in low energy Ar irradiated molybdenum

    Energy Technology Data Exchange (ETDEWEB)

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  20. MEIS1 functions as a potential AR negative regulator

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  1. Multidiffusion mechanisms for noble gases (He, Ne, Ar) in silicate glasses and melts in the transition temperature domain: Implications for glass polymerization

    Science.gov (United States)

    Amalberti, Julien; Burnard, Pete; Laporte, Didier; Tissandier, Laurent; Neuville, Daniel R.

    2016-01-01

    Noble gases are ideal probes to study the structure of silicate glasses and melts as the modifications of the silicate network induced by the incorporation of noble gases are negligible. In addition, there are systematic variations in noble gas atomic radii and several noble gas isotopes with which the influence of the network itself on diffusion may be investigated. Noble gases are therefore ideally suited to constrain the time scales of magma degassing and cooling. In order to document noble gas diffusion behavior in silicate glass, we measured the diffusivities of three noble gases (4He, 20Ne and 40Ar) and the isotopic diffusivities of two Ar isotopes (36Ar and 40Ar) in two synthetic basaltic glasses (G1 and G2; 20Ne and 36Ar were only measured in sample G1). These new diffusion results are used to re-interpret time scales of the acquisition of fractionated atmospheric noble gas signatures in pumices. The noble gas bearing glasses were synthesized by exposing the liquids to high noble gas partial pressures at high temperature and pressure (1750-1770 K and 1.2 GPa) in a piston-cylinder apparatus. Diffusivities were measured by step heating the glasses between 423 and 1198 K and measuring the fraction of gas released at each temperature step by noble gas mass spectrometry. In addition we measured the viscosity of G1 between 996 and 1072 K in order to determine the precise glass transition temperature and to estimate network relaxation time scales. The results indicate that, to a first order, that the smaller the size of the diffusing atom, the greater its diffusivity at a given temperature: D(He) > D(Ne) > D(Ar) at constant T. Significantly, the diffusivities of the noble gases in the glasses investigated do not display simple Arrhenian behavior: there are well-defined departures from Arrhenian behavior which occur at lower temperatures for He than for Ne or Ar. We propose that the non-Arrhenian behavior of noble gases can be explained by structural modifications

  2. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Science.gov (United States)

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  3. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    OpenAIRE

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  4. SUMER-IRIS Observations of AR11875

    Science.gov (United States)

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  5. Silicone chain extender

    DEFF Research Database (Denmark)

    2015-01-01

    The present invention relates to a silicone chain extender, more particularly a chain extender for silicone polymers and copolymers, to a chain extended silicone polymer or copolymer and to a functionalized chain extended silicone polymer or copolymer, to a method for the preparation thereof and...

  6. Health supply chain management.

    Science.gov (United States)

    Zimmerman, Rolf; Gallagher, Pat

    2010-01-01

    This chapter gives an educational overview of: * The actual application of supply chain practice and disciplines required for service delivery improvement within the current health environment. * A rationale for the application of Supply Chain Management (SCM) approaches to the Health sector. * The tools and methods available for supply chain analysis and benchmarking. * Key supply chain success factors. PMID:20407173

  7. Isotopic geology; Geologie isotopique

    Energy Technology Data Exchange (ETDEWEB)

    Allegre, C. [Paris-7 Univ. Denis Diderot, 75 (France); Institut de physique du globe de Paris, 75 - Paris (France)

    2005-07-01

    Born from the application to geology of nuclear physics techniques, the isotopic geology has revolutionized the Earth's sciences. Beyond the dating of rocks, the tracer techniques have permitted to reconstruct the Earth's dynamics, to measure the temperatures of the past (giving birth to paleoclimatology) and to understand the history of chemical elements thanks to the analysis of meteorites. Today, all domains of Earth sciences appeal more or less to the methods of isotopic geology. In this book, the author explains the principles, methods and recent advances of this science: 1 - isotopes and radioactivity; 2 - principles of isotope dating; 3 - radio-chronological methods; 4 - cosmogenic isotope chronologies; 5 - uncertainties and radio-chronological results; 6 - geochemistry of radiogenic isotopes; 7 - geochemistry of stable isotopes; 8 - isotopic geology and dynamical analysis of reservoirs. (J.S.)

  8. Optical isotope shifts for unstable samarium isotopes

    International Nuclear Information System (INIS)

    Using a tunable dye laser beam intersecting a thermal atomic beam, optical isotope shifts and hyperfine splittings have been measured for the four unstable samarium isotopes between 144Sm and 154Sm, covering the well known transition region from spherical to deformed shapes. (orig.)

  9. Dicty_cDB: FC-AR10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  10. Dicty_cDB: FC-AR05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  11. Dicty_cDB: FC-AR16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  12. Dicty_cDB: FC-AR17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  13. Dicty_cDB: FC-AR01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  14. Dicty_cDB: FC-AR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  15. The role of mitochondrial fusion and StAR phosphorylation in the regulation of StAR activity and steroidogenesis.

    Science.gov (United States)

    Castillo, Ana F; Orlando, Ulises; Helfenberger, Katia E; Poderoso, Cecilia; Podesta, Ernesto J

    2015-06-15

    The steroidogenic acute regulatory (StAR) protein regulates the rate-limiting step in steroidogenesis, i.e. the delivery of cholesterol from the outer (OMM) to the inner (IMM) mitochondrial membrane. StAR is a 37-kDa protein with an N-terminal mitochondrial targeting sequence that is cleaved off during mitochondrial import to yield 30-kDa intramitochondrial StAR. StAR acts exclusively on the OMM and its activity is proportional to how long it remains on the OMM. However, the precise fashion and the molecular mechanism in which StAR remains on the OMM have not been elucidated yet. In this work we will discuss the role of mitochondrial fusion and StAR phosphorylation by the extracellular signal-regulated kinases 1/2 (ERK1/2) as part of the mechanism that regulates StAR retention on the OMM and activity.

  16. Statistical clumped isotope signatures.

    Science.gov (United States)

    Röckmann, T; Popa, M E; Krol, M C; Hofmann, M E G

    2016-01-01

    High precision measurements of molecules containing more than one heavy isotope may provide novel constraints on element cycles in nature. These so-called clumped isotope signatures are reported relative to the random (stochastic) distribution of heavy isotopes over all available isotopocules of a molecule, which is the conventional reference. When multiple indistinguishable atoms of the same element are present in a molecule, this reference is calculated from the bulk (≈average) isotopic composition of the involved atoms. We show here that this referencing convention leads to apparent negative clumped isotope anomalies (anti-clumping) when the indistinguishable atoms originate from isotopically different populations. Such statistical clumped isotope anomalies must occur in any system where two or more indistinguishable atoms of the same element, but with different isotopic composition, combine in a molecule. The size of the anti-clumping signal is closely related to the difference of the initial isotope ratios of the indistinguishable atoms that have combined. Therefore, a measured statistical clumped isotope anomaly, relative to an expected (e.g. thermodynamical) clumped isotope composition, may allow assessment of the heterogeneity of the isotopic pools of atoms that are the substrate for formation of molecules. PMID:27535168

  17. Laser Spectroscopy of neutron deficient Sn isotopes

    CERN Multimedia

    We propose to study the ground state properties of neutron-deficient tin isotopes towards the doubly-magic nucleus $^{100}$Sn. Nuclear spins, changes in the rms charge radii and electromagnetic moments of $^{101-121}$Sn will be measured by laser spectroscopy using the CRIS experimental beam line. These ground-state properties will help to clarify the evolution of nuclear structure properties approaching the $\\textit{N = Z =}$ 50 shell closures. The tin isotopic chain is currently the frontier for the application of state-of-the-art ab-initio calculations. Our knowledge of the nuclear structure of the Sn isotopes will set a benchmark for the advances of many-body methods, and will provide an important test for modern descriptions of the nuclear force.

  18. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Science.gov (United States)

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  19. Three-nucleon forces in exotic open-shell isotopes

    CERN Document Server

    Soma, V; Cipollone, A; Duguet, T; Navratil, P

    2013-01-01

    Advances in the self-consistent Green's function approach to finite nuclei are discussed, including the implementation of three-nucleon forces and the extension to the Gorkov formalism. We report results on binding energies in the nitrogen and fluorine isotopic chains, as well as spectral functions of 22O. The application to medium-mass open-shell systems is illustrated by separation energy spectra of two argon isotopes, which are compared to one-neutron removal experiments.

  20. Molybdenite Re-Os and muscovite 40Ar/39Ar dating of quartz vein-type W-Sn polymetallic deposits in Northern Guangdong, South China

    Science.gov (United States)

    Qi, Hua-Wen; Hu, Rui-Zhong; Wang, Xiao-Fei; Qu, Wen-Jun; Bi, Xian-Wu; Peng, Jian-Tang

    2012-08-01

    Northern Guangdong is an important part of Nanling tungsten-tin metallogenic belt, South China. The tungsten mineralization in this area consists of mainly quartz-wolframite vein-type mineralization, with W-Sn polymetallic deposits mostly distributed at the outer contact zone between concealed Late Jurassic granitic stocks and Cambrian-Ordovician low-metamorphosed sandstones and shales. Molybdenite Re-Os and muscovite 40Ar/39Ar isotopic dating of three typical tungsten vein-type deposits (Yaoling, Meiziwo, and Jubankeng) in northern Guangdong, show that two episodes of Late Jurassic W-Sn polymetallic mineralization occurred in this area: an early episode during the Late Jurassic (158-159 Ma) represented by the Yaoling, Hongling, and Meiziwo tungsten deposits, and a younger event during the Early Cretaceous (138 Ma) represented by the Jubankeng deposit. Analysis of available radiometric ages of several W-Sn deposits in the Nanling region indicate that these deposits formed at several intervals during the Mesozoic at 90-100, 134-140, 144-162, and 210-235 Ma, and that large-scale W-Sn mineralization in this region occurred mainly between 150 and 160 Ma.

  1. 40Ar/39 Ar and paleomagnetic results from the Guapore shield: further implications for the nature of middle-late proterozoic mobile belts of Gondwana land

    International Nuclear Information System (INIS)

    Twenty sites in diverse rock units of the Serra dos Carajas region provide the first paleomagnetic poles from the Guapore shield of the Amazonian Craton. The most reliable results were obtained from the Pium Complex and the Carajas and Seringa granites. The ages of magnetization of these units are reasonably well constrained by isotopic data: 40 Ar/39 Ar data on a Pium hornblende indicate an Archean (>2.7 Ga) age for high grade metamorphism, but biotite and plagioclase from the same sample, plus biotite from another, all record a trans-Amazonian overprint. Thus the trans-Amazonian orogeny in this area produced temperatures between ca. 300 and 500 o C, apparently sufficient to re magnetize these rocks, and was followed by relatively rapid cooling uninterrupted by significant later regional metamorphism. Emplacement of the Carajas and Seringa granites, members of an extensive suite of anorogenic granitoids of the craton, is reasonably well constrained by previous studies at 1.70 to 1.83 Ga. A F and thermal demagnetization of specimens from three sites in the Pium complex and one in each of the granites reveals multicomponent behavior, but characteristic direction with moderately high coercivity and/or blocking temperature were isolated from all five sites. (author)

  2. Isotopes in heterogeneous catalysis

    CERN Document Server

    Hargreaves, Justin SJ

    2006-01-01

    The purpose of this book is to review the current, state-of-the-art application of isotopic methods to the field of heterogeneous catalysis. Isotopic studies are arguably the ultimate technique in in situ methods for heterogeneous catalysis. In this review volume, chapters have been contributed by experts in the field and the coverage includes both the application of specific isotopes - Deuterium, Tritium, Carbon-14, Sulfur-35 and Oxygen-18 - as well as isotopic techniques - determination of surface mobility, steady state transient isotope kinetic analysis, and positron emission profiling.

  3. Isotopically controlled semiconductors

    Energy Technology Data Exchange (ETDEWEB)

    Haller, Eugene E.

    2001-12-21

    Semiconductor bulk crystals and multilayer structures with controlled isotopic composition have attracted much scientific and technical interest in the past few years. Isotopic composition affects a large number of physical properties, including phonon energies and lifetimes, bandgaps, the thermal conductivity and expansion coefficient and spin-related effects. Isotope superlattices are ideal media for self-diffusion studies. In combination with neutron transmutation doping, isotope control offers a novel approach to metal-insulator transition studies. Spintronics, quantum computing and nanoparticle science are emerging fields using isotope control.

  4. Androgen Receptor-Mediated Growth Suppression of HPr-1AR and PC3-Lenti-AR Prostate Epithelial Cells.

    Directory of Open Access Journals (Sweden)

    Young-Chae Kim

    Full Text Available The androgen receptor (AR mediates the developmental, physiologic, and pathologic effects of androgens including 5α-dihydrotestosterone (DHT. However, the mechanisms whereby AR regulates growth suppression and differentiation of luminal epithelial cells in the prostate gland and proliferation of malignant versions of these cells are not well understood, though they are central to prostate development, homeostasis, and neoplasia. Here, we identify androgen-responsive genes that restrain cell cycle progression and proliferation of human prostate epithelial cell lines (HPr-1AR and PC3-Lenti-AR, and we investigate the mechanisms through which AR regulates their expression. DHT inhibited proliferation of HPr-1AR and PC3-Lenti-AR, and cell cycle analysis revealed a prolonged G1 interval. In the cell cycle, the G1/S-phase transition is initiated by the activity of cyclin D and cyclin-dependent kinase (CDK complexes, which relieve growth suppression. In HPr-1AR, cyclin D1/2 and CDK4/6 mRNAs were androgen-repressed, whereas CDK inhibitor, CDKN1A, mRNA was androgen-induced. The regulation of these transcripts was AR-dependent, and involved multiple mechanisms. Similar AR-mediated down-regulation of CDK4/6 mRNAs and up-regulation of CDKN1A mRNA occurred in PC3-Lenti-AR. Further, CDK4/6 overexpression suppressed DHT-inhibited cell cycle progression and proliferation of HPr-1AR and PC3-Lenti-AR, whereas CDKN1A overexpression induced cell cycle arrest. We therefore propose that AR-mediated growth suppression of HPr-1AR involves cyclin D1 mRNA decay, transcriptional repression of cyclin D2 and CDK4/6, and transcriptional activation of CDKN1A, which serve to decrease CDK4/6 activity. AR-mediated inhibition of PC3-Lenti-AR proliferation occurs through a similar mechanism, albeit without down-regulation of cyclin D. Our findings provide insight into AR-mediated regulation of prostate epithelial cell proliferation.

  5. An approach to noble-gas isotopic compositions in natural gases and gas-source tracing in the Ordos Basin, China

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Isotopic compositions of noble gases, i.e. He Ar Kr and Xe, are measured in natural gases from the Zhongbu gasfield in the Ordos Basin. And heavy noble-gas isotopes (Kr, Xe) are here first used in geochemically studying natural gases and gas-source correlation. Isotopic compositions of heavy noble gases in natural gases, especially Xe, show two-source mixing in the Zhongbu gasfield. Gas sources are somewhat different in the northeast and the southwest of the gasfield. Generally, the gas source of the Lower Paleozoic makes a greater contribution in the southwest than in the northeast in the field. Two kinds of gases can be differentiated from isotopic compositions of heavy noble gases and from their relation with the Ar isotopic composition, Therefore, the comprehensive study on isotopic compositions of light and heavy noble gases can supply more useful information on gas-source correlation and tracing.

  6. Identification and analysis of ARS function of six plant MARs

    Institute of Scientific and Technical Information of China (English)

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  7. The use of stable isotopes for food web analysis.

    Science.gov (United States)

    Wada, E; Mizutani, H; Minagawa, M

    1991-01-01

    General aspects in isotope biogeochemistry was summarized with emphasis on delta 15N and delta 13C contents in plants and animals in natural ecosystems. In the estuary, the variation of isotope ratios were principally governed by the mixing of land-derived organic matter, marine phytoplankton, and seagrasses. A clear cut linear relationship between animal delta 15N and its trophic level was obtained in the Antarctic food chain system. Several current efforts to use the stable isotopes for food web analysis were demonstrated for some terrestrial and marine systems as well as human food web. PMID:1910519

  8. Plasma AR and abiraterone-resistant prostate cancer.

    Science.gov (United States)

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone.

  9. Coupled cluster calculations of mean excitation energies of the noble gas atoms He, Ne and Ar and of the H2 molecule

    DEFF Research Database (Denmark)

    Sauer, Stephan P. A.; Haq, Inam U.; Sabin, John R.;

    2013-01-01

    Using an asymmetric-Lanczos-chain algorithm for the calculation of the coupled cluster linear response functions at the CCSD and CC2 levels of approximation, we have calculated the mean excitation energies of the noble gases He, Ne and Ar, and of the hydrogen molecule H2. Convergence with respect...

  10. Elaboration of a model of the nuclear fragmentation and application to the method of isotopic separation of projectile fragments

    International Nuclear Information System (INIS)

    In this thesis the experimental results on the cross sections for the production of 36P in the fragmentation of 403 MeV/u 40Ar on a carbon target are presented. Furthermore some models of the nuclear fragmentation are elaborated and compared by means of experimental data for the production of gold and cerium isotopes in the reaction 12C+209Bi at 400 MeV/u, of chlorine, sulfur, aluminium, magnesium, and oxygen isotopes in the reactions 40Ar+12C at 600 MeV/u and 48Ca+9Be at 212 MeV/u, and of cobalt, manganese, vanadium, and scandium isotopes together with the charge distributions for A=43 and A=44 in the reactions 40Ar+64Cu at 2 GeV/u and 56Fe+12C at 600 MeV/u. (HSI)

  11. Practical reactor production of {sup 41}Ar from argon clathrate

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  12. In situ Investigations of Organics, Isotopes, and Inorganic Volatiles in Gale Crater

    Science.gov (United States)

    Mahaffy, Paul; Mars Science Laboratory Team, The Sample Analysis at Mars Team

    2016-10-01

    During its path toward and now onto the flanks of Mount Sharp in Gale crater the powerful set of instruments of the Curiosity rover have enabled a wide range of geological and geochemical studies. The focus of the Sample Analysis (SAM) at Mars Investigation is to conduct volatile and isotope measurements of both the atmosphere and drilled or scooped solids to help elucidate present and ancient environmental conditions and the global changes that have transformed Mars over time.Discoveries, to date, include:(1) definitive identification of an increasing number of S and Cl containing organic compounds in Gale crater samples,(2) transient spikes and season-length variations in atmospheric methane abundance,(3) the cosmic radiation exposure age of a mudstone using the spallogenic 3He and 21Ne and the neutron capture 36Ar isotopes,(4) the rock formation age in the same sample using the SAM 40Ar and the K abundance from the Alpha Particle Backscatter instrument,(5) constraints on atmospheric loss rates over geological time using the atmospheric 36Ar/38Ar ratio and isotopes of C and O in CO2,(6) D/H ratios locked into mudstone rocks more than 3 billion years ago,(7) perchlorates and a variety of other minerals contained in the ubiquitous amorphous fraction of solid samples, and(8) isotopic fractionation in the trace atmospheric Kr and Xe isotopes that allowed a first in situ comparison with martian gas trapped in meteorites.In this overview of our exploration of volatiles in Gale crater we will focus on organic compounds discovered to date, variations in the chemistry and isotopic composition of solid samples taken on the traverse to Mount Sharp, and on seasonal variations in isotopes and mixing ratios in the atmosphere.The results described have relied on significant contributions from many members of the MSL and SAM teams.

  13. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  14. 40Ar/39Ar age-spectrum data for hornblende, biotite, white mica, and K-feldspar samples from metamorphic rocks in the Great Smoky Mountains of North Carolina and Tennessee

    Science.gov (United States)

    Kunk, Michael J.; McAleer, Ryan

    2011-01-01

    This report contains reduced 40Ar/39Ar data of hornblende, biotite, white mica and (or) sericite, and potassium-feldspar mineral separates and phyllite groundmass samples from metamorphic rocks of the Great Smoky Mountains in North Carolina and Tennessee. Included in this report are information on the location of the samples and a brief description of the samples. The data contained herein are not interpreted in a geological context, and care should be taken by users unfamiliar with argon isotopic data in the use of these results. No geological meaning is implied for any of the apparent ages presented below, and many of the individual apparent ages are not geologically meaningful. This report is primarily a detailed source document for subsequent publications that will integrate these data into a geological context. All the samples in this report were collected in and around the Great Smoky Mountain National Park in western North Carolina and eastern Tennessee.

  15. Reactivation episodes of the romeral fault system in the northwestern part of central andes, colombia, through 39ar-40ar and k-ar results

    OpenAIRE

    VINASCO VALLEJO, CESAR JAVIER; Cordani, Umberto

    2013-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  16. Ab Initio Potential Curve for ArH+%ArH+势能曲线的从头计算

    Institute of Scientific and Technical Information of China (English)

    王胜龙; 屈军艳; 郭锐; 赵新生

    2001-01-01

    The molecular parameters of ArH+ have been calculated with different quantum chemistry methods and basis sets.Based on the data from QCISD/Aug cc pVTZ ab initio calculation for different configurations of ArH+ and the experimental data,an accurate potential curve for ArH+ has been constructed.The molecular properties,such as dissociation energy,equilibrium bond length,and vibrational energy levels,can be accurately reproduced.

  17. 40Ar/39Ar Age of the Lathrop Wells Volcanic Center, Yucca Mountain, Nevada.

    Science.gov (United States)

    Turrin, B D; Champion, D; Fleck, R J

    1991-08-01

    Paleomagnetic and (40)Ar/(39)Ar analyses from the Lathrop Wells volcanic center, Nevada, indicate that two eruptive events have occurred there. The ages (136 +/- 8 and 141 +/- 9 thousand years ago) for these two events are analytically indistinguishable. The small angular difference (4.7 degrees ) between the paleomagnetic directions from these two events suggests they differ in age by only about 100 years. These ages are consistent with the chronology of the surficial geological units in the Yucca Mountain area. These results contradict earlier interpretations of the cinder-cone geomorphology and soil-profile data that suggest that at least five temporally discrete eruptive events occurred at Lathrop Wells approximately 20,000 years ago. PMID:17772371

  18. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley, Maghalaya, India

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande

    2001-09-01

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma and 107.5 ± 1.4 Ma, respectively. The weighted mean of these ages, 107.2 ± 0.8 Ma, is the time of emplacement of this complex. This implies that Sung Valley complex and probably other such complexes in the Assam-Meghalaya Plateau postdate the main ood basalt event (i.e., the eruption of tholeiites) in the RBS province by ∼10 Ma.

  19. Acoustic resonance spectroscopy (ARS): ARS300 operations manual, software version 2.01

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-25

    Acoustic Resonance Spectroscopy (ARS) is a nondestructive evaluation technology developed at the Los Alamos National Laboratory. The ARS technique is a fast, safe, and nonintrusive technique that is particularly useful when a large number of objects need to be tested. Any physical object, whether solid, hollow, or fluid filled, has many modes of vibration. These modes of vibration, commonly referred to as the natural resonant modes or resonant frequencies, are determined by the object`s shape, size, and physical properties, such as elastic moduli, speed of sound, and density. If the object is mechanically excited at frequencies corresponding to its characteristic natural vibrational modes, a resonance effect can be observed when small excitation energies produce large amplitude vibrations in the object. At other excitation frequencies, i.e., vibrational response of the object is minimal.

  20. Deactivation of lipopolysaccharide by Ar and H2 inductively coupled low-pressure plasma

    Science.gov (United States)

    Bartis, E. A. J.; Barrett, C.; Chung, T.-Y.; Ning, N.; Chu, J.-W.; Graves, D. B.; Seog, J.; Oehrlein, G. S.

    2014-01-01

    Using an inductively coupled plasma system, we study the effects of direct plasma, plasma-generated high-energy photons in the ultraviolet and vacuum ultraviolet (UV/VUV), and radical treatments on lipopolysaccharide (LPS). LPS is a biomolecule found in the outer membrane of Gram-negative bacteria and a potent stimulator of the immune system composed of polysaccharide and lipid A, which contains six aliphatic chains. LPS film thickness spun on silicon was monitored by ellipsometry while the surface chemistry was characterized before and after treatments by x-ray photoelectron spectroscopy (XPS). Additionally, biological activity was measured using an enzyme-linked immunosorbent assay under (a) a sensitive regime (sub-µM concentrations of LPS) and (b) a bulk regime (above µM concentrations of LPS) after plasma treatments. Direct plasma treatment causes rapid etching and deactivation of LPS in both Ar and H2 feed gases. To examine the effect of UV/VUV photons, a long-pass filter with a cut-off wavelength of 112 nm was placed over the sample. H2 UV/VUV treatment causes material removal and deactivation due to atomic and molecular UV/VUV emission while Ar UV/VUV treatment shows minimal effects as Ar plasma does not emit UV/VUV photons in the transmitted wavelength range explored. Interestingly, radical treatments remove negligible material but cause deactivation. Based on the amphiphilic structure of LPS, we expect a lipid A rich surface layer to form at the air-water interface during sample preparation with polysaccharide layers underneath. XPS shows that H2 plasma treatment under direct and UV/VUV conditions causes oxygen depletion through removal of C-O and O-C = O bonds in the films, which does not occur in Ar treatments. Damage to these groups can remove aliphatic chains that contribute to the pyrogenicity of LPS. Radical treatments from both Ar and H2 plasmas remove aliphatic carbon from the near-surface, demonstrating the important role of neutral species.

  1. 40Ar/39Ar dating and paleo-magnetism of traps from Ethiopia, Deccan and Siberia

    International Nuclear Information System (INIS)

    Recent studies have shown that major flood basalt provinces have been emplaced as short events (∼ 1 Myr), more or less synchronous with climatic crises and mass extinctions. We present new geochronologic (40Ar/39Ar) and magneto-stratigraphic results for the Ethiopian traps, one of the last remaining flood basalts for which little of such data were available. The ages obtained in a 2000 m thick section are indistinguishable. Moreover, magneto-stratigraphy reveals a simple 3-chron reverse-normal-reverse sequence. Although magnetic chrons cannot be yet unambiguously identified, there is more likelihood for the normal sub-chron in the main basaltic pile to correspond to 11N, supporting a brief duration (less than 1.5 Ma). The Ethiopian traps erupted near 30 Ma at or near the time of the cold and dry climate, major Antarctic ice sheet advance, and the largest sea-level drop in the Tertiary. Bhandari et al. (GRL, 1995) have discovered inter-traps sediments with a triple iridium anomaly in a series of seven basaltic lava flows in the Kutch area of the North Western Deccan traps of India. Plagioclases from three flows above the iridium bearing sediments yield 39Ar/40Ar plateau ages near 65.0 Ma: these flows have unambiguously reversed magnetic polarity interpreted as chron 29R. As a preliminary summary, evidence of the KTB asteroid impact is confirmed in the Deccan traps, showing that they are coeval events in a general sense (in a Ma long window) though clearly with vastly different time constants. This is compatible with paleontologic evidence of two scales of extinctions, one quasi-instantaneous and the other on the order of 105 to 106 yrs. Clearly, the impact cannot have caused trap eruptions. On the other hand, the exact age and significance of the lower flows more altered remains to be analyzed further as they pertained to the much debated question of duration of Deccan trap volcanism. (author)

  2. 40 Ar/ 39 Ar radiometric dating to constrain the volcanic stratigraphy: The Mt. Etna methodological case.

    OpenAIRE

    De Beni, E.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Groppelli, G.; Istituto per la Dinamica dei Processi Ambientali–Sezione di Milano, Consiglio Nazionale delle Ricerche, via Mangiagalli 34, 20133 Milano, Italy

    2010-01-01

    Although ~50 radiometric age analyses have been performed on Etna, and there are many historical references, these are not enough to temporally constrain the geo- logical evolution of the volcano. In particular, a new stratigraphic framework based on lithostratigraphic and unconformity-bounded units has pointed out the presence of some stratigraphic uncertainty that can be resolved only with radiometric dating. For this reason, a dating project applying the 40 Ar/ ...

  3. Frequency shift in high order harmonic generation from isotopic molecules

    CERN Document Server

    He, Lixin; Zhai, Chunyang; Wang, Feng; Shi, Wenjing; Zhang, Qingbin; Zhu, Xiaosong; Lu, Peixiang

    2016-01-01

    We report the first experimental observation of frequency shift in high order harmonic generation (HHG) from isotopic molecules H2 and D2 . It is found that harmonics generated from the isotopic molecules exhibit obvious spectral red shift with respect to those from Ar atom. The red shift is further demonstrated to arise from the laser-driven nuclear motion in isotopic molecules. By utilizing the red shift observed in experiment, we successfully retrieve the nuclear vibrations in H2 and D2, which agree well with the theoretical calculations from the time-dependent Schrodinger equation (TDSE) with Non-Born-Oppenheimer approximation. Moreover, we demonstrate that the frequency shift can be manipulated by changing the laser chirp.

  4. Naturally-occurring stable isotopes as direct measures of larval feeding efficiency, nutrient incorporation and turnover

    OpenAIRE

    Le Vay, Lewis; Gamboa-Delgado, Julián

    2011-01-01

    Stable isotopes are non-hazardous markers that have been widely-used in assessing energy flow within aquatic ecosystems. Hatchery systems are also highly amenable to this approach, as they represent controlled mesocosms with a limited number of food sources and short planktonic food chains with rapid and measurable bioaccumulation of the heavier stable isotopes of carbon and nitrogen at each trophic step. Differences in the natural isotopic composition of dietary components may be used to pro...

  5. Spatial autocorrelation method using AR model; Kukan jiko sokanho eno AR model no tekiyo

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, H.; Obuchi, T.; Saito, T. [Iwate University, Iwate (Japan). Faculty of Engineering

    1996-05-01

    Examination was made about the applicability of the AR model to the spatial autocorrelation (SAC) method, which analyzes the surface wave phase velocity in a microtremor, for the estimation of the underground structure. In this examination, microtremor data recorded in Morioka City, Iwate Prefecture, was used. In the SAC method, a spatial autocorrelation function with the frequency as a variable is determined from microtremor data observed by circular arrays. Then, the Bessel function is adapted to the spatial autocorrelation coefficient with the distance between seismographs as a variable for the determination of the phase velocity. The result of the AR model application in this study and the results of the conventional BPF and FFT method were compared. It was then found that the phase velocities obtained by the BPF and FFT methods were more dispersed than the same obtained by the AR model. The dispersion in the BPF method is attributed to the bandwidth used in the band-pass filter and, in the FFT method, to the impact of the bandwidth on the smoothing of the cross spectrum. 2 refs., 7 figs.

  6. Dicty_cDB: FC-AR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR21 (Link to dictyBase) - - - Contig-U16455-1 FC-AR21Z (Li...nk to Original site) - - FC-AR21Z 528 - - - - Show FC-AR21 Library FC (Link to library) Clone ID FC-AR21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR21Q.Seq.d/ Representative seq. ID FC-AR...21Z (Link to Original site) Representative DNA sequence >FC-AR21 (FC-AR21Q) /CSM/FC/FC-AR/FC-AR21Q.Seq....omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR21 (FC-AR

  7. Seasonal variation in stable carbon and nitrogen isotope values of bats reflect environmental baselines.

    Directory of Open Access Journals (Sweden)

    Ana G Popa-Lisseanu

    Full Text Available The stable carbon and nitrogen isotope composition of animal tissues is commonly used to trace wildlife diets and analyze food chains. Changes in an animal's isotopic values over time are generally assumed to indicate diet shifts or, less frequently, physiological changes. Although plant isotopic values are known to correlate with climatic seasonality, only a few studies restricted to aquatic environments have investigated whether temporal isotopic variation in consumers may also reflect environmental baselines through trophic propagation. We modeled the monthly variation in carbon and nitrogen isotope values in whole blood of four insectivorous bat species occupying different foraging niches in southern Spain. We found a common pattern of isotopic variation independent of feeding habits, with an overall change as large as or larger than one trophic step. Physiological changes related to reproduction or to fat deposition prior to hibernation had no effect on isotopic variation, but juvenile bats had higher δ13C and δ15N values than adults. Aridity was the factor that best explained isotopic variation: bat blood became enriched in both 13C and 15N after hotter and/or drier periods. Our study is the first to show that consumers in terrestrial ecosystems reflect seasonal environmental dynamics in their isotope values. We highlight the danger of misinterpreting stable isotope data when not accounting for seasonal isotopic baselines in food web studies. Understanding how environmental seasonality is integrated in animals' isotope values will be crucial for developing reliable methods to use stable isotopes as dietary tracers.

  8. Seasonal variation in stable carbon and nitrogen isotope values of bats reflect environmental baselines.

    Science.gov (United States)

    Popa-Lisseanu, Ana G; Kramer-Schadt, Stephanie; Quetglas, Juan; Delgado-Huertas, Antonio; Kelm, Detlev H; Ibáñez, Carlos

    2015-01-01

    The stable carbon and nitrogen isotope composition of animal tissues is commonly used to trace wildlife diets and analyze food chains. Changes in an animal's isotopic values over time are generally assumed to indicate diet shifts or, less frequently, physiological changes. Although plant isotopic values are known to correlate with climatic seasonality, only a few studies restricted to aquatic environments have investigated whether temporal isotopic variation in consumers may also reflect environmental baselines through trophic propagation. We modeled the monthly variation in carbon and nitrogen isotope values in whole blood of four insectivorous bat species occupying different foraging niches in southern Spain. We found a common pattern of isotopic variation independent of feeding habits, with an overall change as large as or larger than one trophic step. Physiological changes related to reproduction or to fat deposition prior to hibernation had no effect on isotopic variation, but juvenile bats had higher δ13C and δ15N values than adults. Aridity was the factor that best explained isotopic variation: bat blood became enriched in both 13C and 15N after hotter and/or drier periods. Our study is the first to show that consumers in terrestrial ecosystems reflect seasonal environmental dynamics in their isotope values. We highlight the danger of misinterpreting stable isotope data when not accounting for seasonal isotopic baselines in food web studies. Understanding how environmental seasonality is integrated in animals' isotope values will be crucial for developing reliable methods to use stable isotopes as dietary tracers. PMID:25700080

  9. GEOCHRONOMETRY & ISOTOPE GEOLOGY

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    <正>20111901 Chen Yingtao(State Key Laboratory of Continental Dynamics,Department of Geology,Northwest University,Xi’an 710069,China);Zhang Guowei 40Ar/39Ar Geochronology of the Guozhacuo Fault in the Northwestern Margin of Qinghai-Tibet Plateau--New Evidence for the Western Extension of Altyn Tagh Fault(Geological Bulletin of China,ISSN1671-2552,CN11-4648/P,29(8),2010,p.1129-1137,2 illus.,1 table,44 refs.)Key words:Ar-Ar dating,Qinghai-Tibetan Plateau,Altun Fracture ZoneThe samples of mylonite were collected from the Guozhacuo fault,situated in the southwestern e

  10. The fluence effect of Ar++ bombardment in PPS

    International Nuclear Information System (INIS)

    The modifications induced by ion bombardment on the physical and chemical structures and on thermal, optical and electrical properties of poly(phenylene sulphide), PPS, were investigated. Thin PPS foils, 2, 6 and 125 μm thick were bombarded with Ar++ (700 keV) under initial vacuum of 10-6 torr. Changes in the chemical structure were monitored by infrared absorption spectroscopy (FTIR) and ultraviolet and visible spectroscopy (UV-VIS). Modifications in the relative atomic composition of the bombarded polymer samples were determined by elemental analysis (CHN) and Rutherford backscattering spectrometry (RBS). Processes resulting from ion implantation on the physical structure of PPS were followed by X-ray diffraction spectrometry (XRD), differential scanning calorimetry (DSC), solubility tests and electrical conductivity measurements. Thermal stability of these samples was established by thermogravimetric analysis (TGA). Ion bombardment induces electronic excitation and ionization of molecular species, which leads to crystallinity loss, chemical bonds disruptions and formation of free radicals. These reactive groups lead to the formation of cross-linking processes and absorption of atmospheric gases, like oxygen and nitrogen. Oxygen is combined with the polymer main chain, partaking in the cross-linking and in the formation of conjugated structures. Due to extensive bond conjugation the energy gap between valence and conduction bands diminishes. This process favors charge transport, leading to an increase of the macroscopic electrical conductivity. However, after bombardment, the oxygen absorption induces a continuous decrease of the conductivity, even after a period of six months. The samples irradiated with the highest fluences exhibit conductivities similar to those of semiconductors. A kinetic study of the thermal degradation of implanted samples indicates that the thermal stability, defined by the onset temperature and the activation energy of the process

  11. Isotopic and noble gas geochemistry in geothermal research

    Energy Technology Data Exchange (ETDEWEB)

    Kennedy, B.M.; DePaolo, D.J. [Lawrence Berkeley National Lab., CA (United States)

    1997-12-31

    The objective of this program is to provide, through isotopic analyses of fluids, fluid inclusions, and rocks and minerals coupled with improved methods for geochemical data analysis, needed information regarding sources of geothermal heat and fluids, the spatial distribution of fluid types, subsurface flow, water-rock reaction paths and rates, and the temporal evolution of geothermal systems. Isotopic studies of geothermal fluids have previously been limited to the light stable isotopes of H, C, and O. However, other isotopic systems such as the noble gases (He, Ne, Ar, Kr and Xe) and reactive elements (e.g. B, N, S, Sr and Pb) are complementary and may even be more important in some geothermal systems. The chemistry and isotopic composition of a fluid moving through the crust will change in space and time in response to varying chemical and physical parameters or by mixing with additional fluids. The chemically inert noble gases often see through these variations, making them excellent tracers for heat and fluid sources. Whereas, the isotopic compositions of reactive elements are useful tools in characterizing water-rock interaction and modeling the movement of fluids through a geothermal reservoir.

  12. Chain-Chain Based Routing Protocol

    Directory of Open Access Journals (Sweden)

    Samia A Ali

    2011-05-01

    Full Text Available Wireless sensor network (WSN is an emerging technology for monitoring physical world. WSNs consist of large numbers of sensor nodes operated by battery mostly in harsh environment. Thus energy conservation is a primary issue for organization of these sensor nodes. Another crucial issue is the data delivery time by sensor nodes to the sink node, especially in Military, medical fields, and security monitoring systems where minimum delay is desirable. Number of protocols has been proposed in the literature for routing. One of such protocols is the cluster based routing protocol LEACH (low energy adaptive clustering hierarchy. LEACH protocol organizes WSN into a set of clusters and a periodic voting for cluster head is performed in order to be evenly distributed among all the sensors of the WSN. This periodical cluster head voting in LEACH, however, consumes an amount of non-negligible energy and other resources. For energy conservation, PEGASIS (power efficient gathering in sensor information systems a near optimal chain-based protocol has been proposed, however, it is faced with the challenge of long delay for the transmitted data. Another routing protocol called CCM (Chain-Cluster based Mixed routing, which is mainly a hybrid of LEACH and PEGASIS is proposed, the consumed energy increases as network size increases. In this paper, we propose an efficient routing protocol called CCBRP (Chain-Chain based routing protocol, it achieves both minimum energy consumption and minimum delay. The CCBRP protocol mainly divides a WSN into a number of chains (Greedy algorithm is used to form each chain as in PEGSIS protocol and runs in two phases. In the first phase, sensor nodes in each chain transmit data to their chain leader nodes in parallel. In the second phase, all chain leader nodes form a chain (also, using Greedy algorithm and choose randomly a leader node then all chain leader nodes send their data to this chosen leader node. This chosen leader node

  13. Southernmost Andes and South Georgia Island, North Scotia Ridge: Zircon U-Pb and muscovite {40Ar }/{39Ar } age constraints on tectonic evolution of Southwestern Gondwanaland

    Science.gov (United States)

    Mukasa, Samuel B.; Dalziel, Ian W. D.

    1996-11-01

    Zircon U-Pb and muscovite {40Ar }/{39Ar } isotopic ages have been determined on rocks from the southernmost Andes and South Georgia Island, North Scotia Ridge, to provide absolute time constraints on the kinematic evolution of southwestern Gondwanaland, until now known mainly from stratigraphic relations. The U-Pb systematics of four zircon fractions from one sample show that proto-marginal basin magmatism in the northern Scotia arc, creating the peraluminous Darwin granite suite and submarine rhyolite sequences of the Tobifera Formation, had begun by the Middle Jurassic (164.1 ± 1.7 Ma). Seven zircon fractions from two other Darwin granites are discordant with non-linear patterns, suggesting a complex history of inheritances and Pb loss. Reference lines drawn through these points on concordia diagrams give upper intercept ages of ca. 1500 Ma, interpreted as a minimum age for the inherited zircon component. This component is believed to have been derived from sedimentary rocks in the Gondwanaland margin accretionary wedge that forms the basement of the region, or else directly from the cratonic "back stop" of that wedge. Ophiolitic remnants of the Rocas Verdes marginal basin preserved in the Larsen Harbour complex on South Georgia yield the first clear evidence that Gondwanaland fragmentation had resulted in the formation of oceanic crust in the Weddell Sea region by the Late Jurassic (150 ± 1 Ma). The geographic pattern in the observed age range of 8 to 13 million years in these ophiolitic materials, while not definitive, is in keeping with propagation of the marginal basin floor northwestward from South Georgia Island to the Sarmiento Complex in southern Chile. Rocks of the Beagle granite suite, emplaced post-tectonically within the uplifted marginal basin floor, have complex zircon U-Pb systematics with gross discordances dominated by inheritances in some samples and Pb loss in others. Of eleven samples processed, only two had sufficient amounts of zircon for

  14. Age of the Lava Creek supereruption and magma chamber assembly at Yellowstone based on 40Ar/39Ar and U-Pb dating of sanidine and zircon crystals

    Science.gov (United States)

    Vazquez, J. A.; Matthews, N. E.; Calvert, A. T.

    2015-12-01

    The last supereruption from the Yellowstone Plateau formed Yellowstone caldera and ejected the >1000 km3 of rhyolite that composes the Lava Creek Tuff (LCT). Tephra from the eruption blanketed much of the western United States, and is a key Quaternary chronostratigraphic marker, in particular for dating deposition of mid-Pleistocene glacial and pluvial deposits in western North America. We performed 40Ar/39Ar dating of single sanidines to delimit eruption age, and ion microprobe U-Pb and trace-element analyses of crystal faces on single zircons to characterize magmatic evolution and date near-eruption crystallization, as well as analyses of crystal interiors to date the interval of zircon crystallization. Sanidines from the two LCT members A and B yield an 40Ar/39Ar isochron date of 631 ± 4 ka (2σ). Crystal faces on zircons from both members yield a weighted mean 206Pb/238U date of 627 ± 6 ka (2σ) and have trace element concentrations that vary with eruptive stratigraphy. Zircon interiors yield a weighted mean 206Pb/238U date of 660 ± 6 ka, and reveal reverse and/or oscillatory zoning of trace element concentrations, with many crystals containing high-U concentrations and dark cathodoluminescence (CL) cores. These crystals with high-U cores are possibly sourced from 'defrosting' of melt-impregnated margins of the growing subvolcanic reservoir. LCT sanidines mirror the variation of zircon composition within the eruptive stratigraphy, with crystals from upper LCT-A and basal LCT-B having bright-CL rims with high Ba concentrations, suggesting late crystallization after addition of less evolved silicic magma. The occurrence of distal LCT in stratigraphic sequences marking the Marine Isotope Stage 16-15 transition supports the apparent eruption age of ca. 631 ka. These results reveal that Lava Creek zircons record episodic heating, renewed crystallization, and an overall up-temperature evolution for Yellowstone's subvolcanic reservoir in the 103-104 year interval

  15. RECONSTRUCTION OF AR DEPTH PROFILES FROM PIXE MEASUREMENTS

    NARCIS (Netherlands)

    OSIPOWICZ, T; LIEW, SC; LOH, KK; ORLIC, [No Value; TANG, SM; WEBER, T

    1994-01-01

    We report on the application of an iterative maximum likelihood algorithm [1] to the reconstruction of depth profiles from PIXE measurements. PIXE spectra of 450 and 800 keV Ar implanted Al samples were taken at 1.5 and 1.3 MeV He+ energy and at angles ranging from 18 to 83-degrees. The measured Ar

  16. Experimental introduction of excess Ar40 into a granitic melt

    Science.gov (United States)

    Fyfe, W.S.; Lanphere, M.A.; Dalrymple, G.B.

    1969-01-01

    Samples of a Precambrian granite were melted in sealed capsules to produce a radiogenic Ar40 atmosphere over the melt. The amount of Ar40 incorporated in the quenched charge was then determined. Under these experimental conditions the amount of argon dissolved in the quenched melt was appreciable and could be an important source of error in potassiumargon dating. ?? 1969 Springer-Verlag.

  17. In Vitro Activity of AR-709 against Streptococcus pneumoniae▿

    OpenAIRE

    Jansen, W.T.M.; Verel, A.; Verhoef, J.; Milatovic, D.

    2008-01-01

    We investigated the in vitro activity of AR-709, a novel diaminopyrimidine antibiotic currently in development for treatment of community-acquired upper and lower respiratory tract infections, against 151 Streptococcus pneumoniae strains from various European countries. AR-709 showed excellent activity against both drug-susceptible and multidrug-resistant pneumococci.

  18. Aspects of What Makes or Breaks a Museum AR Experience

    DEFF Research Database (Denmark)

    Madsen, Claus B.; Madsen, Jacob Boesen; Morrison, Ann

    2012-01-01

    The paper critically evaluates central aspects of an iPad AR application developed for a museum context. The application is designed for children aged 8 to 12 and mixes AR and mini-game elements to convey dramatized historical events. The game has been deployed for roughly 3 months and the findin...

  19. Discrete Quantum Markov Chains

    CERN Document Server

    Faigle, Ulrich

    2010-01-01

    A framework for finite-dimensional quantum Markov chains on Hilbert spaces is introduced. Quantum Markov chains generalize both classical Markov chains with possibly hidden states and existing models of quantum walks on finite graphs. Quantum Markov chains are based on Markov operations that may be applied to quantum systems and include quantum measurements, for example. It is proved that quantum Markov chains are asymptotically stationary and hence possess ergodic and entropic properties. With a quantum Markov chain one may associate a quantum Markov process, which is a stochastic process in the classical sense. Generalized Markov chains allow a representation with respect to a generalized Markov source model with definite (but possibly hidden) states relative to which observables give rise to classical stochastic processes. It is demonstrated that this model allows for observables to violate Bell's inequality.

  20. Isotope separation principles

    Energy Technology Data Exchange (ETDEWEB)

    Benedict, Manson

    1963-03-15

    Isotope separation theory of ideal cascades is discussed. It is shown how the most important characteristics of an isotope separation process can be worked out from the compositions and flow rates of the feed and product streams. These characteristics include plant size, dependence of product rate on product purity, minimum power consumption, costs of isotope separation, minimum time for reaching steady production, and effect of third component on process performance and product costs. The concepts of value functions, separative power, and separative work are used to derive the characteristics, and the analogy between isotope separation theory and thermodynamics is emphasized. (D.L.C.)

  1. The isotope breathe test

    International Nuclear Information System (INIS)

    The foundations of the breath diagnostic test, based on application of the carbon compounds, labeled with the stable (13C) or radioactive isotope are presented. The methodology for conducting the breath isotope test and the apparatuses, making it possible to determine under clinical conditions the isotope composition of the carbon, contained in the expired air, depending on the introduced tracer type, is briefly described. The safety of the method and prospects of its application are discussed. The examples of the breath isotope test practical application are presented

  2. Touch interface for markless AR based on Kinect

    Science.gov (United States)

    Hsieh, Ching-Tang; Kuo, Tai-Ku; Wang, Hui-Chun; Wu, Yeh-Kuang; Chang, Liung-Chun

    2014-01-01

    We develop an augmented reality (AR) environment with hidden-marker via touch interface using Kinect device, and then also set up a touch painting game with the AR environment. This environment is similar to that of the touch screen interface which allows user to paint picture on a tabletop with his fingers, and it is designed with depth image information from Kinect device setting up above a tabletop. We incorporate support vector machine (SVM) to classify painted pictures which correspond to the inner data and call out its AR into the tabletop in color images information from Kinect device. Because users can utilize this similar touch interface to control AR, we achieve a marker-less AR and interactive environment.

  3. AR Sco: A White Dwarf Synchronar

    CERN Document Server

    Katz, J I

    2016-01-01

    The emission of the white dwarf-M dwarf binary AR Sco is driven by the rapid synchronization of its white dwarf, rather than by accretion. This requires a comparatively large magnetic field $\\sim 100$ gauss at the M dwarf and $\\sim 10^8$ gauss on the white dwarf, larger than the fields of most intermediate polars but within the range of fields of known magnetic white dwarfs. The spindown power is dissipated in the atmosphere of the M dwarf by magnetic reconnection, accelerating particles that produce the observed synchrotron radiation. The displacement of the optical maximum from conjunction may be explained either by dissipation in a bow wave as the white dwarf's magnetic field sweeps past the M dwarf or by a misaligned white dwarf's rotation axis and oblique magnetic moment. In the latter case the rotation axis precesses with a period of decades, predicting a drift in the orbital phase of maximum. Binaries whose emission is powered by synchronization may be termed synchronars, in analogy to magnetars.

  4. Lifetime measurement for the 21+ state in 140Sm and the onset of collectivity in neutron-deficient Sm isotopes

    Science.gov (United States)

    Bello Garrote, F. L.; Görgen, A.; Mierzejewski, J.; Mihai, C.; Delaroche, J. P.; Girod, M.; Libert, J.; Sahin, E.; Srebrny, J.; Abraham, T.; Eriksen, T. K.; Giacoppo, F.; Hagen, T. W.; Kisielinski, M.; Klintefjord, M.; Komorowska, M.; Kowalczyk, M.; Larsen, A. C.; Marchlewski, T.; Mitu, I. O.; Pascu, S.; Siem, S.; Stolarz, A.; Tornyi, T. G.

    2015-08-01

    Background: The chain of Sm isotopes exhibits a wide range of nuclear shapes and collective behavior. While the onset of deformation for N >82 has been well studied both experimentally and theoretically, fundamental data is lacking for some Sm isotopes with N Weisskopf units. The theoretical calculations are in very good agreement with the experimental result. Conclusions: The B (E 2 ;21+→01+) value for 140Sm fits smoothly into the systematic trend for the chain of Sm isotopes. The new beyond-mean field calculations are able to correctly describe the onset of collectivity in the Sm isotopes below the N =82 shell closure for the first time.

  5. Preliminary K/Ar geochronology of the Crater Basalt volcanic field (CBVF, northern Patagonia

    Directory of Open Access Journals (Sweden)

    Z. Pécskay

    2007-03-01

    Full Text Available The Crater Basalt volcanic field is one of the Quaternary intraplate basaltic fields in northern Patagonia. A systematic geological, volcanological and geochronological study of CBVF indicates a multistage history of eruptions of basaltic volcanoes. K/Ar dating, using whole rock samples shows that the measured analytical ages are fully consistent with the available stratigraphic control. The radiometric ages fall into three distinct, internally consistent age groups, which give evidence that there were at least three major episodes of volcanic activity, at about 1.0 Ma, 0.6 Ma and 0.3 Ma ago. The age differences appear to be just significant, even although less than 10 % radiogenic argon was found in the isotope analysis of whole rock samples.

  6. Evaporation of the 36 Ar + 58 Ni system studied with the 4π INDRA detector

    International Nuclear Information System (INIS)

    With the capabilities of the INDRA 4π detector, vaporization of the 36Ar + 58Ni system has been detected permitting thus first studies. This phenomenon which corresponds to a total disintegration of the total nuclear system into neutrons and isotopes of H is expected for very high excitation energies induced in-nucleus collisions at intermediate energies. The onset of vaporization was determined, it is found at 52 MeV per nucleon, which corresponds to an available energy per nucleon into the system of 12.3 MeV. Temperature at which vaporization occurs is a crucial parameter to describe the phenomenon. Upper limits for temperature have been deduced within two frameworks (complete surface evaporation or calculation within the free gas limit) and lead to values in the range 7-10 MeV. (author). 43 refs

  7. On Full Disclosure and Transparent Data Flow from 40Ar/39Ar Geochronology Measurements to Data Reduction to Online Repositories

    Science.gov (United States)

    Koppers, A. A. P.

    2015-12-01

    Arguably 40Ar/39Ar geochronology is one of the most versatile techniques available to Earth scientists today for the dating of rocks and minerals and determining the rates of geological processes on Earth and in our solar system. Over the last four decades large quantities of high (and lower) quality 40Ar/39Ar data have been produced using many different generations of mass spectrometry instrumentation. This wealth of data is only as useful as its description and availability of metadata allows. Many online data sets or compilations available in the science literature only carry the resulting product, an age and a related uncertainty in millions of years, for example. These data points are far from desirable as these don't allow recalculation against modern-day age standards, decay constants and other parameters essential in 40Ar/39Ar geochronology. Over time these data will become less useful to the research community and eventually these will be put by the wayside. In this presentation I will emphasize the need for full disclosure of all data and metadata involved in 40Ar/39Ar geochronology. I will give examples of how a complex data flow can be kept transparent from sample preparation to measurement to data reduction and eventually the uploading into online data repositories. Without the full disclosure of our data and a transparent data flow, it is evident that we cannot live up to one of the governing doctrines in the sciences, namely reproducibility of our scientific experiments and findings.

  8. 40Ar/39Ar ages of adularia from the Golden Cross, Neavesville, and Komata epithermal deposits, Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar ages of adularia from three epithermal vein deposits in the Hauraki Goldfield constrain when these deposits formed. Adularia from veins at Neavesville has 40Ar/39Ar plateau and isochron ages of 6.89 ± 0.02 and 6.86 ± 0.02 Ma, respectively, similar to the 40Ar/39Ar plateau and isochron ages of adularia from veins at Golden Cross of 6.96 ± 0.04 and 6.93 ± 0.03 Ma, respectively. In contrast, Komata mineralisation formed at 5.99 ± 0.02 to 6.07 ± 0.03 Ma, based on the 40Ar/39Ar isochron and plateau ages of the adularia in these veins, similar to the previously reported 6.0 Ma age of mineralisation at Waihi/Favona. These preliminary data suggest that mineralisation in the Hauraki Goldfields occurred episodically. (author). 19 refs., 3 figs., 1 tab

  9. Intracellular Cadmium Isotope Fractionation

    Science.gov (United States)

    Horner, T. J.; Lee, R. B.; Henderson, G. M.; Rickaby, R. E.

    2011-12-01

    Recent stable isotope studies into the biological utilization of transition metals (e.g. Cu, Fe, Zn, Cd) suggest several stepwise cellular processes can fractionate isotopes in both culture and nature. However, the determination of fractionation factors is often unsatisfactory, as significant variability can exist - even between different organisms with the same cellular functions. Thus, it has not been possible to adequately understand the source and mechanisms of metal isotopic fractionation. In order to address this problem, we investigated the biological fractionation of Cd isotopes within genetically-modified bacteria (E. coli). There is currently only one known biological use or requirement of Cd, a Cd/Zn carbonic anhydrase (CdCA, from the marine diatom T. weissfloggii), which we introduce into the E. coli genome. We have also developed a cleaning procedure that allows for the treating of bacteria so as to study the isotopic composition of different cellular components. We find that whole cells always exhibit a preference for uptake of the lighter isotopes of Cd. Notably, whole cells appear to have a similar Cd isotopic composition regardless of the expression of CdCA within the E. coli. However, isotopic fractionation can occur within the genetically modified E. coli during Cd use, such that Cd bound in CdCA can display a distinct isotopic composition compared to the cell as a whole. Thus, the externally observed fractionation is independent of the internal uses of Cd, with the largest Cd isotope fractionation occurring during cross-membrane transport. A general implication of these experiments is that trace metal isotopic fractionation most likely reflects metal transport into biological cells (either actively or passively), rather than relating to expression of specific physiological function and genetic expression of different metalloenzymes.

  10. Discovery of the Arsenic Isotopes

    CERN Document Server

    Shore, A; Heim, M; Schuh, A; Thoennessen, M

    2009-01-01

    Twenty-nine arsenic isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  11. Discovery of the Scandium Isotopes

    CERN Document Server

    Meierfrankenfeld, D

    2010-01-01

    Twenty-three scandium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  12. Discovery of the Tungsten Isotopes

    OpenAIRE

    A. Fritsch; Ginepro, J. Q.; Heim, M.; Schuh, A.; SHORE, A.; Thoennessen, M

    2009-01-01

    Thirty-five tungsten isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  13. Discovery of the Vanadium Isotopes

    OpenAIRE

    SHORE, A.; A. Fritsch; Heim, M.; Schuh, A.; Thoennessen, M

    2009-01-01

    Twenty-four vanadium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  14. Discovery of the Barium Isotopes

    OpenAIRE

    SHORE, A.; A. Fritsch; Ginepro, J. Q.; Heim, M.; Schuh, A.; Thoennessen, M

    2009-01-01

    Thirty-eight barium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  15. Discovery of the Silver Isotopes

    OpenAIRE

    Schuh, A.; A. Fritsch; Ginepro, J. Q.; Heim, M.; SHORE, A.; Thoennessen, M

    2009-01-01

    Thirty-eight silver isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  16. Discovery of the Cadmium Isotopes

    OpenAIRE

    Amos, S.; Thoennessen, M

    2009-01-01

    Thirty-seven cadmium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  17. Discovery of the Krypton Isotopes

    OpenAIRE

    Heim, M.; A. Fritsch; Schuh, A.; SHORE, A.; Thoennessen, M

    2009-01-01

    Thirty-two krypton isotopes have been observed so far; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  18. Discovery of the Iron Isotopes

    OpenAIRE

    Schuh, A.; A. Fritsch; Heim, M.; SHORE, A.; Thoennessen, M

    2009-01-01

    Twenty-eight iron isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  19. Discovery of the Gold Isotopes

    OpenAIRE

    Schuh, A.; A. Fritsch; Ginepro, J. Q.; Heim, M.; SHORE, A.; Thoennessen, M

    2009-01-01

    Thirty-six gold isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  20. Discovery of the Cobalt Isotopes

    OpenAIRE

    Szymanski, T; Thoennessen, M

    2009-01-01

    Twenty-six cobalt isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  1. Dicty_cDB: FC-AR11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR11 (Link to dictyBase) - - - Contig-U14938-1 FC-AR11E (Li...nk to Original site) - - - - - - FC-AR11E 918 Show FC-AR11 Library FC (Link to library) Clone ID FC-AR11 (Li... 8.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: endoplasmic reticulum >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR11Q.Seq.d/ Representative seq. ID FC-AR...11E (Link to Original site) Representative DNA sequence >FC-AR11 (FC-AR11Q) /CSM/FC/FC-AR/FC-AR11Q.Seq.

  2. Dicty_cDB: FC-AR19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR19 (Link to dictyBase) - - - Contig-U16521-1 FC-AR19Z (Li...nk to Original site) - - FC-AR19Z 565 - - - - Show FC-AR19 Library FC (Link to library) Clone ID FC-AR19 (Li... 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR19 is .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR19Q.Seq.d/ Representative seq. ID FC-AR...19Z (Link to Original site) Representative DNA sequence >FC-AR19 (FC-AR19Q) /CSM/FC/FC-AR/FC-AR19Q.Seq.

  3. Dicty_cDB: FC-AR15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR15 (Link to dictyBase) - - - Contig-U16022-1 FC-AR15E (Li...nk to Original site) - - - - - - FC-AR15E 390 Show FC-AR15 Library FC (Link to library) Clone ID FC-AR15 (Li..., including cell wall 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR15 is cyt 5' .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR15Q.Seq.d/ Representative seq. ID FC-AR...15E (Link to Original site) Representative DNA sequence >FC-AR15 (FC-AR15Q) /CSM/FC/FC-AR/FC-AR15Q.Seq.

  4. Dicty_cDB: FC-AR07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR07 (Link to dictyBase) - - - Contig-U16276-1 FC-AR07Z (Li...nk to Original site) - - FC-AR07Z 604 - - - - Show FC-AR07 Library FC (Link to library) Clone ID FC-AR07 (Li...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: cytoplasmic 36.0 %: nuclear 8.0 %: cytoskeletal 8.0 %: mitochondrial >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR07Q.Seq.d/ Representative seq. ID FC-AR...07Z (Link to Original site) Representative DNA sequence >FC-AR07 (FC-AR07Q) /CSM/FC/FC-AR/FC-AR07Q.Seq.

  5. Dicty_cDB: FC-AR24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR24 (Link to dictyBase) - G24050 DDB0191443 Contig-U16141-1 FC-AR...24E (Link to Original site) - - - - - - FC-AR24E 785 Show FC-AR24 Library FC (Link to library) Clone ID FC-AR...sicles of secretory system 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-AR...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR24Q.Se...q.d/ Representative seq. ID FC-AR24E (Link to Original site) Representative DNA sequence >FC-AR24 (FC-AR24Q) /CSM/FC/FC-AR/FC-AR

  6. Dicty_cDB: FC-AR13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR13 (Link to dictyBase) - - - Contig-U16456-1 FC-AR13Z (Li...nk to Original site) - - FC-AR13Z 550 - - - - Show FC-AR13 Library FC (Link to library) Clone ID FC-AR13 (Li... 8.0 %: mitochondrial 4.0 %: extracellular, including cell wall >> prediction for FC-AR13 is nuc 5' e.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR13Q.Seq.d/ Representative seq. ID FC-AR...13Z (Link to Original site) Representative DNA sequence >FC-AR13 (FC-AR13Q) /CSM/FC/FC-AR/FC-AR13Q.Seq.

  7. Changes in the mean square charge radii and electromagnetic moments of neutron-deficient Bi isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Barzakh, A. E., E-mail: barzakh@mail.ru; Batist, L. Kh.; Fedorov, D. V.; Ivanov, V. S.; Molkanov, P. L.; Moroz, F. V.; Orlov, S. Yu.; Panteleev, V. N.; Seliverstov, M. D.; Volkov, Yu. M. [Petersburg Nuclear Physics Institute (PNPI), NRC Kurchatov Institute, Gatchina 188300 (Russian Federation)

    2015-10-15

    In-source laser spectroscopy experiments for neutron deficient bismuth isotopes at the 306.77 nm atomic transition were carried out at the IRIS (Investigation of Radioactive Isotopes on Synchrocyclotron) facility of Petersburg Nuclear Physics Institute (PNPI). New data on isotope shifts and hyperfine structure for {sup 189–198,} {sup 211}Bi isotopes and isomers were obtained. The changes in the mean-square charge radii and the magnetic moment values were deduced. Marked deviation from the nearly spherical behavior for ground states of bismuth isotopes at N < 109 is demonstrated, in contrast to the lead and thallium isotopic chains. The big isomer shift between I = 1/2 (intruder) and I = 9/2 (normal) states for odd Bi isotopes (A = 193, 195, 197) was found.

  8. 40Ar/39Ar geochronology and exhumation of mylonitized metamorphic complex in Changle-Nanao ductile shear zone

    Institute of Scientific and Technical Information of China (English)

    王志洪; 卢华复

    1997-01-01

    New 40Ar/39Ar plateau ages from rocks of Changle-Nanao ductile shear zone are 107.9 Ma(Mus), 108.2 Ma(Bi), 107. 1 Ma(Bi), 109. 2 Ma(Hb) and 117. 9 Ma(Bi) respectively, which are concordant with their isochron ages and record the formation age of the ductile shear zone. The similarity and apparent overlap of the cooling ages with respective closure temperatures of 5 minerals document initial rapid uplift during 107-118 Ma following the collision between the Min-Tai microcontinent and the Min-Zhe Mesozoic volcanic arc. The 40Ar/39Ar plateau ages, K-Ar date of K-feldspar and other geochronologic information suggest that the exhumation rate of the ductile shear zone is about 0.18-1.12 mm/a in the range of 107-70 Ma, which is mainly influenced by tectonic extension.

  9. New 40Ar/39Ar dates of adularia from epithermal deposits in the Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar dates of vein and wall rock adularia from seven epithermal deposits and one porphyry copper prospect help constrain the ages of mineralisation in the Hauraki Goldfield. Vein adularia from the Paritu region yielded a single 40Ar/39Ar plateau date of 16.315 ± 0.066 Ma. Five 40Ar/39Ar plateau dates of three samples of vein adularia from the Opitonui deposit overlap within error to yield a preferred age of 13.149 ± 0.016 Ma. Two samples of vein adularia from the Night Reef at the Broken Hills deposit yield exceptionally flat 40Ar/39Ar plateaus, and all date overlap within error to provide an age of 7.121 ± 0.010 Ma. Two 40Ar/39Ar plateau dates of one sample of vein adularia from the Wharekirauponga deposit overlap within error to provide an age of 6.318 ± 0.061 Ma. Four 40Ar/39Ar plateau dates of three samples of vein adularia from the Maratoto deposit overlap within error to provide an age of 6.411 ± 0.022 Ma. Two samples of adularia from altered wall rock at the Sovereign deposit yield three 40Ar/39Ar plateau dates that range from 6.547 ± 0.021 Ma to 6.806 ± 0.028 Ma. This suggest that mineralisation formed around 6.6 Ma, but the results are complicated because the adularia contains minor illite that post-dates adularia formation. Results from the Karangahake deposit are complex. Two samples of vein adularia yield three 40Ar/39Ar plateau dates that range from 6.116 ± 0.116 Ma to 6.901 ± 0.101 Ma, wheras one sample of wall rock adularia that contains minor late illite yields two 40Ar/39Ar plateau dates that overlap within error to provide a date of 5.734 ± 0.041. The range of dates indicates that more work is necessary to understand the history of mineralisation at this deposit. Two samples of vein adularia from the Tui deposit yield four 40Ar/39Ar plateau dates that overlap within error to provide an age of 5.714 ± 0.017 Ma. These results confirm previous work that indicates that the ages of epithermal deposit young southward in the Hauraki

  10. Recombination measurements at low energies with Ar16+ and Ar18+ ions in a dense, cold electron target

    International Nuclear Information System (INIS)

    Recombination of multiply charged ions with electrons at very low relative energies has become a major topic of interest, due to the observation of rates which are enhanced beyond the expectations for radiative recombination. We present results for Ar16+ and Ar18+ ions from systematic measurements along the argon isonuclear sequence using a high density cold electron beam target (ne = 7 x 109 cm-3) at the UNILAC of GSI. The transverse and longitudinal temperatures of the electron beam were determined from DR resonance features observed with metastable Ar16+ (23S) ions. The rate at Erel = 0 for radiative recombination of completely stripped Ar18+ calculated with electron beam temperatures kTparallel = 0.002 eV, kTperpendicular = 0.2 eV amounts to α = 10-9 cm3 s-1. This is exceeded by nearly a factor of 10 by the rate measured in experiments with Ar18+ ions

  11. Evaluation of the IPCC Models (AR4 and AR5) in the Precipitation Simulation in the Northeast of Brazil

    Science.gov (United States)

    Alves, José; Vasconcelos Junior, Francisco; Chaves, Rosane; Silva, Emerson; Servain, Jacques; Costa, Alexandre; Sombra, Sérgio; Barbosa, Augusto; Dos Santos, Antonio

    2016-04-01

    With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC), comparative studies are necessary between observations and the so-called historical run (C20) and future projections of the AR4 (A2) and AR5 (RCP8.5) experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5) in representing the anuall average and seasonal rainfall variation (summer and autumn) in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation) data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  12. Evaluation of the IPCC Models (AR4 and AR5 in the Precipitation Simulation in the Northeast of Brazil

    Directory of Open Access Journals (Sweden)

    José Brabo Alves

    2016-04-01

    Full Text Available With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC, comparative studies are necessary between observations and the so-called historical run (C20 and future projections of the AR4 (A2 and AR5 (RCP8.5 experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5 in representing the anuall average and seasonal rainfall variation (summer and autumn in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  13. 39Ar groundwater dating of a coastal aquifer in the Nam Dinh Province, Vietnam

    Science.gov (United States)

    Gerber, Christoph; Purtschert, Roland; Larsen, Flemming; Hoang, Hoan V.; Tran, Long V.; Tran, Luu T.; Pham, Nhan Q.; Sültenfuss, Jürgen

    2013-04-01

    In the south of Nam Dinh Province, Red River Delta, Vietnam, fresh Pleistocene groundwater has been identified to exist next to brackish pore waters in the Red River area (WAGNER et al. 2011). Extensive exploitation of the fresh water results in decreasing groundwater heads and migration of brackish water towards the freshwater (WAGNER et al., 2012). In order to understand the dynamics and origin of the fresh and saltwater and to predict the future evolution of the resource an extensive investigation using environmental tracers has been carried out. 39Ar, 85Kr, 3H/3He and stable noble gas measurements have been used for groundwater dating. Stable isotopes and other geochemical parameters (stable isotopes of the water molecule, water chemistry and gas composition) provide crucial information about the genesis of the water. Groundwater ages are modern in the recharge area and increase to > 1000 years towards the coast and northwards based on the 39Ar data (T1-2: 269 years). Depleted stable noble gas concentrations correlate with high concentrations of dissolved methane suggesting degassing due to the high methane partial pressure. Physical modelling of the degassing process (AESCHBACH-HERTIG et al., 2008) supported by concentrations of accumulated radiogenic 4He indicates that diffusion controlled the observed degassing at a late stage of the groundwater evolution path. References Aeschbach-Hertig, W., El-Gamal, H., Wieser, M., Palcsu, L., 2008. Modeling excess air and degassing in groundwater by equilibrium partitioning with a gas phase. Water Resour Res 44:W08449. Wagner, F., Trung, Ð. T., Phúc, H. Ð., Lindenmaier, F., 2011, Assessment of Groundwater Resources in Nam Dinh Province, Final Technical Report, Part A, Improvement of Groundwater Protection in Vietnam. Wagner, F., Ludwig, R. R., Noell, U., Hoang, H. V., Pham, N. Q., Larsen, F., Lindenmaier, F., 2012, Genesis of economic relevant fresh groundwater resources in Pleistocene/Neogene aquifers in Nam Dinh

  14. Ar-Ar investigations on Quarternary volcanic sequences of Monte Vulture (Southern Italy)

    Science.gov (United States)

    Buettner, A.; Principe, C.; Villa, I. M.

    2003-04-01

    Volcanic sanidines and phlogopites from feldspathoid- or sanidine-bearing volcanic sequences of Monte Vulture (Southern Italy) were analysed using Ar-Ar stepwise heating. In all samples phlogopite and sanidine are internally inhomogeneous as observed in a plot of Cl/K ratio vs step-age. At least two phases that are degassed during different temperature steps can be distinguished, resulting in internal discordance. Hence, all samples are affected by impurities and have to be treated as heterochemical mixtures. These effects are strongest in phlogopite. The high uncertainty of the calculated ages mirrors the statistically significant age discordance. The calculation of average ages was focused on isochemical steps. Isochron calculations necessarily give less precise ages because of the excessive scatter of datapoints. Moreover, most coarse grained phlogopites could contain excess 40Ar (as suggested by non-atmospheric intercepts in isochron plots) which could be of mantle origin. The analysed phlogopites from carbonatitic and melilite-foiditolite rocks of the upper stratigraphical sequence of Monte Vulture are Mg-rich, which indicates a mantle provenance (Stoppa and Woolley, 1997). All calculated phlogopite ages have, therefore, to be considered with caution. One sample, PG5, contains both sanidine and matrix phlogopite. This offers the possibility to directly compare the analytical results and further decipher possible inconsistencies. Ages were calculated as the average of isochemical steps, and errors are indicated at the 95% confidence level. Sanidine gives a weighted average age of 752±13 ka in agreement with the phlogopite age of 801±88 ka. In comparison to these average step ages, an isochron over five sanidine-steps yields an age of 737±35 ka (MSWD=1.5) and an atmospheric intercept of 295±49. The eruptive time-span covered by the analysed samples is 75±20 ka, confirming that the eruption history of Monte Vulture has been organised in clusters of activity

  15. Emplacement age for the mafic-ultramafic plutons in the northern Dabie Mts. (Hubei): Zircon U-Pb, Sm-Nd and 40Ar/39Ar dating

    Institute of Scientific and Technical Information of China (English)

    WANG; Jianghai

    2002-01-01

    , China, Sci. in China, Ser. D, 2000, 43(2): 225-236.[11]Hacker, B. R., Wang, Q. C., Ar/Ar geochronology of ultrahigh-pressure metamorphism in Central China, Tectonics, 1995, 14: 994-1006.[12]Ge, N. J., Hou, Z. H., Li, H. M. et al., Zircon U-Pb ages of the Shacun gabbro body, Yuexi, Dabie orogen and its geological implications, Chinese Sci. Bull., 2000, 45(1): 74-79.[13]Xu, S. T., Liu, Y. C., Jiang, L. L. et al., Tectonic Regime and Evolution of the Dabie Mountains, Beijing: Science Press, 1994, 1-175.[14]Li, S. G., Ni, Y. H., Zheng, S. G. et al., Interaction between subducted continental crust and the mantle: I. Major and trace element geochemistry of syncollisional mafic-ultramafic intrusions in the Dabie Mountains, Sci. in China, Ser. D, 1998, 41(5): 545-553.[15]Blundy, J. D., Holland, T. J. B., Calcic amphibole equilibrium and a new amphibole plagioclase geothermometer, Contrib. Mineral. Petrol. 1990, 104: 208-224.[16]Hammartron, J. M., Zen, E. A., Aluminum in hornbole: an empirical igneous geobarometer, Amer. Mineral., 1986, 71: 1297-1313.[17]Hollister, L. S., Grisson, G. C., Peters, E. K. et al., Confirmation of the empirical correlation of Al in hornblende with pressure of solidification of calcalkaline plutons, Amer. Mineral., 1987, 72: 231-239.[18]Johnson, M. C., Rutherford, M. J., Experimental calibration of an aluminium-hornblende geobarometer applicable to calc-alkaline rocks, EOS, 1988, 69: 1511.[19]Whitney, J. A., Stormer, J. C., The distribution of NaAlSi3O8 between coexisting microcline and plagioclase and its effect on geothermometric calculations, Am. Mineral., 1977, 62: 687-691.[20]Zhang, R. Y., Cong, B. L., Mineral Thermometers and Barometers, Beijing: Geological Publishing House, 1983, 150-173.[21]Krogh, T. E., A low-contamination method for hydrothermal decomposition of zircon and extraction of U and Pb for isotopic age determinations, Geochim. Cosmochim. Acta, 1973, 48: 505-511.[22]Krogh, T. E., Vapour

  16. Contributions à la chaine logistique numérique : conception de circuits courts et planification décentralisée.

    OpenAIRE

    Ogier, Maxime

    2013-01-01

    The concept of digital supply chain gathers models, methods and tools to plan decisions on digital prototypes of supply chains. This doctoral dissertation proposes two contributions to digital supply chain. Mainly, our results address small and medium enterprises/industries. Firstly, we study two new problems related to service network design for short and local fresh food supply chains. For each of them we propose a Mixed Integer Linear Programming formulation. Decomposition-based methods ar...

  17. ISOTOPIC MASS FRACTIONATION OF SOLAR WIND: EVIDENCE FROM FAST AND SLOW SOLAR WIND COLLECTED BY THE GENESIS MISSION

    International Nuclear Information System (INIS)

    NASA's Genesis space mission returned samples of solar wind collected over ∼2.3 years. We present elemental and isotopic compositions of He, Ne, and Ar analyzed in diamond-like carbon targets from the slow and fast solar wind collectors to investigate isotopic fractionation processes during solar wind formation. The solar wind provides information on the isotopic composition for most volatile elements for the solar atmosphere, the bulk Sun and hence, on the solar nebula from which it formed 4.6 Ga ago. Our data reveal a heavy isotope depletion in the slow solar wind compared to the fast wind composition by 63.1 ± 2.1 per mille for He, 4.2 ± 0.5 per mille amu–1 for Ne and 2.6 ± 0.5 per mille amu–1 for Ar. The three Ne isotopes suggest that isotopic fractionation processes between fast and slow solar wind are mass dependent. The He/H ratios of the collected slow and fast solar wind samples are 0.0344 and 0.0406, respectively. The inefficient Coulomb drag model reproduces the measured isotopic fractionation between fast and slow wind. Therefore, we apply this model to infer the photospheric isotopic composition of He, Ne, and Ar from our solar wind data. We also compare the isotopic composition of oxygen and nitrogen measured in the solar wind with values of early solar system condensates, probably representing solar nebula composition. We interpret the differences between these samples as being due to isotopic fractionation during solar wind formation. For both elements, the magnitude and sign of the observed differences are in good agreement with the values predicted by the inefficient Coulomb drag model.

  18. Surface modification and biocompatible improvement of polystyrene film by Ar, O2 and Ar + O2 plasma

    International Nuclear Information System (INIS)

    Highlights: ► NVP is successfully grafted onto the different discharge gases (Ar, O2, and Ar + O2) plasma-treated PS film surface by Ar plasma induced graft polymerization. ► Compare with Ar and O2 plasma, the Ar + O2 plasma-treated film surface introduced large amounts of NVP, as known from ATR-FTIR and XPS results. ► According to SEM, the surface roughness increased at different levels after plasma treatment. Contact angle reveal that the hydrophilicity of the PS film surface was greatly improved. ► Cellular compatibility tests indicate that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. - Abstract: This paper reports the surface modification of different discharge gases (Ar, O2, and Ar + O2) plasma-treated polystyrene (PS) film by Ar plasma induced graft polymerization, with biocompatible monomer N-vinyl-2-pyrrolidone (NVP) is carried out to improve biocompatibility. The films are characterized by attenuated total reflectance Fourier transfer infrared (ATR-FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS) and scanning electron microscopy (SEM). Water contact angle measurement demonstrates the modified films possess a relatively hydrophilic surface. Furthermore, the films are also examined cell attachment and proliferation in vitro using mouse fibroblasts (L929 cells). The modified film surface shows a better cell distribution and growth than that of the pristine PS surface. From cell culture experiments, it is also observed that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. This method will provide a potential and effective solution for grafting useful component in future tissue-engineering applications.

  19. Ar Ar dating of authigenic K-feldspar: Quantitative modelling of radiogenic argon-loss through subgrain boundary networks

    Science.gov (United States)

    Mark, D. F.; Kelley, S. P.; Lee, M. R.; Parnell, J.; Sherlock, S. C.; Brown, D. J.

    2008-06-01

    We have analysed two distinct generations of authigenic K-feldspar in Fucoid Bed sandstones from An-t-Sron and Skiag Bridge, NW Highlands, Scotland, which have experienced post-growth heating to levels in excess of the predicted Ar-closure temperature. Authigenic K-feldspars show microtextural similarities to patch perthites; that is subgrains separated by dislocation-rich boundary networks that potentially act as fast diffusion pathways for radiogenic argon. The two generations of authigenic K-feldspar in the Fucoid Bed sandstones can be distinguished by different microtextural zones, bulk mineral compositions, fluid-inclusion populations, and inferred temperatures and chemistries of parent fluids. Ar-Ar age data obtained using high-resolution ultraviolet laser ablation, show that the first cementing generation is Ordovician and the second cementing generation is Silurian. Modelling of Ar diffusion using subgrain size as the effective diffusion dimension and a simplified tectono-thermal thrust model assuming transient heating of the Fucoid Beds is inconsistent with observed data. Removal of heat from the thrust zone through rapid flushing of heated fluids rather than transient heating can be invoked to explain the observed Ar-Ar ages for both generations of cement. Alternatively, Ar-diffusion modelling using overgrowth thickness as the effective diffusion dimension instead of subgrain size also yields models that are consistent with both the Fucoid Bed palaeothermal maxima and determined Ar-Ar age ages for the two generations of K-feldspar cement. Based on this alternate explanation, we propose a theoretical microtextural model that highlights fundamental differences between the microtextures of deuterically formed patch perthites and authigenic K-feldspars, explaining the apparent robustness of authigenic K-feldspar with respect to Ar-retention.

  20. Stable isotopes labelled compounds

    International Nuclear Information System (INIS)

    The catalogue on stable isotopes labelled compounds offers deuterium, nitrogen-15, and multiply labelled compounds. It includes: (1) conditions of sale and delivery, (2) the application of stable isotopes, (3) technical information, (4) product specifications, and (5) the complete delivery programme

  1. Detecting isotopic ratio outliers

    International Nuclear Information System (INIS)

    An alternative method is proposed for improving isotopic ratio estimates. This method mathematically models pulse-count data and uses iterative reweighted Poisson regression to estimate model parameters to calculate the isotopic ratios. This computer-oriented approach provides theoretically better methods than conventional techniques to establish error limits and to identify outliers. 6 refs., 3 figs., 3 tabs

  2. New 40Ar/39Ar Ages From Southwest Bolivia Refine the Timing of APVC Volcanism

    Science.gov (United States)

    Salisbury, M.; de Silva, S. L.; Jicha, B.; Singer, B.; Jiménez, N.; Ort, M.

    2008-12-01

    The Altiplano-Puna Volcanic Complex (APVC) of the Central Andes has produced prodigious silicic volcanism (at least 11,000 km3 of magma) over the last 10 Ma including some of the largest known ignimbrites on Earth. Despite excellent exposure, little previous work had been conducted on the timing and distribution of ignimbrite volcanism in the Lípez region of southwestern Bolivia, the heart of the APVC. To address this deficiency we have performed ~612 single crystal laser-fusion 40Ar/39Ar analyses from 39 pumice and bulk matrix samples collected from the main ignimbrite units within the Lípez region. Geochemistry of pumice and mineral samples, and paleomagnetic data are also being used to correlate individual ignimbrite units. Our new 40Ar/39Ar results establish new or refined eruption ages (with 2σ error) from the Vilama caldera at 8.41±0.02 Ma, Pastos Grandes caldera at 5.45±0.02 and 2.94±0.01 Ma, and Guacha caldera at 5.65±0.01, and 3.57±0.02 Ma. New ages were also determined for eruptions from the Panizos ignimbrite shield (6.86±0.03 Ma), Juvina ignimbrite shield (5.23±0.01 Ma), and the Laguna Colorado ignimbrite shield (2.21±0.05 and 1.95±0.03 Ma). The oldest ignimbrite we have found in the area is 10.33±0.64 Ma, a local unit beneath the Vilama ignimbrite. The youngest units have been identified west of the Guacha caldera with eruption ages of 1.70±0.6 Ma and 0.70±0.01 Ma. These results demonstrate that ignimbrite-producing eruptions in the Lípez region span the age of APVC volcanism previously established, with the largest eruptions occurring from long-lived, cyclic supervolcano caldera systems like Guacha and Pastos Grandes. The aggregate data from the APVC support the hypothesis that the APVC developed predominantly during distinct pulses of massive ignimbrite eruptions at ~8, 6, and 4 Ma and attest to episodic behavior of the magmatic system. Ignimbrites of geothermal presence and active local surface deformation suggest that the magma

  3. Supply Chain Management og Supply Chain costing

    DEFF Research Database (Denmark)

    Nielsen, Steen; Mortensen, Ole

    2002-01-01

    Formålet med denne artikel er at belyse de muligheder som ligger i at integrere virksomhedens økonomiske styring med begrebet Supply Chain Management (SCM). Dette søges belyst ved først at beskrive den teoretiske ramme, hvori SCM indgår. Herefter analyseres begrebet Supply Chain Costing (SCC) som...... Århus. Et resultat er, at via begrebet Supply Chain Costing skabes der mulighed for at måle logistikkædens aktiviteter i kr./øre. Anvendelsen af denne information har også strategisk betydning for at kunne vælge kunde og leverandør. Ved hjælp af integrationen skabes der også helt nye mulighed...

  4. Principles of stable isotope distribution

    CERN Document Server

    Criss, Robert E

    1999-01-01

    1. Abundance and Measurement of Stable Isotopes 1.1. Discovery of Isotopes 1.2. Nuclide Types, Abundances, and Atomic Weights 1.3. Properties and Fractionation of Isotopic Molecules 1.4. Material Balance Relationships 1.5. Mass Spectrometers 1.6. Notation and Standards 1.7. Summary 1.8. Problems References 2. Isotopic Exchange and Equilibrium Fractionation 2.1. Isotopic Exchange Reactions 2.2. Basic Equations 2.3. Molecular Models 2.4. Theory of Isotopic Fractionation 2.5. Temperature Dependence of Isotopic Fractionation Factors 2.6. Rule of the Mean 2.7. Isotopic Thermometers

  5. Understanding the Chain Fountain

    CERN Document Server

    Biggins, John Simeon

    2013-01-01

    If a chain is initially at rest in a beaker at a height h1 above the ground, and the end of the chain is pulled over the rim of the beaker and down towards the ground and then released, the chain will spontaneously "flow" out of the beaker under gravity. Furthermore, if h1 is sufficient, the beads do not simply drag over the edge of the beaker but form a fountain reaching a height h2 above it. We show that the formation of a fountain requires that the beads come into motion not only by being pulled upwards by the part of the chain immediately above the pile, but also by being pushed upwards by an anomalous reaction force from the pile of stationary chain. We propose possible origins for this force, argue that its magnitude will be proportional to the square of the chain velocity, and predict and verify experimentally that h2 is proportional to h1.

  6. Multi-isotopic system geochronology of low temperature eclogite from Huangzhen, Southern Dabie Terrain

    Institute of Scientific and Technical Information of China (English)

    CHEN Daogong; E. Deloule; CHENG Hao; XIA Qunke; WU Yuanbao

    2004-01-01

    Zircon U-Pb thermal ionization mass-spectrometer (TIMS) and secondary ion mass-spectrometer (SIMS) dating, mica and amphibole 40Ar-39Ar dating and mineral Sm-Nd isotopic compositions of Huangzhen Iow temperature eclogite and country granitic gneiss are carried out. The zircon U-Pb weighted average SIMS age is (231.6±9.7) Ma for one eclogite.The mica 40Ar-39Ar isochron age is (232.6±2.1) Ma and the lowest plateau age is (221.7±2.4)Ma from same sample. U-Pb TIMS concordant ages from other eclogite zircons are from (221.3± 1.4) Ma to (222.5±2.3) Ma. U-Pb SIMS low intercept age from country granitic gneiss is (221±35) Ma. The retrograde amphibole 40Ar-39Ar isochron age is (205.9± 1.0) Ma. Except for mica,which may contain excess 40Ar, all the ages represent peak and retrograde metamorphism of low temperature eclogites. It is indicated that the Huangzhen low temperature eclogites differ from Xiongdian low temperature eclogites of north of the Northern Dabie Terrain in metamorphic ages.Huangzhen low temperature eclogites share one coherent HP-UHP terrain with high temperature eclogites from Southern Dabie Terrain and they may have differences in subduction depth and cooling rates during exhumation.

  7. Isotopes in Greenland Precipitation

    DEFF Research Database (Denmark)

    Faber, Anne-Katrine

    Greenland ice cores offer a unique opportunity to investigate the climate system behaviour. The objective of this PhD project is to investigate isotope modelling of present- day conditions and conduct model-data comparison using Greenland ice cores. Thus this thesis investigates how the integration...... of model and data can be used to improve the understanding of climate changes. This is done through analysis of isotope modelling, observations and ice core measurements. This dissertation comprises three projects: (1) Modelling the isotopic response to changes in Arctic sea surface conditions, (2......) Constructing a new Greenland database of observations and present-day ice core measurements, and (3) Performance test of isotope-enabled CAM5 for Greenland. The recent decades of rapid Arctic sea ice decline are used as a basis for an observational-based model experiment using the isotope-enabled CAM model 3...

  8. Food supply chains

    OpenAIRE

    Zhou, Qian

    2011-01-01

    The dissertation analyses food waste in global supply chain. From the related managerial literature, the process of supply chain operation, from agriculture, manufacturing, warehouses, retailers to customers are explained clearly. Then the reasons and characteristics of food wastes in any point of food supply chain are analyzed. From some case studies and questionnaire investigation, some corresponding methods to reduce food waste are put forward in the following. Lastly, in terms of method s...

  9. Economy, market and chain

    OpenAIRE

    Sukkel, W.; Hommes, M.

    2009-01-01

    In their pursuit of growth and professionalisation, the Dutch organic sector focuses primarily on market development. But how do you stimulate the market for organic foods? This is the subject of many research projects concerning market, consumer preferences and the supply chain. These projects focus specifically at consumer purchasing behaviour, product development, supply chain formation and minimising cost price. As a rule, this research takes place in close cooperation with chain actors

  10. Supply Chain Collaboration

    OpenAIRE

    Meca, Ana; Timmer, Judith

    2008-01-01

    In this chaper, we have reviewed and surveyed the literature on supply chain collaboration. As mentioned above, the game theory models that include cooperative behaviour among retailers seem to be a natural framework to model cooperation (collaboration) in supply chains that consist of a supplier and a finite number of retailers. Various researchers in this area have already adopted several cooperative models dealing with supply chain coordination, and it is expected to see many more in the n...

  11. Sustainable Supply Chain Management

    OpenAIRE

    Geentjens, Marlies

    2013-01-01

    This project investigates the phenomena Sustainable Supply Chain Management. The point of departure is Supply Chain Management, which we analyse in order to lock into an understanding of the development that occur when implementing sustainability. In the quest for higher understanding of the interlocking mechanisms of supply chain management, we combine a theoretical approach to the developmnent of sustainability with some relevant case-examples (mainly depicting IKEA). This focal point g...

  12. Supply chain components

    Directory of Open Access Journals (Sweden)

    Vieraşu, T.

    2011-01-01

    Full Text Available In this article I will go through three main logistics components, which are represented by: transportation, inventory and facilities, and the three secondary logistical components: information, production location, price and how they determine performance of any supply chain. I will discuss then how these components are used in the design, planning and operation of a supply chain. I will also talk about some obstacles a supply chain manager may encounter.

  13. Supply chain components

    OpenAIRE

    Vieraşu, T.; Bălăşescu, M.

    2011-01-01

    In this article I will go through three main logistics components, which are represented by: transportation, inventory and facilities, and the three secondary logistical components: information, production location, price and how they determine performance of any supply chain. I will discuss then how these components are used in the design, planning and operation of a supply chain. I will also talk about some obstacles a supply chain manager may encounter.

  14. Multicollector ICPMS and TIMS as tools for isotopic fingerprinting

    Science.gov (United States)

    Bouman, C.; Schwieters, J. B.; Lloyd, N. S.; Trinquier, A.

    2012-04-01

    Elements such as C, N, O and S are essential for chemical and biological processes in nature and very small shifts in the isotopic composition of these elements are important tracers to explore complex processes in nature. During the last few years, stable isotopes of elements as Cl, Ca, Fe, Cu, Zn, Sr, Hg and Pb are getting more and more attention as tracer to study biomedical and environmental processes, as well as forensics and archaeometry. Multi-collector ICPMS and TIMS enable high-precision isotopic analysis of these so-called non-traditional stable isotope systems. MC-ICPMS is a powerful technique for the isotopic analysis of most elements, with the exception of light elements such as H, C, N and O and the noble gases. Various inlet systems can be used to introduce samples into the mass spectrometer, for instance gas chromatography (GC), liquid chromatography (LC) ) for compound-specific isotope analysis, laser ablation for direct analysis of solids, or conventional liquid nebulization for liquid samples. The aerosol is transported by an Ar and/or He gas flow into the ICP source where it is effectively ionized and introduced into the mass analyzer through a differential pumping system. Molecular interferences as carbides, nitrides, oxides, argides or doubly-charged species can show up in the mass spectrum and interfere with the elemental isotope peaks. High mass resolution is needed to effectively discriminate against these interferences. The NEPTUNE Plus is specially designed to meet this requirement and expand the power of isotope ratio measurements even to elements where previously isobaric interferences were the limit. For some specific isotope systems, such as Ca, Sr and Pb, the thermal ionization technique may have advantages, due to the potentially lower backgrounds and higher sensitivity. Prior to the TIMS analysis, the sample is chemically purified, loaded on a filament and introduced into the mass spectrometer. With the introduction of the TRITON

  15. A Survey on Web-based AR Applications

    CERN Document Server

    Parhizkar, Behrang; Lashkari, Arash Habibi; Bartaripou, Mohammad Mehdi; Babae, Hossein Reza

    2011-01-01

    Due to the increase of interest in Augmented Reality (AR), the potential uses of AR are increasing also. It can benefit the user in various fields such as education, business, medicine, and other. Augmented Reality supports the real environment with synthetic environment to give more details and meaning to the objects in the real word. AR refers to a situation in which the goal is to supplement a user's perception of the real-world through the addition of virtual objects. This paper is an attempt to make a survey of web-based Augmented Reality applications and make a comparison among them.

  16. Wellness- joogatyöpajojen tuotekehitys: case ArsMondo

    OpenAIRE

    Koukonen, Heidi; Lintunen, Maiju

    2012-01-01

    Tässä opinnäytetyössä tutkitaan, miten ArsMondo Oy:n joogamatkoja voisi kehittää entistä asiakaslähtöisempään suuntaan tulevaisuudessa. Aihe valittiin, sillä se on erittäin mielenkiintoinen ja ajankohtainen aihe matkailun alalla. ArsMondo on suomalainen kulttuurialan yritys, joka räätälöi kulttuuri- ja liikuntamatkoja Italiaan. Työ rajattiin vain ArsMondo- yrityksen joogamatkoihin Italiassa. Teoreettisessa viitekehyksessä avataan jooga- wellness- matkailun käsite sekä kerrotaan wellness- ...

  17. Episodes of Cenozoic Gold Mineralization on the Eastern Margin of the Qinghai-Tibet Plateau: 40Ar/39Ar Dating and Implication for Geodynamic Events

    Institute of Scientific and Technical Information of China (English)

    WANG Denghong; MAO Jingwen; YAN Shenghao; YANG Jianmin; XU Jue; CHEN Yuchuan; XUE Chunji

    2005-01-01

    A lot of new gold deposits have been found on the eastern margin of the Qinghai-Tibet Plateau during the past two decades. Among them, three main types of gold deposits have been recognized, including quartz-vein-type, shearzone-type and porphyry-type. The former two types of gold deposits are mainly hosted within metamorphic rocks, while the latter is related to Cenozoic magmatism. Although all of these gold deposits are believed to have been formed during the uplift process of the Qinghai-Tibet Plateau in the Cenozoic era (Wang et al., 2002b), precise isotopic age constraints have still been lacking until quite recently. This paper presents new 40Ar/39Ar data of some gold deposits on the eastern margin of the Qinghai-Tibet Plateau, which indicate that gold mineralization in the region occurred in response to the episodic stages of the orogenies.Recently obtained 40Ar/39Ar data on quartz and feldspars from several gold deposits, such as the Sandiao deposit, the Baijintaizi deposit, the Pusagang deposits, provide new constraints on gold mineralization on the eastern margin of the Qinghai-Tibet Plateau. Geochronological studies of gold deposits along the Daduhe River indicate that there are three stages of gold mineralization. The early two stages occurred as early as 65.1 Ma in the Shuibaiyang deposit and 58.95 Ma in the Ruoji deposit, while the latter stage occurred as late as 25.35 Ma in Baijintaizi and 24.70 Ma in Sandiao. Isotopic dating of three plagioclases from the Beiya deposit, Zhifanggou deposit and Luobodi deposit and a K-feldspar from the Jinchangqing deposit in Yunnan Province indicates that these deposits were formed at two stages. The Zhifanggou and Jinchangqing deposits have early stage records as old as 58.82 Ma in Zhifanggou and 55.49 Ma in Jinchangqing, but all of the above four deposits in Yunnan have late stage records of 23.18 Ma in Jinchangqing, 24.54 Ma in Zhifanggou, 24.60 Ma in Luobodi and 24.56 Ma in Hongnitang. The above results suggest

  18. Mass Spectrometric and Langmuir Probe Measurements in Inductively Coupled Plasmas in Ar, CHF3/Ar and CHF3/Ar/O2 Mixtures

    Science.gov (United States)

    Kim, J. S.; Rao, M. V. V. S.; Cappelli, M. A.; Sharma, S. P.; Meyyappan, M.; Arnold, Jim (Technical Monitor)

    2000-01-01

    Absolute fluxes and energy distributions of ions in inductively coupled plasmas of Ar, CHF3/Ar, and CHF3/Ar/O2 have been measured. These plasmas were generated in a Gaseous Electronics Conference (GEC) cell modified for inductive coupling at pressures 10-50 mTorr and 100-300 W of 13.56 MHz radio frequency (RF) power in various feedgas mixtures. In pure Ar plasmas, the Ar(+) flux increases linearly with pressure as well as RF-power. Total ion flux in CHF3 mixtures decreases with increase in pressure and also CHF3 concentration. Relative ion fluxes observed in the present studies are analyzed with the help of available cross sections for electron impact ionization and charge-exchange ion-molecule reactions. Measurements of plasma potential, electron and ion number densities, electron energy distribution function, and mean electron energy have also been made in the center of the plasma with a RF compensated Langmuir probe. Plasma potential values are compared with the mean ion energies determined from the measured ion energy distributions and are consistent. Electron temperature, plasma potential, and mean ion energy vary inversely with pressure, but increase with CHF3 content in the mixture.

  19. Experimental study of NO2 reduction in N2/Ar and O2/Ar mixtures by pulsed corona discharge.

    Science.gov (United States)

    Zhu, Xinbo; Zheng, Chenghang; Gao, Xiang; Shen, Xu; Wang, Zhihua; Luo, Zhongyang; Cen, Kefa

    2014-11-01

    Non-thermal plasma technology has been regarded as a promising alternative technology for NOx removal. The understanding of NO2 reduction characteristics is extremely important since NO2 reduction could lower the total NO oxidation rate in the plasma atmosphere. In this study, NO2 reduction was experimentally investigated using a non-thermal plasma reactor driven by a pulsed power supply for different simulated gas compositions and operating parameters. The NO2 reduction was promoted by increasing the specific energy density (SED), and the highest conversion rates were 33.7%, 42.1% and 25.7% for Ar, N2/Ar and O2/Ar, respectively. For a given SED, the NO2 conversion rate had the order N2/Ar>Ar>O2/Ar. The highest energy yield of 3.31g/kWh was obtained in N2/Ar plasma and decreased with increasing SED; the same trends were also found in the other two gas compositions. The conversion rate decreased with increasing initial NO2 concentration. Furthermore, the presence of N2 or O2 led to different reaction pathways for NO2 conversion due to the formation of different dominating reactive radicals. PMID:25458679

  20. Monitoring reverse osmosis treated wastewater recharge into a coastal aquifer by environmental isotopes (B, Li, O, H).

    Science.gov (United States)

    Kloppmann, W; Van Houtte, E; Picot, G; Vandenbohede, A; Lebbe, L; Guerrot, C; Millot, R; Gaus, I; Wintgens, T

    2008-12-01

    Artificial recharge (AR) is gaining importance as a management tool in water stressed regions. The need to prove recovery performance requires new monitoring tools for AR systems. A novel combination of environmental isotope tracers (B, Li, O, H stable isotopes) was tested for the monitoring of AR of tertiary treated, desalinated domestic wastewater into a coastal dune aquifer in Flanders, Belgium. No significant isotope fractionation was observed for the treatment process, which includes low pH RO desalination. The wastewater, after infiltration through ponds and before recovery through pumping wells is characterized by low molar Cl/B ratios (3.3 to 5.2), compared to 130 to 1020 in the wider study area, delta(11)B values close to 0% per hundred, rather homogeneous delta(7)Li values (10.3 +/- 1.7% per hundred), and a 18O and 2H enrichment with respect to ambient groundwater due to evaporation in the infiltration ponds. This confers to the AR component a unique isotopic and geochemical fingerprint. Immediately downstream of the pumping wells and in the deeper part of the aquifer no evidence of AR wastewater could be found, indicating a high recovery efficiency. In the wider area and in the deeper part of the aquifer, isotopes evidence mixing of coastal rain and a fresh paleo-groundwater component with residual seawater as well as interaction with the aquifer material. Combining several isotope tracers provides independent constraints on groundwater flow and mixing proportions as a complement to hydrodynamic modeling and geochemical studies.

  1. Monitoring reverse osmosis treated wastewater recharge into a coastal aquifer by environmental isotopes (B, Li, O, H).

    Science.gov (United States)

    Kloppmann, W; Van Houtte, E; Picot, G; Vandenbohede, A; Lebbe, L; Guerrot, C; Millot, R; Gaus, I; Wintgens, T

    2008-12-01

    Artificial recharge (AR) is gaining importance as a management tool in water stressed regions. The need to prove recovery performance requires new monitoring tools for AR systems. A novel combination of environmental isotope tracers (B, Li, O, H stable isotopes) was tested for the monitoring of AR of tertiary treated, desalinated domestic wastewater into a coastal dune aquifer in Flanders, Belgium. No significant isotope fractionation was observed for the treatment process, which includes low pH RO desalination. The wastewater, after infiltration through ponds and before recovery through pumping wells is characterized by low molar Cl/B ratios (3.3 to 5.2), compared to 130 to 1020 in the wider study area, delta(11)B values close to 0% per hundred, rather homogeneous delta(7)Li values (10.3 +/- 1.7% per hundred), and a 18O and 2H enrichment with respect to ambient groundwater due to evaporation in the infiltration ponds. This confers to the AR component a unique isotopic and geochemical fingerprint. Immediately downstream of the pumping wells and in the deeper part of the aquifer no evidence of AR wastewater could be found, indicating a high recovery efficiency. In the wider area and in the deeper part of the aquifer, isotopes evidence mixing of coastal rain and a fresh paleo-groundwater component with residual seawater as well as interaction with the aquifer material. Combining several isotope tracers provides independent constraints on groundwater flow and mixing proportions as a complement to hydrodynamic modeling and geochemical studies. PMID:19192794

  2. Dicty_cDB: FC-AR08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR08 (Link to dictyBase) - - - Contig-U15118-1 FC-AR08Z (Li...nk to Original site) - - FC-AR08Z 542 - - - - Show FC-AR08 Library FC (Link to library) Clone ID FC-AR08 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR08Q.Seq.d/ Representative seq. ID FC-AR...08Z (Link to Original site) Representative DNA sequence >FC-AR08 (FC-AR08Q) /CSM/FC/FC-AR/FC-AR08Q.Seq....esfilgfmgyr tscrynrwssqlpirycs*knddasrsc*yslfkhlgllgkdchp*rsncllqrcfikch qrfrwcfs

  3. Dicty_cDB: FC-AR06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR06 (Link to dictyBase) - - - - FC-AR06Z (Link to Original site) - - FC-AR...06Z 316 - - - - Show FC-AR06 Library FC (Link to library) Clone ID FC-AR06 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...06Q.Seq.d/ Representative seq. ID FC-AR06Z (Link to Original s...ite) Representative DNA sequence >FC-AR06 (FC-AR06Q) /CSM/FC/FC-AR/FC-AR06Q.Seq.d/ XXXXXXXXXXTGATCCAAGAAAAGG

  4. Dicty_cDB: FC-AR18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR18 (Link to dictyBase) - G03231 DDB0229952 Contig-U16528-1 FC-AR...18E (Link to Original site) - - - - - - FC-AR18E 567 Show FC-AR18 Library FC (Link to library) Clone ID FC-AR...8-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR18Q.Se...q.d/ Representative seq. ID FC-AR18E (Link to Original site) Representative DNA sequence >FC-AR18 (FC-AR18Q) /CSM/FC/FC-AR/FC-AR...QNRALVAGPHSGVERHIINFKWIN LTPLKVNIQRGARINTLIAAIKAADLETKIAALSAVKKINARATKSNQTDFERFKANLIR RKLNKKVSGEVKKLVNIANRAA

  5. Dicty_cDB: FC-AR14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR14 (Link to dictyBase) - - - Contig-U16311-1 FC-AR14Z (Li...nk to Original site) - - FC-AR14Z 593 - - - - Show FC-AR14 Library FC (Link to library) Clone ID FC-AR14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR14Q.Seq.d/ Representative seq. ID FC-AR...14Z (Link to Original site) Representative DNA sequence >FC-AR14 (FC-AR14Q) /CSM/FC/FC-AR/FC-AR14Q.Seq....epsin, complete cds. 72 8e-09 1 BP130435 |BP130435.1 Nicotiana tabacum cDNA, clone: BY2401, primer: M13 forwar

  6. Dicty_cDB: FC-AR09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR09 (Link to dictyBase) - - - Contig-U15312-1 FC-AR09E (Li...nk to Original site) - - - - - - FC-AR09E 702 Show FC-AR09 Library FC (Link to library) Clone ID FC-AR09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR09Q.Seq.d/ Representative seq. ID FC-AR...09E (Link to Original site) Representative DNA sequence >FC-AR09 (FC-AR09Q) /CSM/FC/FC-AR/FC-AR09Q.Seq....elfikr*kerqvc*nrldsleg*r*srrk *rcw*ir*l*ygwhgyatndarygwygrygwygrygwygrygrhgryarwy

  7. A Human Deciduous Tooth and New 40Ar/39Ar Dating Results from the Middle Pleistocene Archaeological Site of Isernia La Pineta, Southern Italy

    Science.gov (United States)

    Peretto, Carlo; Arnaud, Julie; Moggi-Cecchi, Jacopo; Manzi, Giorgio; Nomade, Sébastien; Pereira, Alison; Falguères, Christophe; Bahain, Jean-Jacques; Grimaud-Hervé, Dominique; Berto, Claudio; Sala, Benedetto; Lembo, Giuseppe; Muttillo, Brunella; Gallotti, Rosalia; Thun Hohenstein, Ursula; Vaccaro, Carmela; Coltorti, Mauro; Arzarello, Marta

    2015-01-01

    Isernia La Pineta (south-central Italy, Molise) is one of the most important archaeological localities of the Middle Pleistocene in Western Europe. It is an extensive open-air site with abundant lithic industry and faunal remains distributed across four stratified archaeosurfaces that have been found in two sectors of the excavation (3c, 3a, 3s10 in sect. I; 3a in sect. II). The prehistoric attendance was close to a wet environment, with a series of small waterfalls and lakes associated to calcareous tufa deposits. An isolated human deciduous incisor (labelled IS42) was discovered in 2014 within the archaeological level 3 coll (overlying layer 3a) that, according to new 40Ar/39Ar measurements, is dated to about 583–561 ka, i.e. to the end of marine isotope stage (MIS) 15. Thus, the tooth is currently the oldest human fossil specimen in Italy; it is an important addition to the scanty European fossil record of the Middle Pleistocene, being associated with a lithic assemblage of local raw materials (flint and limestone) characterized by the absence of handaxes and reduction strategies primarily aimed at the production of small/medium-sized flakes. The faunal assemblage is dominated by ungulates often bearing cut marks. Combining chronology with the archaeological evidence, Isernia La Pineta exhibits a delay in the appearance of handaxes with respect to other European Palaeolithic sites of the Middle Pleistocene. Interestingly, this observation matches the persistence of archaic morphological features shown by the human calvarium from the Middle Pleistocene site of Ceprano, not far from Isernia (south-central Italy, Latium). In this perspective, our analysis is aimed to evaluate morphological features occurring in IS42. PMID:26457581

  8. 40Ar/39Ar geochronology of subaerial lava flows of Barren Island volcano and the deep crust beneath the Andaman Island Arc, Burma Microplate

    Science.gov (United States)

    Ray, Jyotiranjan S.; Pande, Kanchan; Bhutani, Rajneesh

    2015-06-01

    Little was known about the nature and origin of the deep crust beneath the Andaman Island Arc in spite of the fact that it formed part of the highly active Indonesian volcanic arc system, one of the important continental crust forming regions in Southeast Asia. This arc, formed as a result of subduction of the Indian Plate beneath the Burma Microplate (a sliver of the Eurasian Plate), contains only one active subaerial magmatic center, Barren Island volcano, whose evolutional timeline had remained uncertain. In this work, we present results of the first successful attempt to date crustal xenoliths and their host lava flows from the island, by incremental heating 40Ar/39Ar method, in an attempt to understand the evolutionary histories of the volcano and its basement. Based on concordant plateau and isochron ages, we establish that the oldest subaerial lava flows of the volcano are 1.58 ± 0.04 (2σ) Ma, and some of the plagioclase xenocrysts have been derived from crustal rocks of 106 ± 3 (2σ) Ma. Mineralogy (anorthite + Cr-rich diopside + minor olivine) and isotopic compositions (87Sr/86Sr 7.0) of xenoliths not only indicate their derivation from a lower (oceanic) crustal olivine gabbro but also suggest a genetic relationship between the arc crust and the ophiolitic basement of the Andaman accretionary prism. We speculate that the basements of the forearc and volcanic arc of the Andaman subduction zone belong to a single continuous unit that was once attached to the western margin of the Eurasian Plate.

  9. Electronic and nuclear properties from the analysis of the isotope shifts in the spectral lines of lead

    Energy Technology Data Exchange (ETDEWEB)

    Wasowicz, T.J. [Gdansk Univ. of Technology, Dept. of Physics of Electronic Phenomena (Poland); Gdansk Univ., Institute of Experimental Physics (Poland)

    2009-06-15

    Isotope shifts in the 623.7 nm line of Pb I have been measured. Then, in a spectral range of 280 - 730 nm the optical isotope shifts in 24 lines of neutral and singly ionized lead have been analyzed using a combined model-independent method. From the combination of the optical isotope shifts data with elastic electron scattering, muonic X-ray and electronic K{sub {alpha}} X-ray data, we were able to determine the two contributions to the total isotope shift, namely the mass and the field shifts, and to obtain the values of several nuclear factors for a long chain of lead isotopes. (authors)

  10. Electronic and nuclear properties from the analysis of the isotope shifts in the spectral lines of lead

    Science.gov (United States)

    Wasowicz, T. J.

    2009-06-01

    Isotope shifts in the 623.7 nm line of Pb I have been measured. Then, in a spectral range of 280div730 nm the optical isotope shifts in 24 lines of neutral and singly ionized lead have been analyzed using a combined model-independent method. From the combination of the optical isotope shifts data with elastic electron scattering, muonic X-ray and electronic Kα X-ray data, we were able to determine the two contributions to the total isotope shift, namely the mass and the field shifts, and to obtain the values of several nuclear factors for a long chain of lead isotopes.

  11. Isotopically controlled semiconductors

    Energy Technology Data Exchange (ETDEWEB)

    Haller, Eugene E.

    2006-06-19

    The following article is an edited transcript based on the Turnbull Lecture given by Eugene E. Haller at the 2005 Materials Research Society Fall Meeting in Boston on November 29, 2005. The David Turnbull Lectureship is awarded to recognize the career of a scientist who has made outstanding contributions to understanding materials phenomena and properties through research, writing, and lecturing, as exemplified by the life work of David Turnbull. Haller was named the 2005 David Turnbull Lecturer for his 'pioneering achievements and leadership in establishing the field of isotopically engineered semiconductors; for outstanding contributions to materials growth, doping and diffusion; and for excellence in lecturing, writing, and fostering international collaborations'. The scientific interest, increased availability, and technological promise of highly enriched isotopes have led to a sharp rise in the number of experimental and theoretical studies with isotopically controlled semiconductor crystals. This article reviews results obtained with isotopically controlled semiconductor bulk and thin-film heterostructures. Isotopic composition affects several properties such as phonon energies, band structure, and lattice constant in subtle, but, for their physical understanding, significant ways. Large isotope-related effects are observed for thermal conductivity in local vibrational modes of impurities and after neutron transmutation doping. Spectacularly sharp photoluminescence lines have been observed in ultrapure, isotopically enriched silicon crystals. Isotope multilayer structures are especially well suited for simultaneous self- and dopant-diffusion studies. The absence of any chemical, mechanical, or electrical driving forces makes possible the study of an ideal random-walk problem. Isotopically controlled semiconductors may find applications in quantum computing, nanoscience, and spintronics.

  12. Value Chain Engineering

    DEFF Research Database (Denmark)

    Wæhrens, Brian Vejrum; Slepniov, Dmitrij

    2015-01-01

    This workbook is recommended for the attention of students of and managers in Danish small and medium sized enterprises (SMEs). Danish SMEs are currently facing a number of key challenges related to their position in global value chains. This book provides an insight into value chain management t...

  13. Single-crystal 40Ar/39Ar incremental heating reveals bimodal sanidine ages in the Bishop Tuff

    Science.gov (United States)

    Andersen, N. L.; Jicha, B. R.; Singer, B. S.

    2015-12-01

    The 650 km3 Bishop Tuff (BT) is among the most studied volcanic deposits because it is an extensive marker bed deposited just after the Matuyama-Brunhes boundary. Reconstructions of the vast BT magma reservoir from which high-silica rhyolite erupted have long influenced thinking about how large silicic magma systems are assembled, crystallized, and mixed. Yet, the longevity of the high silica rhyolitic melt and exact timing of the eruption remain controversial due to recent conflicting 40Ar/39Ar sanidine vs. SIMS and ID-TIMS U-Pb zircon dates. We have undertaken 21 40Ar/39Ar incremental heating ages on 2 mm BT sanidine crystals from pumice in 3 widely separated outcrops of early-erupted fall and flow units. Plateau ages yield a bimodal distribution: a younger group has a mean of 766 ka and an older group gives a range between 772 and 782 ka. The younger population is concordant with the youngest ID-TIMS and SIMS U-Pb zircon ages recently published, as well as the astronomical age of BT in marine sediment. Of 21 crystals, 17 yield older, non-plateau, steps likely affected by excess Ar that would bias traditional 40Ar/39Ar total crystal fusion ages. The small spread in older sanidine ages, together with 25+ kyr of pre-eruptive zircon growth, suggest that the older sanidines are not partially outgassed xenocrysts. A bimodal 40Ar/39Ar age distribution implies that some fraction of rhyolitic melt cooled below the Ar closure temperature at least 10 ky prior to eruption. We propose that rapid "thawing" of a crystalline mush layer released older crystals into rhyolitic melt from which sanidine also nucleated and grew immediately prior to the eruption. High precision 40Ar/39Ar dating can thus provide essential information on thermo-physical processes at the millenial time scale that are critical to interpreting U-Pb zircon age distributions that are complicated by large uncertainties associated with zircon-melt U-Th systematics.

  14. Eestlased ARS BALTICA 08-l Austrias / Jüri Hain

    Index Scriptorium Estoniae

    Hain, Jüri, 1941-

    2008-01-01

    Rahvusvaheline kunstinäitus "ARS BALTICA 08" Salzburgi näitusehoones Berchtoldvilla, kuraator Peter Rieder. Osalesid kunstnikud Eestist (Mare Vint, Marje Üksine, Andres Tolts, Tiiu Kirsipuu, Jüri Hain), Lätist, Leedust ja Soomest

  15. H- Beam Stripping Loss at Background Partial Pressure of Ar

    Institute of Scientific and Technical Information of China (English)

    Hu Chundong; Wang Shaohu; Hu Liqun

    2005-01-01

    It has been observed that H- current could be improved by adding Ar to H2 plasma.But due to a slower pumping speed for Ar with the existing pumping scheme, the tank pressure will increase quickly during the length of a beam pulse. Since H- stripping loss depends on the tank pressure and gas species, part of the H- beam can be converted to H0 and then H0 can be converted into H+ with background H2 and Ar gas thickness. Therefore, the H- beam current,measured by a Faraday cup, situated at a distance L from GG (ground grid), will decrease because it will be converted into a H+ current. This gives a ratio of the Faraday cup net current to the H- beam current before stripping at background partial pressure of Ar.

  16. Chain exchange in block copolymer micelles

    Science.gov (United States)

    Lu, Jie; Bates, Frank; Lodge, Timothy

    2014-03-01

    Block copolymer micelles are aggregates formed by self-assembly of amphiphilic copolymers dispersed in a selective solvent, driven by unfavorable interactions between the solvent and the core-forming block. Due to the relatively long chains being subject to additional thermodynamic and dynamic constraints (e.g., entanglements, crystallinity, vitrification), block copolymer micelles exhibit significantly slower equilibration kinetics than small molecule surfactants. As a result, details of the mechanism(s) of equilibration in block copolymer micelles remain unclear. This present works focuses on the chain exchange kinetics of poly(styrene-b-ethylenepropylene) block copolymers in squalane (C30H62) using time-resolved small angle neutron scattering (TR-SANS). A mixture of h-squalane and d-squalane is chosen so that it contrast matches a mixed 50/50 h/d polystyrene micelle core. When the temperature is appropriate and isotopically labeled chains undergo mixing, the mean core contrast with respect to the solvent decreases, and the scattering intensity is therefore reduced. This strategy allows direct probing of chain exchange rate from the time dependent scattering intensity I(q, t).

  17. Oxygen isotopes and lakes

    OpenAIRE

    Leng, Melanie; Dean, Jonathan

    2014-01-01

    Isotopes are variations of a particular chemical element. It is all to do with the number of neutrons. Oxygen has two main isotopes: 18O which has 10 neutrons and 8 protons; and 16O which has 8 neutrons and 8 protons. Although these variants have a different number of neutrons (and therefore a different atomic mass), the number of protons remains the same, and they are still classed as the same element. Isotopes are analysed in terms of ratios such as 18O/16O which is shortened to δ18O (δ...

  18. Chromium isotope variations

    DEFF Research Database (Denmark)

    D'Arcy, Joan Mary

    fractionate during oxidative weathering of the continents. High river water δ53Cr values (+1.6‰) indicate that dissolved Cr has been back-reduced either in the weathering profile or during river transport. The main conclusion from this study is that δ53Cr value for continental runoff is not uniform....... The positive excursion does not correlated with other redox proxies (carbon and sulphur stable isotopes profiles from the Lower Ordovician), suggesting that Cr isotopes behave non-conservatively and are more sensitive to changes in local redox conditions. These results demonstrate that Cr isotope composition...

  19. The emission spectra of Ar, Kr and Xe + TEA

    Science.gov (United States)

    Suzuki, Masayo; Strock, Pierre; Sauli, Fabio; Charpak, Georges

    1987-03-01

    The emission spectra of Ar, Kr and Xe + 6% TEA gas mixtures are measured by using a single wire proportional counter as the emission source. Asymmetric emission bands are observed in the range of 270 to 350 nm, which can be attributed to the radiative deexcitation of excited TEA molecules. For the practical application of optical readout of avalanche chambers, the Ar + 2.0% TEA + 20% isobutane gas mixture is also examined, and nearly the same emission band is observed.

  20. Augmented Reality Computer-Aided Drawing (AR-CAD)

    OpenAIRE

    ECT Team, Purdue

    2007-01-01

    While Virtual Reality (VR) replaces the entire real world with virtual images, Augmented Reality (AR) superimposes virtual images on the real world. Augmented Reality (a most useful form of Mixed Reality (MR)) is a popular concept for using computers to overlay virtual information onto a view of the real world. In 2000, Phillip Dunston then at the University of Washington in Seattle and his research team presented the initial concept of AR CAD developed for supporting design and construction....

  1. Integrated supply chain risk management

    OpenAIRE

    Riaan Bredell; Jackie Walters

    2007-01-01

    Integrated supply chain risk management (ISCRM) has become indispensable to the theory and practice of supply chain management. The economic and political realities of the modern world require not only a different approach to supply chain management, but also bold steps to secure supply chain performance and sustainable wealth creation. Integrated supply chain risk management provides supply chain organisations with a level of insight into their supply chains yet to be achieved. If correctly ...

  2. Repeated thermal resetting of phengites in the Mulhacen Complex (Betic Zone, southeastern Spain) shown by 40Ar/ 39Ar step heating and single grain laser probe dating

    Science.gov (United States)

    de Jong, Koen; Wijbrans, Jan R.; Féraud, Gilbert

    1992-05-01

    This study reports the results of the first 40Ar/ 39Ar combined induction furnace and laser probe dating of phengites from the Mulhacen HP/LT metamorphic complex in the Betic Cordilleras, southern Spain. Laser step heating and spot fusion analyses on different halves of a split single grain were made with a continuous laser probe. Spot fusion analysis resulted in ages of about 30-31 Ma in the core and ages as low as 25-26 Ma in the rim. Laser step heating on the other half of the grain gave a spectrum with apparent ages increasing from about 25 Ma to 29.5 Ma. The age spectrum and the decreasing ages towards the rim of the grain may imply that resetting essentially occurred by volume diffusion of radiogenic 40Ar due to late stage reheating resulting from extensional tectonics. Ages around 30 Ma in the core of the grain are interpreted as minimum estimates of the cooling age of the main tectono-metamorphic phase D 2. Induction furnace step heating on phengite separates from mica schists and one gneiss resulted in two types of age spectra. Type I spectra show monotonously rising apparent ages from 14.5 ± 1.9 Ma to 20.7 ± 0.2 Ma, and in a second sample from 16.9 ± 0.7 to 29.7 ± 0.2 Ma. Type II spectra are characterized by plateaus of 14.4 ± 0.1 Ma (the gneiss sample), 17.3 ± 0.1 Ma and 17.6 ± 0.1 Ma. Type II spectra show low temperature apparent ages significantly below the plateau age, implying resetting subsequent to initial cooling. Modelling of the age spectra demonstrated that the plateau ages are possibly the result of strong resetting (75-85% of argon loss) of an older isotope system. Total fusion of a number of phengite single grains from marbles taken close to type II mica schists yielded ages of 15.4 ± 1.2 Ma and 17.0 ± 0.7 Ma. The observed repeated resetting is coeval with major volcanic activity in basins adjacent to the metamorphic ranges, pointing to a resetting by advective fluid transport related to volcanism.

  3. Ar-Ar and U-Pb ages of marble-hosted ruby deposits from Central and South-east Asia

    Science.gov (United States)

    Garnier, V.; Giuliani, G.; Maluski, H.; Ohnenstetter, D.; Deloule, E.

    2003-04-01

    Marble-hosted ruby deposits represent the first source of gemstones in Asia. The deposits from Jegdalek (Afghanistan), Hunza Valley (Pakistan), Nangimali (Azad-Kashmir), Chumar, Ruyil (Nepal), Mogok (Myanmar), Luc Yen, Yen Bai and Quy Chau (Vietnam) were dated using the 40Ar-39Ar laser stepwise heating technique on syngenetic micas. The following ages were obtained : 24.7 ± 0.3 Ma at Jegdalek ; 10.8 ± 0.3 to 5.4 ± 0.3 Ma at Hunza ; 17.2 ± 0.2 to 15.3 ± 0.1 Ma at Nangimali ; 4.6 ± 0.1 Ma at Ruyil ; 5.6 ± 0.4 Ma at Chumar ; 18.7 ± 0.2 to 17.1 ± 0.2 Ma at Mogok ; 33.8 ± 0.4 to 30.8 ± 0.8 Ma at Luc Yen ; 24.4 ± 0.4 to 23.2 ± 0.6 Ma at Yen Bai, 22.1 ± 0.6 to 21.6 ± 0.7 Ma at Quy Chau. These ages represent cooling ages and thus minimum ages for ruby formation. The ages obtained for Nangimali are close to the Ar-Ar cooling age of 19 Ma recorded in the Chichi granite, North to the ruby deposit. However, (C,O)-isotopic studies of the ruby-bearing marbles show no genetic relation between granite emplacement and ruby deposition in this area. The age found at Jegdalek is similar to the K-Ar ages obtained on the Sairobi pegmatitic dykes (20-26 Ma) and of the Jalalabad pluton (25 Ma), located close to the ruby deposit. At Mogok, the ruby deposits yield ages close to those obtained on high grade metamorphic and foliated intrusive regional rocks (15.8 ± 0.7 - 19.5 ± 1.0 Ma). The ages obtained at Chumar and Ruyil agree with those of the Lesser Himalaya Formation (12 - 6 Ma). Those found at Quy Chau agree with those found for the shear zone activity. Furthermore, U-Pb dating was done on zircons included in a ruby from Luc Yen and spinels in marble from Luc Yen and Hunza. The wide range of 238U-206Pb ages obtained for Luc Yen (266 - 45 Ma) evidences a complex metamorphic history. Ruby crystallised at 45 Ma during ductile activity of the Red River shear zone. At Hunza, an 238U-206Pb age of 94.0 ± 2.1 Ma obtained on inherited zircons confirms the U-Pb age obtained on

  4. LEAF: a computer program to calculate fission product release from a reactor containment building for arbitrary radioactive decay chains

    Energy Technology Data Exchange (ETDEWEB)

    Lee, C.E.; Apperson, C.E. Jr.; Foley, J.E.

    1976-10-01

    The report describes an analytic containment building model that is used for calculating the leakage into the environment of each isotope of an arbitrary radioactive decay chain. The model accounts for the source, the buildup, the decay, the cleanup, and the leakage of isotopes that are gas-borne inside the containment building.

  5. LEAF: a computer program to calculate fission product release from a reactor containment building for arbitrary radioactive decay chains

    International Nuclear Information System (INIS)

    The report describes an analytic containment building model that is used for calculating the leakage into the environment of each isotope of an arbitrary radioactive decay chain. The model accounts for the source, the buildup, the decay, the cleanup, and the leakage of isotopes that are gas-borne inside the containment building

  6. Supply Chain Connectivity: Enhancing Participation in the Global Supply Chain

    OpenAIRE

    Patalinghug, Epictetus E.

    2015-01-01

    Supply chain connectivity is vital for the efficient flow of trade among APEC economies. This paper reviews the literature and supply chain management, describes the barriers to enhancing participation in global supply chain, analyzes the various measures of supply chain performance, and suggests steps for the Philippines to fully reap the benefits of the global value chain.

  7. Effect and mechanism of AR-6 in experimental rheumatoid arthritis.

    Science.gov (United States)

    Sun, Shi-xue; Li, Yun-man; Fang, Wei-rong; Cheng, Peng; Liu, Lifang; Li, Fengwen

    2010-06-01

    The root of Clematis chinensis Osbeck has been used widely in rheumatoid arthritis in Chinese traditional medicine and AR-6 is a triterpene saponin isolated from it. In this present study, we investigated in vivo effects of oral AR-6 in chronic rat adjuvant-induced arthritis (AA) and in vitro effect in macrophage and synoviocytes cells. Arthritic scores and serum inflammatory mediators were evaluated 19 days after AA induction by endermic injection of Freund's complete adjuvant in Sprague-Dawley(S-D) rats. Oral administration of AR-6 to arthritic rats resulted in a clear decrease of clinical signs compared to untreated controls. The synoviocyte and macrophage response ex vivo were then analyzed. Anti-arthritic effects of AR-6 correlated with significant decrease of NO and TNF-alpha produced by peritoneal macrophages, ex vivo and in vitro. AR-6 also significant decreased the proliferation of synoviocyte. These data indicate that AR-6 is a potential anti-inflammatory therapeutic and preventive agent. PMID:19842015

  8. The geological, isotopic, botanical, invertebrate, and lower vertebrate contexts for aripithecus ramidus

    Energy Technology Data Exchange (ETDEWEB)

    Woldegabriel, Giday [Los Alamos National Laboratory; Ambrose, Stanley H [UNIV OF ILLINOIS; Barboni, Doris [CEREGE, FRANCE; Bonneffille, Raymond [CEREGE, FRANCE; Bremond, Laurent [MONTPELLIER, FRANCE; Currie, Brian [MIAMI UNIV, OXFORD, OHIO; Degusta, David [STANFORD UNIV.; Hart, William K [MIAMI UNIV, OXFORD, OHIO; Murray, Alison M [UNIV OF ALBERTA; Renne, Paul R [UC/BERKELEY; Jolly - Saad, M C [NANTERRE, FRANCE; Stewart, Kathlyn M [CANADA; White, Tim D [UC/BERKELEY

    2009-01-01

    Sediments containing Ardipithecus ramidus were deposited 4.4 million years ago on an alluvial floodplain in Ethiopia's western Afar rift. The Lower Aramis Member hominid-bearing unit, now exposed across a >9-kilometer structural arc, is sandwiched between two volcanic tuffs that have nearly identical {sup 40}Ar/{sup 39}Ar ages. Geological data presented here, along with floral, invertebrate, and vertebrate paleontological and taphonomic evidence associated with the hominids, suggest that they occupied a wooded biotope over the western three-fourths of the paleotransect. Phytoliths and oxygen and carbon stable isotopes of pedogenic carbonates provide evidence of humid cool woodlands with a grassy substrate.

  9. Isotope Production Facility (IPF)

    Data.gov (United States)

    Federal Laboratory Consortium — The Los Alamos National Laboratory has produced radioactive isotopes for medicine and research since the mid 1970s, when targets were first irradiated using the 800...

  10. Calcium stable isotope geochemistry

    Energy Technology Data Exchange (ETDEWEB)

    Gausonne, Nikolaus [Muenster Univ. (Germany). Inst. fuer Mineralogie; Schmitt, Anne-Desiree [Strasbourg Univ. (France). LHyGeS/EOST; Heuser, Alexander [Bonn Univ. (Germany). Steinmann-Inst. fuer Geologie, Mineralogie und Palaeontologie; Wombacher, Frank [Koeln Univ. (Germany). Inst. fuer Geologie und Mineralogie; Dietzel, Martin [Technische Univ. Graz (Austria). Inst. fuer Angewandte Geowissenschaften; Tipper, Edward [Cambridge Univ. (United Kingdom). Dept. of Earth Sciences; Schiller, Martin [Copenhagen Univ. (Denmark). Natural History Museum of Denmark

    2016-08-01

    This book provides an overview of the fundamentals and reference values for Ca stable isotope research, as well as current analytical methodologies including detailed instructions for sample preparation and isotope analysis. As such, it introduces readers to the different fields of application, including low-temperature mineral precipitation and biomineralisation, Earth surface processes and global cycling, high-temperature processes and cosmochemistry, and lastly human studies and biomedical applications. The current state of the art in these major areas is discussed, and open questions and possible future directions are identified. In terms of its depth and coverage, the current work extends and complements the previous reviews of Ca stable isotope geochemistry, addressing the needs of graduate students and advanced researchers who want to familiarize themselves with Ca stable isotope research.

  11. Perchlorate isotope forensics

    Science.gov (United States)

    Böhlke, J.K.; Sturchio, N.C.; Gu, B.; Horita, J.; Brown, G.M.; Jackson, W.A.; Batista, J.; Hatzinger, P.B.

    2005-01-01

    Perchlorate has been detected recently in a variety of soils, waters, plants, and food products at levels that may be detrimental to human health. These discoveries have generated considerable interest in perchlorate source identification. In this study, comprehensive stable isotope analyses ( 37Cl/35Cl and 18O/17O/ 16O) of perchlorate from known synthetic and natural sources reveal systematic differences in isotopic characteristics that are related to the formation mechanisms. In addition, isotopic analyses of perchlorate extracted from groundwater and surface water demonstrate the feasibility of identifying perchlorate sources in contaminated environments on the basis of this technique. Both natural and synthetic sources of perchlorate have been identified in water samples from some perchlorate occurrences in the United States by the isotopic method. ?? 2005 American Chemical Society.

  12. Isotopically controlled semiconductors

    Energy Technology Data Exchange (ETDEWEB)

    Haller, E.E.

    2004-11-15

    A review of recent research involving isotopically controlled semiconductors is presented. Studies with isotopically enriched semiconductor structures experienced a dramatic expansion at the end of the Cold War when significant quantities of enriched isotopes of elements forming semiconductors became available for worldwide collaborations. Isotopes of an element differ in nuclear mass, may have different nuclear spins and undergo different nuclear reactions. Among the latter, the capture of thermal neutrons which can lead to neutron transmutation doping, can be considered the most important one for semiconductors. Experimental and theoretical research exploiting the differences in all the properties has been conducted and will be illustrated with selected examples. Manuel Cardona, the longtime editor-in-chief of Solid State Communications has been and continues to be one of the major contributors to this field of solid state physics and it is a great pleasure to dedicate this review to him.

  13. Volcanic history and 40Ar/39Ar and 14C geochronology of Terceira Island, Azores, Portugal

    Science.gov (United States)

    Calvert, A.T.; Moore, R.B.; McGeehin, J.P.; Rodrigues da Silva, A.M.

    2006-01-01

    Seven new 40Ar/39Ar and 23 new radiocarbon ages of eruptive units, in support of new geologic mapping, improve the known chronology of Middle to Late Pleistocene and Holocene volcanic activity on the island of Terceira, Azores and define an east-to-west progression in stratovolcano growth. The argon ages indicate that Cinco Picos Volcano, the oldest on Terceira, completed its main subaerial cone building activity by about 370-380??ka. Collapse of the upper part of the stratovolcanic edifice to form a 7 ?? 9??km caldera occurred some time after 370??ka. Postcaldera eruptions of basalt from cinder cones on and near the caldera floor and trachytic pyroclastic flow and pumice fall deposits from younger volcanoes west of Cinco Picos have refilled much of the caldera. The southern portion of Guilherme Moniz Volcano, in the central part of the island, began erupting prior to 270??ka and produced trachyte domes, flows, and minor pyroclastic deposits until at least 111??ka. The northern part of Guilherme Moniz Caldera is less well exposed than the southern part, but reflects a similar age range. The northwest portion of the caldera was formed sometime after 44??ka. Several well-studied ignimbrites that blanket much of the island likely erupted from Guilherme Moniz Volcano. The Pico Alto Volcanic Center, a tightly spaced cluster of trachyte domes and short flows, is a younger part of Guilherme Moniz Volcano. Stratigraphic studies and our new radiocarbon ages suggest that most of the Pico Alto eruptions occurred during the period from about 9000 to 1000??years BP. Santa Barbara Volcano is the youngest stratovolcano on Terceira, began erupting prior to 29??ka, and has been active historically. ?? 2006.

  14. 40Ar/39Ar age evidence for Altyn fault tectonic activities in western China

    Institute of Scientific and Technical Information of China (English)

    LIU Yongjiang; J. Genser; GE Xiaohong; F. Neubauer; G. Friedl; CHANG Lihua; REN Shoumai; R. Handler

    2003-01-01

    Four 40Ar/39Ar age groups of mica, hornblende and K-feldspar were obtained from Proterozoic and early Paleozoic metamorphic rocks in the Aksay-Dangjin Pass area, western China. The samples away from the middle shear zone of the Altyn fault belt yield two plateau age groups in the range of 461-445.2 Ma and 414.9-342.8 Ma, respectively. They represent the tectono-thermal events that had been recorded in the rocks that were displaced by the Altyn strike-slip fault in late Ordovician-early Silurian and Devonian, respectively. These two age groups should be related to the closures of Northern and Southern Qilian Oceans. The deformed granitic gneiss from the northern belt gives a plateau age group of 178.4-137.5 Ma, which is interpreted as the active age of the Altyn fault in the middle-late Jurassic- early Cretaceous and should be related to the accretion of Lhasa block to the north. The sample from the middle shear zone of the Altyn fault belt yields two plateau ages of 36.4 and 26.3 Ma, respectively, suggesting the strike-slip movement with strong metamorphism at greenschist facies along the Altyn fault in the late Eocene. This event occurred in the most areas of the northern Tibet Plateau and should be in response in the north to the collision between Indian and Eurasian continents. The present study demonstrates that the Altyn fault is characterized by multiple pulse-style activities under the tectonic setting of convergence between the Indian and Eurasian continents.

  15. A long-term change of the AR/KR/XE fractionation in the solar corpuscular radiation

    Science.gov (United States)

    Wieler, R.; Baur, H.; Signer, P.

    1993-01-01

    Solar noble gases in an ilmenite separate from breccia 79035 (antiquity greater than 1 Ga) were analyzed by closed system stepped etching (CSSE). All five gases show the familiar two-component structure: first solar-wind (SW) gases are released, followed by gases from solar energetic particles (SEP). Element patterns in 79035 are similar to those of 71501 ilmenite. SW-He-Ne were partly lost, but SEP-He-Ne-Ar are retained (nearly) unfractionated. Constant Ar/Kr/Xe ratios indicate that ilmenites contain an unfractionated sample of the heavy SW-SEP noble gases. Ar/Kr/Xe ratios in the solar corpuscular radiation are, however, different from 'solar system' values, whereby the Kr/Xe difference in 79035 is about twice as large as in 71501. We propose that Xe is less fractionated than Kr and Ar, though its first ionization potential (FIP) is higher than the 'cutoff' at approximately 11.5 eV, above which all elements in SEP are usually assumed to be depleted by a roughly constant factor. SW-Ne may be isotopically slightly heavier in the ancient SW trapped by 79035, as proposed earlier. In this work we extend our previous CSSE studies of solar noble gases including Kr and Xe to a lunar sample irradiated at least 1 Ga ago (breccia 79035, ilmenite separate, 42-64 microns). This sample was particularly gently etched in the first steps. Surprisingly, the first three steps, each releasing less than or equal to 0.5% of the total 36-Ar, showed an SEP-like trapped component plus relatively large concentrations of cosmogenic gases. Steps 4ff contain much less cosmogenic and more solar gas with a SW-like isotope pattern. Thus, a very minor easily etchable phase that has completely lost its SW-gases must be responsible for steps 1-3. We will not discuss these steps here and refer to the actual step 4 as the 'initial' etching step.

  16. Understanding the supply chain

    Directory of Open Access Journals (Sweden)

    Aćimović Slobodan

    2006-01-01

    Full Text Available Supply chain management represents new business philosophy and includes strategically positioned and much wider scope of activity in comparison with its "older brother" - management of logistics. Philosophy of the concept of supply chain is directed to more coordination of key business functions of every link in distribution chain in the process of organization of the flow of both goods and information, while logistic managing instruments are focused on internal optimum of flows of goods and information within one company. Applying the concept of integrated supply chain among several companies makes the importance of operative logistics activity even greater on the level of one company, thus advancing processes of optimum and coordination within and between different companies and confirms the importance of logistics performances for the company’s profitability. Besides the fact that the borders between companies are being deleted, this concept of supply chain in one distribution channel influences increasing of importance of functional, i.e. traditional business managing approaches but instead it points out the importance of process managing approaches. Although the author is aware that "there is nothing harder, more dangerous and with uncertain success, but to find a way for introducing some novelties (Machiavelli, it would be even his additional stimulation for trying to bring closer the concept and goals of supply chain implementation that are identified in key, relevant, modern, theoretical and consulting approaches in order to achieve better understanding of the subject and faster implementation of the concept of supply chain management by domestic companies.

  17. Isotopes in everyday life

    International Nuclear Information System (INIS)

    Isotopes represent a tool which can do certain jobs better, easier, quicker, more simply and cheaper than competitive methods. Some measurements could not be done at all without the use of isotopes as there are no alternative methods available. A short review of these tools of science in their different fields is given: food and agriculture, human health applications, industry, hydrology, geology, geochemistry, geophysics and dating, environment, basic scientific research

  18. Methods of isotopic geochronology

    Science.gov (United States)

    Gorokhov, I. M.; Levchenkov, O. A.

    Papers are presented on such topics as the age of the chemical elements; the age of meteorites, the moon, and the earth; isotopic ages of the most ancient terrestrial formations; and the Archean evolution of Enderby Land in the Antarctic as evidenced by isotopic dating. Consideration is also given to a uranium-lead geochronology technique for investigating Precambrian ore deposits, a Pb-Pb technique of zircon dating, and the potentials and limitations of Sm-Nd geochronology.

  19. Isotope toolbox turns 10

    DEFF Research Database (Denmark)

    Wenander, Fredrik; Riisager, Karsten

    2012-01-01

    REX-ISOLDE, one of CERN’s most compact accelerators, has just celebrated its 10th anniversary. The machine’s versatility provides radioactive ion beams across the range of nuclear isotopes.......REX-ISOLDE, one of CERN’s most compact accelerators, has just celebrated its 10th anniversary. The machine’s versatility provides radioactive ion beams across the range of nuclear isotopes....

  20. Isotopes in environmental research

    International Nuclear Information System (INIS)

    Radioactive and stable isotopes have long been considered a very efficient tool for studying physical and biological aspects of how the global ecosystem functions. Their applications in environmental research are numerous, embracing research at all levels. This article looks at only a few of the approaches to environmental problems that involve the use of isotopes. Special attention is given to studies of the Amazon Basin. Environmental isotopes are very efficient tools in water cycle studies. Tritium, a radioactive tracer, is especially useful in studying dynamics of water movement in different compartments of the hydrosphere, both on the local and global scales. Heavy stable isotopes of hydrogen and oxygen (deuterium and oxygen-18) provide information about steady-state characteristics of the water cycle. Isotope methods, some relatively new, have a major role in site-specific studies. Some indicative examples include: Studying turnover of organic matter. Changes in the carbon-13/carbon-12 isotopic ratio of organic matter were used to determine the respective contributions of organic carbon derived from forest and pasture. Studying biological nitrogen fixation. One of the ways nitrogen levels in soil can be maintained for productivity is by biological nitrogen fixation. Studying nitrogen availability and losses. The experimental use of nitrogen-15 is invaluable for defining losses of soil nitrogen to the atmosphere and to groundwater. Studies can similarly be done with stable and radioactive sulphur isotopes. This article indicates some potential uses of isotopes in environmental research. While the major problem of global climate change has not been specifically addressed here, the clearing of the Amazon forest, one focus of the IAEA's environmental programme, may have serious consequences for the global climate. These include substantial reduction of the amount of latent heat transported to the regions outside the tropics and acceleration of the greenhouse

  1. Review of the application of isotopic studies to the genesis of Cu-Au mineralisation at Olympic Dam and Au mineralisation at Porgera, the Tennant Creek district and Yilgarn Craton

    International Nuclear Information System (INIS)

    This paper reviews the application of radiogenic isotopes to the study of four Cu-U and Au deposits or deposit types in the Australasian region: Olympic Dam, Porgera, the Proterozoic Au deposits of the Tennant Creek district and the Archaean gold deposits of the Yilgarn Craton. In each case it has been possible to date the mineralisation and to correlate ore formation with a specific igneous event or stage in crystal evolution. In three cases it was also possible to use radiogenic isotopes to trace the source of the metal(s) or to constrain the fluid pathway. The results of K-Ar , 39Ar/40Ar dating of hydrothermal minerals associated with gold deposits, SHRIMP U-Pb analyses of zircon, and conventional Sr, Nd and Pb isotopic tracing of the ore fluids are reported to illustrate the power of radiogenic isotopes in ore-genesis studies

  2. Transpressional tectonics and Carboniferous magmatism in the Limousin, Massif Central, France:structural and 40Ar/39Ar investigations.

    OpenAIRE

    Gébelin, Aude; Brunel, Maurice; Monié, Patrick; Faure, Michel; Arnaud, Nicolas

    2007-01-01

    New structural, microstructural, and 40Ar/39Ar data from the NW Massif Central (France) provide additional constraints on the timing and tectonic setting of late Variscan granite magmatism. Previous studies had emphasized the role of late orogenic extension in the emplacement of granite plutons in the Limousin region. In contrast, the new data set is consistent with syntectonic emplacement of magma in a dextral simple shear active from 350 to 300 Ma in a transpressional regime. As an alternat...

  3. Detailed Ar-40/Ar-39 dating of geologic events associated with the Mantos Blancos copper deposit, northern Chile

    OpenAIRE

    Oliveros, V.; Feraud, G.; L. Aguirre; Ramirez, L.; Fornari, Michel; Palacios, C.; Parada, M.

    2008-01-01

    The Ar-40/Ar-39 geochronological method was applied to date magmatic and hydrothermal alteration events in the Mantos Blancos mining district in the Coastal Cordillera of northern Chile, allowing the distinction of two separate mineralization events. The Late Jurassic Mantos Blancos orebody, hosted in Jurassic volcanic rocks, is a magmatic-hydrothermal breccia-style Cu deposit. Two superimposed mineralization events have been recently proposed. The first event is accompanied by a phyllic hydr...

  4. A Late Mesoproterozoic 40Ar/39Ar age for a melt breccia from the Keurusselkä impact structure, Finland

    Science.gov (United States)

    Schmieder, Martin; Jourdan, Fred; Moilanen, Jarmo; Buchner, Elmar; Öhman, Teemu

    2016-02-01

    Field investigations in the eroded central uplift of the ≤30 km Keurusselkä impact structure, Finland, revealed a thin, dark melt vein that intersects the autochthonous shatter cone-bearing target rocks near the homestead of Kirkkoranta, close to the center of the impact structure. The petrographic analysis of quartz in this melt breccia and the wall rock granite indicate weak shock metamorphic overprint not exceeding ~8-10 GPa. The mode of occurrence and composition of the melt breccia suggest its formation as some kind of pseudotachylitic breccia. 40Ar/39Ar dating of dark and clast-poor whole-rock chips yielded five concordant Late Mesoproterozoic miniplateau ages and one plateau age of 1151 ± 10 Ma [± 11 Ma] (2σ; MSWD = 0.11; P = 0.98), considered here as the statistically most robust age for the rock. The new 40Ar/39Ar age is incompatible with ~1.88 Ga Svecofennian tectonism and magmatism in south-central Finland and probably reflects the Keurusselkä impact, followed by impact-induced hydrothermal chloritization of the crater basement. In keeping with the crosscutting relationships in the outcrop and the possible influence of postimpact alteration, the Late Mesoproterozoic 40Ar/39Ar age of ~1150 Ma should be treated as a minimum age for the impact. The new 40Ar/39Ar results are consistent with paleomagnetic results that suggested a similar age for Keurusselkä, which is shown to be one of the oldest impact structures currently known in Europe and worldwide.

  5. 40Ar-39Ar age of a lava flow from the Bhimashankar Formation, Giravali Ghat, Deccan Traps

    Indian Academy of Sciences (India)

    Kanchan Pande; S K Pattanayak; K V Subbarao; P Navaneethakrishnan; T R Venkatesan

    2004-12-01

    We report here a 40Ar-39Ar age of 66.0 ± 0.9Ma (2 ) for a reversely magnetised tholeiitic lava flow from the Bhimashankar Formation (Fm.), Giravali Ghat, western Deccan province, India. This age is consistent with the view that the 1.8–2km thick bottom part of the exposed basalt flow sequence in the Western Ghats was extruded very close to 67.4 Ma.

  6. Exhumation history of the NW Indian Himalaya revealed by fission track and 40Ar/39Ar ages

    Science.gov (United States)

    Schlup, Micha; Steck, Albrecht; Carter, Andrew; Cosca, Michael; Epard, Jean-Luc; Hunziker, Johannes

    2011-01-01

    New fission track and Ar/Ar geochronological data provide time constraints on the exhumation history of the Himalayan nappes in the Mandi (Beas valley) — Tso Morari transect of the NW Indian Himalaya. Results from this and previous studies suggest that the SW-directed North Himalayan nappes were emplaced by detachment from the underthrusted upper Indian crust by 55 Ma and metamorphosed by ca. 48–40 Ma. The nappe stack was subsequently exhumed to shallow upper crustal depths (

  7. Oxygen Isotopes in Meteorites

    Science.gov (United States)

    Clayton, R. N.

    2003-12-01

    Oxygen isotope abundance variations in meteorites are very useful in elucidating chemical and physical processes that occurred during the formation of the solar system (Clayton, 1993). On Earth, the mean abundances of the three stable isotopes are 16O: 99.76%, 17O: 0.039%, and 18O: 0.202%. It is conventional to express variations in abundances of the isotopes in terms of isotopic ratios, relative to an arbitrary standard, called SMOW (for standard mean ocean water), as follows:The isotopic composition of any sample can then be represented by one point on a "three-isotope plot," a graph of δ17O versus δ18O. It will be seen that such plots are invaluable in interpreting meteoritic data. Figure 1 shows schematically the effect of various processes on an initial composition at the center of the diagram. Almost all terrestrial materials lie along a "fractionation" trend; most meteoritic materials lie near a line of "16O addition" (or subtraction). (4K)Figure 1. Schematic representation of various isotopic processes shown on an oxygen three-isotope plot. Almost all terrestrial materials plot along a line of "fractionation"; most primitive meteoritic materials plot near a line of "16O addition." The three isotopes of oxygen are produced by nucleosynthesis in stars, but by different nuclear processes in different stellar environments. The principal isotope, 16O, is a primary isotope (capable of being produced from hydrogen and helium alone), formed in massive stars (>10 solar masses), and ejected by supernova explosions. The two rare isotopes are secondary nuclei (produced in stars from nuclei formed in an earlier generation of stars), with 17O coming primarily from low- and intermediate-mass stars (radiation in the wavelength range 90-100 nm. The reaction proceeds by a predissociation mechanism, in which the excited electronic state lives long enough to have well-defined vibrational and rotational energy levels. As a consequence, the three isotopic species - C16O, C17O

  8. Research on isotope geology: Isotopes ages of volcanic rocks from Ryeongnam Massif, Korea

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Seong Cheon; Chi, Se Jung; Kim, Yoo Sook [Korea Institute of Geology Mining and Materials, Taejon (Korea, Republic of)

    1997-12-01

    Chronostratigraphy of most volcanic rocks in the Ryeongnam Massif have been undefined or mis-classified in different geological maps due to total absence of reported isotope ages. Twenty-four new isotope ages are given for age-undefined volcanic units and some related igneous bodies. Most of volcanic rocks show high [La/Yb]n ratios and LREE enrichments which are characteristics of subduction-related high-K calc-alkali volcanic rocks occurred in the active continental margin. Preliminary results on carbon and oxygen stable isotope ratios({delta}{sup 13}C=-1.7{approx}-6.2 per mil; {delta}{sup 18} O=-21.6{approx}-24.7 per mil) of druse- or phenocryst-calcite from andesitic and basaltic rocks in the southern coastal region indicate a magmatic origin. Based on new K-Ar whole-rock ages, chronological guidelines are established as follows: 1) Gayasan andesite (78{+-}4Ma) - Gurye andesitic tuff (81{+-}4Ma); 2) Gurye andesite (68{+-}4Ma) - Suncheon andesitic tuff (67{+-}3Ma) - Yeosu basaltic andesite (67{+-}3Ma) - Narodo andesite (70{+-}3Ma); 3) Taebaeg Baegbyeongsan basaltic andesite (62{+-}3Ma) - Gurye Obongsan andesite (64{+-}3Ma) - Yeosu dacite (63{+-}3Ma) - Dolsando andesite (62{+-}3Ma) - Jangheung Buyongsan andesite (65{+-}3Ma); 4) Suncheon Joryedong andesite (55{+-}2Ma) - Goheung andesite (56{+-}3Ma); 5) Taebaeg Baegbyeonsan basaltic andesite (48{+-}2Ma) - Yeosu basalt (51{+-}3Ma). Resetted age (49{+-}2Ma) of an intrusive rhyolite implies the timing of thermal alteration in the Wondong Fe-Mine of the Taebaegsan Mineralized Belt. K-Ar hornblende ages of two hornblendite stocks in the southern Jangsu suggests apparent emplacement-ages of late Triassic (210{+-}9Ma) and early Permian (274{+-}10Ma), independently. K-Ar hornblende age (1023{+-}37Ma) of the Ogbang amphibolite implies a reduction of original age due to later thermal effect probably attributed to either later intrusion or regional metamorphism. (author). 56 refs., 19 tabs., 14 figs.

  9. Dicty_cDB: FC-AR20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR20 (Link to dictyBase) - G03232 DDB0186972 Contig-U15983-1 FC-AR...20P (Link to Original site) FC-AR20F 321 FC-AR20Z 550 FC-AR20P 871 - - Show FC-AR20 Library FC (Link to librar....0 %: cytoplasmic 24.0 %: nuclear 8.0 %: vesicles of secretory system 4.0 %: cytoskeletal 4.0 %: mitochondri...ontig Contig-U15983-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...20Q.Seq.d/ Representative seq. ID FC-AR20P (Link to Original site) Representative DNA sequence >FC-AR20 (FC-AR

  10. Project Decision Chain

    DEFF Research Database (Denmark)

    Rolstadås, Asbjørn; Pinto, Jeffrey K.; Falster, Peter;

    2015-01-01

    To add value to project performance and help obtain project success, a new framework for decision making in projects is defined. It introduces the project decision chain inspired by the supply chain thinking in the manufacturing sector and uses three types of decisions: authorization, selection......, and plan decision. A primitive decision element is defined where all the three decision types can be accommodated. Each task in the primitive element can in itself contain subtasks that in turn will comprise new primitive elements. The primitive elements are nested together in a project decision chain....

  11. The mass of sup 3 sup 2 Ar and sup 3 sup 3 Ar for fundamental tests

    CERN Document Server

    Blaum, K; Beck, D; Bollen, G; Herfurth, F; Kellerbauer, A G; Kluge, H J; Sauvan, E; Schwarz, S

    2003-01-01

    Masses of the short-lived radionuclides sup 3 sup 2 Ar (T sub 1 sub / sub 2 = 98 ms) sup 3 sup 3 Ar (T sub 1 sub / sub 2 = 173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10 sup - sup 8 (delta m = 1.8 keV) and 1.4 x 10 sup - sup 8 (delta m = 0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaricmultiplet mass equation IMME. Furthermore, the improved accuracy for the mass of sup 3 sup 2 Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for sup 4 sup 4 Ar and sup 4 sup 5 Ar, and a 20 sigma deviation for sup 4 sup 4 Ar from the literature value was found and interpreted.

  12. 40Ar/39Ar dating of alkaline and tholeiitic magmatism of Saudi Arabia related to the early Red Sea Rifting

    International Nuclear Information System (INIS)

    40Ar/39Ar plateau-ages at 27-28 Ma obtained on feeder dykes and one lava flow of the alkaline massif of Harrat Hadan are in agreement with the assumed age partly deduced from the conventional K/Ar data of the early activity of other alkaline volcanic massifs from Saudi Arabia. This magmatic activity is spatially distributed over a large area, along the western edge of the Arabian plate, and their N-S to NW-SE volcano-tectonic directions are similar to those of the future Red Sea Rift. Preliminary results obtained on tholeiitic lava flows, dykes and plutons gave 17 plateau-ages which, combined with 6 ages deduced from more disturbed age-spectra, display a main histogram peak from 24 to 21 Ma, much narrower than that obtained with conventional K/Ar ages on the same formations. Therefore, a strong tholeiitic activity affected a narrow linear area following the actual eastern Red Sea coast, over nearly 1700 km, during a brief period of time, and without showing any apparent migration. The main volcano-tectonic features of the future Red Sea are strongly outlined during this event. Such brief magmatic episodes related to continental rifts have also been documented by precise 40Ar/39Ar analyses on the British Tertiary Igneous Province, the Deccan traps and the eastern Central Atlantic. (orig.)

  13. Isotopic signatures by bulk analyses

    International Nuclear Information System (INIS)

    Los Alamos National Laboratory has developed a series of measurement techniques for identification of nuclear signatures by analyzing bulk samples. Two specific applications for isotopic fingerprinting to identify the origin of anthropogenic radioactivity in bulk samples are presented. The first example is the analyses of environmental samples collected in the US Arctic to determine the impact of dumping of radionuclides in this polar region. Analyses of sediment and biota samples indicate that for the areas sampled the anthropogenic radionuclide content of sediments was predominantly the result of the deposition of global fallout. The anthropogenic radionuclide concentrations in fish, birds and mammals were very low. It can be surmised that marine food chains are presently not significantly affected. The second example is isotopic fingerprinting of water and sediment samples from the Rocky Flats Facility (RFP). The largest source of anthropogenic radioactivity presently affecting surface-waters at RFP is the sediments that are currently residing in the holding ponds. One gram of sediment from a holding pond contains approximately 50 times more plutonium than 1 liter of water from the pond. Essentially 100% of the uranium in Ponds A-1 and A-2 originated as depleted uranium. The largest source of radioactivity in the terminal Ponds A-4, B-5 and C-2 was naturally occurring uranium and its decay product radium. The uranium concentrations in the waters collected from the terminal ponds contained 0.05% or less of the interim standard calculated derived concentration guide for uranium in waters available to the public. All of the radioactivity observed in soil, sediment and water samples collected at RFP was naturally occurring, the result of processes at RFP or the result of global fallout. No extraneous anthropogenic alpha, beta or gamma activities were detected. The plutonium concentrations in Pond C-2 appear to vary seasonally

  14. The isotopic distribution conundrum.

    Science.gov (United States)

    Valkenborg, Dirk; Mertens, Inge; Lemière, Filip; Witters, Erwin; Burzykowski, Tomasz

    2012-01-01

    Although access to high-resolution mass spectrometry (MS), especially in the field of biomolecular MS, is becoming readily available due to recent advances in MS technology, the accompanied information on isotopic distribution in high-resolution spectra is not used at its full potential, mainly because of lack of knowledge and/or awareness. In this review, we give an insight into the practical problems related to calculating the isotopic distribution for large biomolecules, and present an overview of methods for the calculation of the isotopic distribution. We discuss the key events that triggered the development of various algorithms and explain the rationale of how and why the various isotopic-distribution calculations were performed. The review is focused around the developmental stages as briefly outlined below, starting with the first observation of an isotopic distribution. The observations of Beynon in the field of organic MS that chlorine appeared in a mass spectrum as two variants with odds 3:1 lie at the basis of the first wave of algorithms for the calculation of the isotopic distribution, based on the atomic composition of a molecule. From here on, we explain why more complex biomolecules such as peptides exhibit a highly complex isotope pattern when assayed by MS, and we discuss how combinatorial difficulties complicate the calculation of the isotopic distribution on computers. For this purpose, we highlight three methods, which were introduced in the 1980s. These are the stepwise procedure introduced by Kubinyi, the polynomial expansion from Brownawell and Fillippo, and the multinomial expansion from Yergey. The next development was instigated by Rockwood, who suggested to decompose the isotopic distribution in terms of their nucleon count instead of the exact mass. In this respect, we could claim that the term "aggregated" isotopic distribution is more appropriate. Due to the simplification of the isotopic distribution to its aggregated counterpart

  15. Enhancement of hydrophobicity and tensile strength of muga silk fiber by radiofrequency Ar plasma discharge

    International Nuclear Information System (INIS)

    The hydrophobicity and tensile strength of muga silk fiber are investigated using radiofrequency (RF) Ar plasma treatment at various RF powers (10-30 W) and treatment times (5-20 min). The Ar plasma is characterized using self-compensated Langmuir and emissive probe. The ion energy is observed to play an important role in determining the tensile strength and hydrophobicity of the plasma treated fibers. The chemical compositions of the fibers are observed to be affected by the increase in RF power rather than treatment time. XPS study reveals that the ions that are impinging on the substrates are mainly responsible for the cleavage of peptide bond and side chain of amino acid groups at the surface of the fibers. The observed properties (tensile strength and hydrophobicity) of the treated fibers are found to be dependent on their variation in atomic concentration and functional composition at the surfaces. All the treated muga fibers exhibit almost similar thermal behavior as compared to the virgin one. At RF power of 10 W and treatment time range of 5-20 min, the treated fibers exhibit properties similar to that of the virgin one. Higher RF power (30 W) and the increase in treatment time deteriorate the properties of the fibers due to incorporation of more surface roughness caused by sufficiently high energetic ion bombardment. The properties of the plasma treated fibers are attempted to correlate with the XPS analysis and their surface morphologies.

  16. Z.W.O. Laboratory for isotope geology

    International Nuclear Information System (INIS)

    Accounts of a number of research projects, performed in the reporting year, are presented. Many of these involved isotope dating methods using the Rb-Sr, K-Ar and U-Pb systems. This is followed by a survey of associated publications. General details regarding staff, finance, conference, visits, vistors, etc. are given and a brief account of the activities is presented under the following subject areas - mineralogy and mineral separation, X-ray analysis, chemistry, mass spectrometry, electronics and computing, alpha spectrometry and fission track dating. (C.F.)

  17. Z.W.O. Laboratory for Isotopic Geology

    International Nuclear Information System (INIS)

    Summaries of the 14 most important research projects performed during the reporting year are presented. These are mainly concerned with isotope dating using Rb-Sr, K-Ar and U-Pb systems. Publications on this work are listed. Activities in mineralogy and mineral separation, X-ray analysis, chemistry, mass spectrometry, alpha spectrometry and fission-track dating are outlined. Information is also included on the laboratory personnel, speeches and papers, foreign trips and fieldwork, colloguia and receptions, foreign vistors and finance. (C.F.)

  18. 两种纯化方法获得脂肪酸的链长及碳同位素分布特征对比%The Disparity of Chain Length Distribution Patterns and Carbon Isotopic Compositions between Different Fatty Acid Purification Procedures

    Institute of Scientific and Technical Information of China (English)

    赵江涛; 刘卫国; 安芷生

    2013-01-01

    Saturated fatty acids and their isotopic composition are important proxies to reconstruct paleoenvironment and paleoclimate. There are several extraction and purification procedures of n-fatty acids based on different principles. However, a comparison test between different processes has not been reported. In this article, the agreement of fatty acid and its isotope compositions purified by different processes directly impacted on the proxies' application, especially on the comparison of reconstruction results from different regions in global change research. Two common fatty acid purification procedures were used to purify lipids of fatty acid standards, plant and peat samples. For the standards, the recovery rates of these two procedures were all greater than 85% , which indicates that these two methods are reliable to process the re-fatty acids. However, for the plants and peats samples, Procedure 1 obtained a relatively large amount of shorter chain length re-fatty acids. According to our results, Procedure 2 obtained almost all of the free fatty acids, while Procedure 1 can obtain both the free and ester state re-fatty acids in the samples. Since the free state fatty acids and esters state fatty acids in the sediment can be transformed into each other, using Procedure 1 to analyze the total fatty acids in the sediment sample was more appropriate. Alternatively, we can also use the Procedure 2 after the ester-state fatty acids in the lipids were released as free state acids by saponification.%饱和脂肪酸及其同位素组成是重建古环境和古气候的重要代用指标,目前存在多种提取及纯化流程.在全球变化研究中,基于不同原理的纯化流程得到的脂肪酸含量及其同位素组成是否一致,直接影响着该指标应用于不同区域重建结果的对比.本文用两种常见的脂肪酸纯化流程提取脂肪酸标准、现生植物和泥炭样品类脂物,通过对比发现:对脂肪酸标准两种流程

  19. Evaluation of the Immunity Activity of Glycyrrhizin in AR Mice

    Directory of Open Access Journals (Sweden)

    Ai-Guo Zhou

    2012-01-01

    Full Text Available In this study, we evaluated effect of glycyrrhizin on immunity function in allergic rhinitis (AR mice. The AR mice model were induced by dripping ovalbumin in physiological saline (2 mg mL−1, 10 μL into the bilateral nasal cavities using a micropipette. After the AR model was induced, mice were randomly divided into six groups: the normal control, model, lycopene 20 mg kg−1 (as positive control drug group, and glycyrrhizin 10, 20, 30 mg kg−1 groups. After the sensitization day 14, lycopene (20 mg/kg BW and glycyrrhizin (10, 20 and 30 mg/kg BW were given orally for 20 days once a day. Mice in the normal control and model groups were given saline orally once a day for 20 days. Results showed that glycyrrhizin treatment could dose-dependently significantly reduce blood immunoglobulin E (IgE, interleukin-4 (IL-4, interleukin-5 (IL-5, interleukin-6 (IL-6, nitrous oxide (NO, tumor necrosis factor-alpha (TNF-α levels and nitrous oxide synthase (NOS activity and enhance blood immunoglobulin A (IgA, immunoglobulin G (IgG, immunoglobulin M (IgM, interleukin-2 (IL-2 and interleukin-12 (IL-12 levels in AR mice. Furthermore, glycyrrhizin treatment could dose-dependently significantly enhance acetylcholinesterase (AchE activity and reduce substance P (SP level in peripheral blood and nasal mucosa of AR mice. We conclude that glycyrrhizin can improve immunity function in AR mice, suggesting a potential drug for the prevention and therapy of AR.

  20. Optical Emission Spectroscopic Studies of ICP Ar Plasma

    Institute of Scientific and Technical Information of China (English)

    QI Xuelian; REN Chunsheng; ZHANG Jian; MA Tengcai

    2007-01-01

    The ion line of 434.8 nm and atom line of 419.8 nm of Ar plasma produced by an inductively coupled plasma (ICP) were measured by optical emission spectroscopy and the influences from the working gas pressure, radio-frequency (RF) power and different positions in the discharge chamber on the line intensities were investigated in this study. It was found that the intensity of Ar atom line increased firstly and then saturated with the increase of the pressure. The line intensity of Ar+, on the other hand, reached a maximum value and then decreased along with the pressure. The intensity of the line in an RF discharge also demonstrated a jumping mode and a hysteresis phenomenon with the RF power. When the RF power increased to 400 W, the discharge jumped from the E-mode to the H-mode where the line intensity of Ar atom demonstrated a sudden increase, while the intensity of Ar+ ion only changed slightly. If the RF power decreased from a high value, e.g., 1000 W, the discharge would jump from the H-mode back to the E-mode at a power of 300 W. At this time the intensities of Ar and Ar+ lines would also decrease sharply. It was also noticed in this paper that the intensity of the ion line depended on the detective location in the chamber, namely at the bottom of the chamber the line was more intense than that in the middle of the chamber, but less intense than at the top, which is considered to be related to the capacitance coupling ability of the ICP plasma in different discharge areas.

  1. Acoustic Resonance Spectroscopy (ARS) Munition Classification System enhancements. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Vela, O.A.; Huggard, J.C.

    1997-09-18

    Acoustic Resonance Spectroscopy (ARS) is a non-destructive evaluation technology developed at the Los Alamos National Laboratory (LANL). This technology has resulted in three generations of instrumentation, funded by the Defense Special Weapons Agency (DSWA), specifically designed for field identification of chemical weapon (CW) munitions. Each generation of ARS instrumentation was developed with a specific user in mind. The ARS1OO was built for use by the U.N. Inspection Teams going into Iraq immediately after the Persian Gulf War. The ARS200 was built for use in the US-Russia Bilateral Chemical Weapons Treaty (the primary users for this system are the US Onsite Inspection Agency (OSIA) and their Russian counterparts). The ARS300 was built with the requirements of the Organization for the Prohibition of Chemical Weapons (OPCW) in mind. Each successive system is an improved version of the previous system based on learning the weaknesses of each and, coincidentally, on the fact that more time was available to do a requirements analysis and the necessary engineering development. The ARS300 is at a level of development that warrants transferring the technology to a commercial vendor. Since LANL will supply the computer software to the selected vendor, it is possible for LANL to continue to improve the decision algorithms, add features where necessary, and adjust the user interface before the final transfer occurs. This paper describes the current system, ARS system enhancements, and software enhancements. Appendices contain the Operations Manual (software Version 3.01), and two earlier reports on enhancements.

  2. Editorial: Supply Chain Management

    Directory of Open Access Journals (Sweden)

    Aidonis, D.

    2012-01-01

    Full Text Available This special issue has followed up the 2nd Olympus International Conference on Supply Chains held on October 5-6, 2012, in Katerini, Greece. The Conference was organized by the Department of Logistics of Alexander Technological Educational Institution (ATEI of Thessaloniki, in collaboration with the Laboratory of Quantitative Analysis, Logistics and Supply Chain Management of the Department of Mechanical Engineering, Aristotle University of Thessaloniki (AUTH. During the 2-Days Conference more than 50 research papers were presented covering the following thematic areas: (i Business Logistics, (ii Transportation, Telematics and Distribution Networks, (iii Green Logistics, (iv Information and Communication Technologies in Supply Chain Management, and (v Services and Quality. Three keynote invited speakers addressed interesting issues for the Humanitarian Logistics, Green Supply Chains of the Agrifood Sector and the Opportunities and Prospects of Greek Ports chaired Round Tables with other Greek and Foreign Scientists and Specialists.

  3. Supply chain risk management

    Directory of Open Access Journals (Sweden)

    Christian Hollstein

    2013-03-01

    Full Text Available Background: Supply chain risk management increasingly gains prominence in many international industries. In order to strengthen supply chain structures, processes, and networks, adequate potentials for risk management need to be built (focus on effective logistics and to be utilized (focus on efficient logistics. Natural-based disasters, such as the case of Fukushima, illustrate how crucial risk management is. Method: By aligning a theoretical-conceptual framework with empirical-inductive findings, it may be hypothesized that logistical systems do have a positive effect on supply chain risk management activities.  Result/conclusion:  Flexibility and capacity, as well as redundancy and standardization, are often viewed as being conflictionary. It shows, however, that in the light of supply chain risk management, those factors may yield a common benefit if proper logistics systems are applied.  

  4. A specialized isotope mass spectrometer for noninvasive diagnostics of Helicobacter pylori infection in human beings

    Science.gov (United States)

    Blashenkov, N. M.; Sheshenya, E. S.; Solov'ev, S. M.; Sachenko, V. D.; Gall, L. N.; Zarutskii, I. V.; Gall, N. R.

    2013-05-01

    A specialized isotope mass spectrometer for noninvasive diagnostics of Helicobacter pylori infection in human beings based on the carbon-13 isotope breath test has been designed and constructed. Important stages of the work included (i) calculating a low-aberration mass analyzer, (ii) manufacturing and testing special gas inlet system, and (iii) creating a small-size collector of ions. The proposed instrument ensures 13C/12C isotopic ratio measurement to within 1.7‰ (pro mille) accuracy, which corresponds to requirements for a diagnostic tool. Preliminary medical testing showed that the mass spectrometer is applicable to practical diagnostics. The instrument is also capable of measuring isotopic ratios of other light elements, including N, O, B (for BF2+ ions), Ar, Cl, and S.

  5. Supply chain reliability modelling

    OpenAIRE

    Eugen Zaitsev

    2012-01-01

    Background: Today it is virtually impossible to operate alone on the international level in the logistics business. This promotes the establishment and development of new integrated business entities - logistic operators. However, such cooperation within a supply chain creates also many problems related to the supply chain reliability as well as the optimization of the supplies planning. The aim of this paper was to develop and formulate the mathematical model and algorithms to find the ...

  6. Supply Chain Collaboration

    OpenAIRE

    Guy Rodrigue Ghomsi 1982

    2015-01-01

    Companies are now progressively looking beyond themselves to come up with ways to improve revenue and profit margins. This has resulted in a heightened focus on the efficiency of the supply chains. Inefficient supply chains are being perceived as cavities that can deprive the firm from its cash flows when inventory is not required and sales revenue when product is not available at the point of sales. This has stimulated development of business models that intend to leverage and enhance the su...

  7. Variance bounding Markov chains

    OpenAIRE

    Roberts, Gareth O.; Jeffrey S. Rosenthal

    2008-01-01

    We introduce a new property of Markov chains, called variance bounding. We prove that, for reversible chains at least, variance bounding is weaker than, but closely related to, geometric ergodicity. Furthermore, variance bounding is equivalent to the existence of usual central limit theorems for all L2 functionals. Also, variance bounding (unlike geometric ergodicity) is preserved under the Peskun order. We close with some applications to Metropolis–Hastings algorithms.

  8. Supply chain risk management

    OpenAIRE

    Christian Hollstein; Frank Himpel

    2013-01-01

    Background: Supply chain risk management increasingly gains prominence in many international industries. In order to strengthen supply chain structures, processes, and networks, adequate potentials for risk management need to be built (focus on effective logistics) and to be utilized (focus on efficient logistics). Natural-based disasters, such as the case of Fukushima, illustrate how crucial risk management is. Method: By aligning a theoretical-conceptual framework with empirical-induct...

  9. Editorial: Supply Chain Management

    OpenAIRE

    Aidonis, D.; Folinas, D.; Triantafillou, D.

    2012-01-01

    This special issue has followed up the 2nd Olympus International Conference on Supply Chains held on October 5-6, 2012, in Katerini, Greece. The Conference was organized by the Department of Logistics of Alexander Technological Educational Institution (ATEI) of Thessaloniki, in collaboration with the Laboratory of Quantitative Analysis, Logistics and Supply Chain Management of the Department of Mechanical Engineering, Aristotle University of Thessaloniki (AUTH). During the 2-Days Conference m...

  10. Innovation Across the Supply Chain

    DEFF Research Database (Denmark)

    Druehl, Cheryl; Carrillo, Janice; Hsuan, Juliana

    Innovation is an integral part of every firm’s ongoing operations. Beyond product innovation, supply chain innovations offer a unique source of competitive advantage. We synthesize recent research on innovation in the supply chain, specifically, innovative supply chain processes...

  11. MASTERING SUPPLY CHAIN RISKS

    Directory of Open Access Journals (Sweden)

    Borut Jereb

    2012-11-01

    Full Text Available Risks in supply chains represent one of the major business issues today. Since every organizationstrives for success and uninterrupted operations, efficient supply chain risk management is crucial.During supply chain risk research at the Faculty of Logistics in Maribor (Slovenia some keyissues in the field were identified, the major being the lack of instruments which can make riskmanagement in an organization easier and more efficient. Consequently, a model which captures anddescribes risks in an organization and its supply chain was developed. It is in accordance with thegeneral risk management and supply chain security standards, the ISO 31000 and ISO 28000families. It also incorporates recent finding from the risk management field, especially from theviewpoint of segmenting of the public.The model described in this paper focuses on the risks itself by defining them by different keydimensions, so that risk management is simplified and can be undertaken in every supply chain andorganizations within them. Based on our mode and consequent practical research in actualorganizations, a freely accessible risk catalog has been assembled and published online from the risksthat have been identified so far. This catalog can serve as a checklist and a starting point in supplychain risk management in organizations. It also incorporates experts from the field into a community,in order to assemble an ever growing list of possible risks and to provide insight into the model andits value in practice.

  12. Issues on Supply Chain Management

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Although supply chain is regarded as an integrated pr ocess, actually, researchers and practitioners have primarily investigated the v arious processes of the supply chain individually. The competitive field in most markets requires well-designed integrated supply chain instead of individual o perations. In this paper, some traditional thinking of supply chain is given fir st, then SCM (Supply Chain Management) is introduced, which views the entire sup ply chain as a whole rather than individual process a...

  13. Transportation of medical isotopes

    International Nuclear Information System (INIS)

    A Draft Technical Information Document (HNF-1855) is being prepared to evaluate proposed interim tritium and medical isotope production at the Fast Flux Test Facility (FFTF). This assessment examines the potential health and safety impacts of transportation operations associated with the production of medical isotopes. Incident-free and accidental impacts are assessed using bounding source terms for the shipment of nonradiological target materials to the Hanford Site, the shipment of irradiated targets from the FFTF to the 325 Building, and the shipment of medical isotope products from the 325 Building to medical distributors. The health and safety consequences to workers and the public from the incident-free transportation of targets and isotope products would be within acceptable levels. For transportation accidents, risks to works and the public also would be within acceptable levels. This assessment is based on best information available at this time. As the medical isotope program matures, this analysis will be revised, if necessary, to support development of a final revision to the Technical Information Document

  14. Separation of sulfur isotopes

    Science.gov (United States)

    DeWitt, Robert; Jepson, Bernhart E.; Schwind, Roger A.

    1976-06-22

    Sulfur isotopes are continuously separated and enriched using a closed loop reflux system wherein sulfur dioxide (SO.sub.2) is reacted with sodium hydroxide (NaOH) or the like to form sodium hydrogen sulfite (NaHSO.sub.3). Heavier sulfur isotopes are preferentially attracted to the NaHSO.sub.3, and subsequently reacted with sulfuric acid (H.sub.2 SO.sub.4) forming sodium hydrogen sulfate (NaHSO.sub.4) and SO.sub.2 gas which contains increased concentrations of the heavier sulfur isotopes. This heavy isotope enriched SO.sub.2 gas is subsequently separated and the NaHSO.sub.4 is reacted with NaOH to form sodium sulfate (Na.sub.2 SO.sub.4) which is subsequently decomposed in an electrodialysis unit to form the NaOH and H.sub.2 SO.sub.4 components which are used in the aforesaid reactions thereby effecting sulfur isotope separation and enrichment without objectionable loss of feed materials.

  15. Modelling Ar II spectral emission from the ASTRAL helicon plasma

    Science.gov (United States)

    Munoz Burgos, Jorge; Boivin, Robert; Loch, Stuart; Kamar, Ola; Ballance, Connor; Pindzola, Mitch

    2008-11-01

    We describe our spectral modeling of ArII emission from the ASTRAL helicon plasma at Auburn University. Collisional-radiative theory is used to model the emitted spectrum, with account being taken for the density and temperature variation along the line of sight. This study has two main aims. Firstly to test the atomic data used in the model and secondly to identify spectral line ratios in the 200 nm - 1000 nm range that could be used as temperature diagnostics. Using the temperature at which Ar II emission starts to be seen we have been able to test recent ionization and recombination data. Using selected spectral lines we were then able to test the importance of the continuum-coupling effects included in the most recent Ar+ electron impact excitation data. Selected spectral line ratios have been identified that show a strong temperature variation and have potential as a temperature diagnostic.

  16. Factor Structure of CIWA-Ar in Alcohol Withdrawal.

    Science.gov (United States)

    Bakhla, Ajay Kumar; Khess, Christoday R J; Verma, Vijay; Hembram, Mahesh; Praharaj, Samir Kumar; Soren, Subhas

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance), and the third had two items (10.04% variance). Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors. PMID:24826372

  17. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    Directory of Open Access Journals (Sweden)

    Ajay Kumar Bakhla

    2014-01-01

    Full Text Available Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance, second factor also had four items (24.25% variance, and the third had two items (10.04% variance. Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors.

  18. Role of hexadecapole interaction in proton rich barium isotopes

    International Nuclear Information System (INIS)

    From the systematic analysis of the experimental data on proton rich barium isotopes, it is observed that nuclei in the region z ≥ 50 and N≤82 are the transitional nuclei as they show a shape transition from spherical to deformed shape. An interesting feature of the observed yrast spectra in barium isotopic mass chain is the systematic variation of E2+, E4+ and E6+ excitation energy states from 120Ba to 136Ba. It is observed that these states follow a systematic decreasing trend as move away from 136Ba towards 120Ba. The isotopes 120-128Ba can be taken to be quasi-deformed nuclei having E4+/E2+ ratio larger than 2.7. Based on the systematics of low-lying states and the experimental data of quadrupole moments and B(E2) transition probabilities, the stable barium isotopes range from the approximately spherical 138Ba to l30Ba which is close to the deformed 120-128Ba isotopes. The purpose of the paper is to determine the importance of octupole-octupole and hexadecapole- hexadecapole parts of the two body interaction in reproducing the observed nuclear structure properties of 120-136Ba isotopes

  19. Laser spectroscopy of neutron deficient gold and platinum isotopes

    International Nuclear Information System (INIS)

    A new method for on-line laser spectroscopy of radioactive atoms based on the resonant ionization spectroscopy of laser-desorbed radioactive samples has been devised. An experimental setup has been installed on-line at the ISOCELE mass separator in Orsay (France) and experiments have been performed on the region of transitional nuclei around Z=79. Isotopic shift measurements on four new isotopes 194Au, 196Au, 198Au, 199Au have been performed on gold and results on the neutron deficient isotopes down to 186 Au have been obtained confirming the nuclear ground-state shape transition from oblate to prolate between 187Au and 186Au. The first isotopic shift measurements on radioactive platinum isotopes have been obtained on 186Pt, 188Pt, 189Pt. Indications of a shape transition have been observed between 186Pt and 188Pt. The extracted experimental changes in mean square charge radii δ 2 > A,A' along isotopic chains are compared to self-consistent Hartree-Fock plus BCS calculations

  20. A 2-chain can interlock with a k-chain

    OpenAIRE

    Glass, Julie; Langerman, Stefan; O'Rourke, Joseph; Snoeyink, Jack; Zhong, Jianyuan K.

    2004-01-01

    One of the open problems posed in [3] is: what is the minimal number k such that an open, flexible k-chain can interlock with a flexible 2-chain? In this paper, we establish the assumption behind this problem, that there is indeed some k that achieves interlocking. We prove that a flexible 2-chain can interlock with a flexible, open 16-chain.

  1. 40Ar-39Ar age of the Shergotty achondrite and implications for its post-shock thermal history

    International Nuclear Information System (INIS)

    Analyses of 40Ar-39Ar have been made on a whole rock sample and a maskelynite (feldspar) separate of the shocked Shergotty achondrite. The maskelynite gave a plateau age of 254 +- 10 Myr. The whole rock sample gave a complex release with apparent ages between 240 and 640 Myr. The slightly younger Rb-Sr isochron age of 165 Myr for Shergotty suggests that the maskelynite as well as the whole rock was incompletely degassed. Reasonable Ar diffusion characteristics for Shergotty for shock heating temperatures of 0C indicate D/a2 of 10-11 to 10-13sec-1. The time required to lose 95% of the 40Ar from the plagioclase would be approximately 103 to 104 yr. When this gas diffusion time is introduced into a thermal model of a cooling ejecta blanket of variable thickness, a post-shock cooling time of >= 103 yr and a burial depth of >= 300 m are indicated for Shergotty. These conclusions are not seriously affected by uncertainties in the thermal model. Most likely the shock event occurred approximately 165 Myr ago, but no earlier than 250 Myr ago, when the Shergotty parent object experienced a collision in the asteroid belt. As a result of that collision, feldspar was converted to maskelynite, the K-Ar and Rb-Sr ages were completely or nearly completely reset, and the Shergotty meteorite was heated to 0C and left to cool slowly inside the parent body. (author)

  2. 40Ar/39Ar laser probe evidence concerning the age and associated hazards of the Lake Nyos Maar, Cameroon

    Science.gov (United States)

    Dalrymple, G.B.; Lockwood, J.P.

    1990-01-01

    The waters of Lake Nyos are impounded by a fragile natural dam composed of pyroclastic rocks ejected during the formation of the lake crater (maar). Lateral erosion of this dam has reduced its width from over 500 m to only 45 m. Published whole-rock K-Ar ages of about 100 ka on juvenile basalt from the dam suggests that erosion has been slow and that the dam poses no imminent threat. New apparent 40Ar/39Ar ages of 1.4 to 232 Ma on xenocrystic K-feldspar contained in the basalt show that the xenocrysts, whose source is the 528-Ma crystalline basement, are carriers of inherited radiogenic 40Ar and would cause the whole-rock K-Ar ages to be too old. The best estimate for the age of the maar is provided by a 14C age of 400 ?? 100 yr BP on charcoal from the base of the dam. This young age indicates that the dam is eroding at a relatively rapid rate; its failure, perhaps within a few decades, would result in a major flood and imperil thousands of people living downstream in Cameroon and eastern Nigeria. ?? 1990 Kluwer Academic Publishers.

  3. Etching characteristics and mechanisms of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas

    Science.gov (United States)

    Lim, Nomin; Efremov, Alexander; Yeom, Geun Young; Choi, Bok-Gil; Kwon, Kwang-Ho

    2014-11-01

    The etching characteristics and mechanism of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas under the same operating conditions (pressure, 6 mTorr; input power, 700 W; bias power, 200 W) were investigated. For both gas mixtures, an increase in the Ar fraction or gas pressure at a fixed gas mixing ratio was found to cause a non-monotonic change in the Mo etching rates. The X-ray photoelectron spectroscopy (XPS) diagnostics indicated contamination of the etched surfaces by reaction products. The Cl2/Ar and CF4/Ar plasma parameters were also investigated using a combination of a zero-dimensional plasma model and plasma diagnostics using Langmuir probes. An analysis of the etching kinetics with the model-predicted fluxes of the plasma active species suggests that: 1) the Mo etching process occurs in the transitional regime of the ion-assisted chemical reaction, and 2) the non-monotonic Mo etching rate is probably associated with opposing changes in the fluxes of the reactive neutral species and ion energy.

  4. Stable isotopes. Applications and production; Les isotopes stables. Applications - production

    Energy Technology Data Exchange (ETDEWEB)

    Goldstein, S.; Louvet, P.; Soulie, E. [eds.

    1994-12-31

    This conference presents 46 communications concerning stable isotope production, utilization and application, grouped in 6 sessions and posters. The various themes are: biological applications (pharmacology, medical diagnosis, metabolism and protein studies, toxicity and response studies, labelled compounds), analysis procedures (NMR analysis for macromolecules, tracer studies), nuclear applications (utilization of stable isotopes in nuclear reactors), biological, physical and chemical applications (mass transfer, mobility, crystallography, isotopic exchange), stable isotope production (ion chromatography, ion cyclotron resonance, cryogenic distillation).

  5. Lithium isotope separation

    International Nuclear Information System (INIS)

    Published methods for 6Li-7Li lithium isotope separation have been reviewed. Future demand for 6Li, whose main use will be as a tritium breeder in blankets surrounding the core of DT fusion power reactors, is likely to exceed 5 Mg/a in the next century. The applicability of the various available methods to such a large scale production rate has been assessed. Research on improving the effectiveness of current lithium isotope separation processes has been carried out worldwide in several major areas during the past decade; these include two-phase chemical exchange systems, ion exchange resin chromatography, highly isotope-selective techniques like laser photoactivation and radiofrequency spectroscopy. Chemical exchange systems appear to offer good potential in the near term for 6Li enrichment

  6. A DNA polymerase mutation that suppresses the segregation bias of an ARS plasmid in Saccharomyces cerevisiae.

    OpenAIRE

    Houtteman, S W; Elder, R T

    1993-01-01

    Yeast autonomously replicating sequence (ARS) plasmids exhibit an unusual segregation pattern during mitosis. While the nucleus divides equally into mother and daughter cells, all copies of the ARS plasmid will often remain in the mother cell. A screen was designed to isolate mutations that suppress this segregation bias. A plasmid with a weak ARS (wARS) that displayed an extremely high segregation bias was constructed. When cells were grown under selection for the wARS plasmid, the resulting...

  7. Phasic Triplet Markov Chains.

    Science.gov (United States)

    El Yazid Boudaren, Mohamed; Monfrini, Emmanuel; Pieczynski, Wojciech; Aïssani, Amar

    2014-11-01

    Hidden Markov chains have been shown to be inadequate for data modeling under some complex conditions. In this work, we address the problem of statistical modeling of phenomena involving two heterogeneous system states. Such phenomena may arise in biology or communications, among other fields. Namely, we consider that a sequence of meaningful words is to be searched within a whole observation that also contains arbitrary one-by-one symbols. Moreover, a word may be interrupted at some site to be carried on later. Applying plain hidden Markov chains to such data, while ignoring their specificity, yields unsatisfactory results. The Phasic triplet Markov chain, proposed in this paper, overcomes this difficulty by means of an auxiliary underlying process in accordance with the triplet Markov chains theory. Related Bayesian restoration techniques and parameters estimation procedures according to the new model are then described. Finally, to assess the performance of the proposed model against the conventional hidden Markov chain model, experiments are conducted on synthetic and real data. PMID:26353069

  8. A 2-chain can interlock with an open 10-chain

    OpenAIRE

    Lu, Bin; O'Rourke, Joseph; Zhong, Jianyuan K.

    2013-01-01

    It is an open problem, posed in \\cite{SoCG}, to determine the minimal $k$ such that an open flexible $k$-chain can interlock with a flexible 2-chain. It was first established in \\cite{GLOSZ} that there is an open 16-chain in a trapezoid frame that achieves interlocking. This was subsequently improved in \\cite{GLOZ} to establish interlocking between a 2-chain and an open 11-chain. Here we improve that result once more, establishing interlocking between a 2-chain and a 10-chain. We present argu...

  9. Efeito dos incêndios florestais na qualidade do ar

    OpenAIRE

    Miranda, Ana Isabel

    1998-01-01

    Os incêndios florestais podem ser considerados como um processo de combustão natural em grande escala, que consome diversas espécies vegetais numa área geográfica específica Consequentemente, consistem numa fonte potencial de elevadas quantidades de poluentes para a atmosfera, sendo indispensável conhecer o seu impacto na qualidade do ar. O objectivo principal deste trabalho consiste no estudo do efeito das emissões dos incêndios florestais na qualidade do ar. Para tal, foram d...

  10. Interatomic scattering in energy dependent photoelectron spectra of Ar clusters

    Energy Technology Data Exchange (ETDEWEB)

    Patanen, M.; Benkoula, S.; Nicolas, C.; Goel, A. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Antonsson, E. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Physikalische und Theoretische Chemie Institut für Chemie und Biochemie, Fachbereich Biologie, Chemie, Pharmazie, Freie Universität Berlin, Takustrasse 3, 14195 Berlin (Germany); Neville, J. J. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Department of Chemistry, University of New Brunswick, Fredericton, New Brunswick E3B 6E2 (Canada); Miron, C., E-mail: Catalin.Miron@synchrotron-soleil.fr [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Extreme Light Infrastructure - Nuclear Physics (ELI-NP), ‘Horia Hulubei’ National Institute for Physics and Nuclear Engineering, 30 Reactorului Street, RO-077125 Măgurele, Jud. Ilfov (Romania)

    2015-09-28

    Soft X-ray photoelectron spectra of Ar 2p levels of atomic argon and argon clusters are recorded over an extended range of photon energies. The Ar 2p intensity ratios between atomic argon and clusters’ surface and bulk components reveal oscillations similar to photoelectron extended X-ray absorption fine structure signal (PEXAFS). We demonstrate here that this technique allows us to analyze separately the PEXAFS signals from surface and bulk sites of free-standing, neutral clusters, revealing a bond contraction at the surface.

  11. Web authentic and similar texts detection using AR digital signature

    OpenAIRE

    Πούλος, Μάριος; Σκιαδόπουλος, Σπύρος; Μπώκος, Γιώργος Δ.

    2010-01-01

    In this paper, we propose a new identification technique based on an AR model with a complexity of size O(n) times in web form, with the aim of creating a unique serial number for texts and to detect authentic or similar texts. For the implementation of this purpose, we used an Autoregressive Model (AR) 15 th order, and for the identification procedure, we employed the cross-correlation algorithm. Empirical investigation showed that the proposed method may be used as an accurate method for id...

  12. Development of a low-level Ar-37 calibration standard

    CERN Document Server

    Williams, R M; Bowyer, T W; Day, A R; Fuller, E S; Haas, D A; Hayes, J C; Hoppe, E W; Humble, P H; Keillor, M E; LaFerriere, B D; Mace, E K; McIntyre, J I; Miley, H S; Myers, A W; Orrell, J L; Overman, C T; Panisko, M E; Seifert, A

    2016-01-01

    Argon-37 is an environmental signature of an underground nuclear explosion. Producing and quantifying low-level Ar-37 standards is an important step in the development of sensitive field measurement instruments. This paper describes progress at Pacific Northwest National Laboratory in developing a process to generate and quantify low-level Ar-37 standards, which can be used to calibrate sensitive field systems at activities consistent with soil background levels. This paper presents a discussion of the measurement analysis, along with assumptions and uncertainty estimates.

  13. Multiphoton Double Ionization of Ar and Ne Close to Threshold

    International Nuclear Information System (INIS)

    In kinematically complete studies we explore double ionization (DI) of Ne and Ar in the threshold regime (I>3x1013 W/cm2) for 800 nm, 45 fs pulses. The basic differences are found in the two-electron momentum distributions - 'correlation' (CO) for Ne and 'anticorrelation' (ACO) for Ar - that can be partially explained theoretically within a 3D classical model including tunneling. Transverse electron momentum spectra provide insight into 'Coulomb focusing' and point to correlated nonclassical dynamics. Finally, DI threshold intensities, CO as well as ACO regimes are predicted for both targets.

  14. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    OpenAIRE

    Ajay Kumar Bakhla; Khess, Christoday R.J.; Vijay Verma; Mahesh Hembram; Samir Kumar Praharaj; Subhas Soren

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance...

  15. Medidas da umidade relativa do ar em um ambiente fechado

    OpenAIRE

    Costa Eden V.

    2003-01-01

    Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de p...

  16. Axenfeld-Rieger syndrome (ARS): A review and case report.

    LENUS (Irish Health Repository)

    Waldron, Jennie M

    2011-08-29

    Axenfeld-Rieger syndrome (ARS) is a rare, autosomal dominant condition characterized by ocular, craniofacial, dental, and periumbilical abnormalities. Relatively little information exists on this syndrome within the dental literature despite the fact that midface hypoplasia and maxillary hypodontia are classical presenting features of this syndrome. This is a case report of a 7-year-old Caucasian female with ARS who presented with significant ocular and dental anomalies. She was also found to have osteopenia. Her dental condition is described, her immediate treatment is shown, and her long-term treatment needs are discussed.

  17. Preliminary K/Ar geochronology of the Crater Basalt volcanic field (CBVF, northern Patagonia

    Directory of Open Access Journals (Sweden)

    Z. Pécskay

    2007-11-01

    Full Text Available The Crater Basalt volcanic field is one of the Quaternary intraplate basaltic fields in northern Patagonia. A systematic geological, volcanological and geochronological study of CBVF indicates a multistage history of eruptions of basaltic volcanoes. K/Ar dating, using whole rock samples shows that the measured analytical ages are fully consistent with the available stratigraphic control. The radiometric ages fall into three distinct, internally consistent age groups, which give evidence that there were at least three major episodes of volcanic activity, at about 1.0 Ma, 0.6 Ma and 0.3 Ma ago. The age differences appear to be just significant, even although less than 10 % radiogenic argon was found in the isotope analysis of whole rock samples.El campo volcánico del Basalto Cráter (CVBC constituye uno de los campos basálticos cuaternarios de intraplaca de la Patagonia septentrional. El estudio sistemático de la geología, volcanología y geocronología del CVBC muestra una historia eruptiva multiepisódica de volcanes basálticos. Las dataciones K-Ar realizadas sobre roca total son coherentes con el control estratigráfico. Las edades obtenidas para el Basalto Cráter permiten distinguir tres episodios diferentes, pero individualmente coherentes, de actividad volcánica, ocurridos hace ~1,0 Ma; 0,6 Ma y 0,3 Ma. Las diferencias de edad parecen ser significativas, aún cuando el contenido de argón radiogénico determinado en los análisis de roca total resultó menor al 10 %.

  18. Climate and isotopic tracers

    International Nuclear Information System (INIS)

    The applications of natural radioactivity and isotopic measurements in the sciences concerning Earth and its atmosphere, are numerous: carbon 14 dating with the Tandetron apparatus at the Cea, measurement of oxygen 18 in coral or sediment limestone for the determination of ocean temperature and salinity, carbon 14 dating of corals for the determination of sea level variations, deuterium content in polar ice-cap leads to temperature variations determination; isotopic measurements also enable the determination of present climate features such as global warming, oceanic general circulation

  19. Zinc isotope anomalies

    International Nuclear Information System (INIS)

    The Zn isotope composition in refractory-element-rich inclusions of the Allende meteorite are determined. Typical inclusions contain normal Zn. A unique inclusion of the Allende meteorite shows an excess for Zn-66 of 16.7 + or - 3.7 eu (1 eu = 0.01 percent) and a deficit for Zn-70 of 21 + or - 13 eu. These results indicate the preservation of exotic components even for volatile elements in this inclusion. The observed excess Zn-66 correlates with excesses for the neutron-rich isotopes of Ca-48, Ti-50, Cr-54, and Fe-58 in the same inclusion. 32 refs

  20. Isotopes in condensed matter

    Energy Technology Data Exchange (ETDEWEB)

    Plekhanov, Vladimir G. [Computer Science College, Tallinn (Estonia). Mathematics and Physics Dept.

    2013-07-01

    This book provides a concise introduction to the newly created sub-discipline of solid state physics isotopetronics. The role of isotopes in materials and their properties are describe in this book. The problem of the enigma of the atomic mass in microphysics is briefly discussed. The range of the applications of isotopes is wide: from biochemical process in living organisms to modern technical applications in quantum information. Isotopetronics promises to improve nanoelectronic and optoelectronic devices. With numerous illustrations this book is useful to researchers, engineers and graduate students.