WorldWideScience

Sample records for ar interior provocada

  1. AVALIAÇÃO DA QUALIDADE DO AR INTERIOR DO HOSPITAL UNIVERSITÁRIO PEDRO ERNESTO

    Directory of Open Access Journals (Sweden)

    Eduardo Delfino Sodré

    2014-12-01

    Full Text Available DOI: 10.12957/sustinere.2014.14126A “Síndrome do Edifício Doente” é um termo utilizado para definir a má qualidade do ar de ambientes interiores e tem sido de preocupação crescente da comunidade científica. A avaliação da qualidade do ar, nos locais amostrados no HUPE, fundamentada na resolução n° 9 de 2003 da Agência Nacional de Vigilância Sanitária, teve como objetivos conhecer e informar para que a Comissão de Controle de Infecção Hospitalar avalie a interação deste fator com as infecções nosocomiais e decida pela necessidade, ou não, de medidas corretivas e contribuir para o conhecimento e desenvolvimento de técnicas e controle da poluição “Indoor”. As amostras foram coletadas com um amostrador de ar tipo impactador linear, de um estágio (MERCK e a interpretação dos resultados utilizou dois critérios contidos na norma vigente: o valor máximo aceitável (VMA de fungos em ambientes internos (750UFC/m3 e o limite aceitável entre a contaminação interna e externa (I/E ≤ 1,5. Entre os sessenta ambientes avaliados nos três primeiros pavimentos do HUPE 20% do total encontravam-se em desacordo com relação ao número de UFC/m3 e 16,6% em relação à relação I/E. Conclui-se que 28% dos setores avaliados do 1° pavimento do HUPE e 26% dos contidos no 2° pavimento não estão tendo a renovação de ar desejada, propiciando o acúmulo de fungos.

  2. Minu San Martín Aróstegui: la pintura interior

    OpenAIRE

    D'Agosto Forteza, Sonia Adriana

    2015-01-01

    En este trabajo se da a conocer la trayectoria vital y profesional de la pintora Minu San Martín Aróstegui. Artista nacida en San Sebastián con un interesante recorrido en el que podremos rastrear la belleza plástica que emana de la fusión entre el Romanticismo occidental y la filosofía Taoísta. In this work one occurs to know the vital and artistic trajectory Minu painter San Martin Aróstegui. Artist born in San Sebastián with an interesting artistic route where we will be able to track t...

  3. INTERIORITY

    DEFF Research Database (Denmark)

    Hvejsel, Marie Frier

    been motivated by the particular hypothesis that an introduction of the notion of interiority, as an ability of the spatial envelope itself to address the sensuous scale of furniture, unfolds a particular dual critical potential signifying our experience of domestic architectural quality: On the one...... an interrelation of the functional and emotional dimensions of furniture and envelope as form, with the necessary economy and logic of construction, can be developed as a critical architctural theory for transforming the technical and economical elements of construction into experiences of interiority within...... of furnishing ‘gestures’ requiring of the envelope itself to guide, reveal, cover, caress and embrace us. These ‘gestures’ unite function and emotion by describing at once a physical movement and a feeling which is intrinsic of the spatial envelope itself. - The explanatory level has resulted in the development...

  4. TEMPERATURA DO AR NO INTERIOR DO CANAL DE CULTIVO E CRESCIMENTO DA ALFACE EM FUNÇÃO DO MATERIAL DE COBERTURA DA MESA DE CULTIVO HIDROPÔNICO - NFT

    Directory of Open Access Journals (Sweden)

    MATTOS KAREN MARIA DA COSTA

    2001-01-01

    Full Text Available Estudou-se o efeito de diferentes tipos de material de cobertura de mesas de cultivo hidropônico-NFT na temperatura do interior das canaletas e no crescimento da alface (Lactuca sativa L., cv. Verônica. Em comparação ao tratamento-controle (tubos de polipropileno, utilizaram-se mantas de polietileno dupla face (branco e preto e de Tetra-Pak®. O experimento foi realizado no Núcleo Experimental de Campinas, do Instituto Agronômico (22°54'S, 47°05'W, 674 m de altitude, usando-se mesas de cultivo com 24 m de comprimento, dividida em quatro blocos simétricos com os tratamentos distribuídos ao acaso. Sessenta termopares foram instalados no interior dos tubos para avaliar a temperatura interna do ar; armazenaram-se os sinais em um datalogger. Os valores medidos no interior dos tubos foram sempre superiores aos externos. Entretanto, nos tubos protegidos com Tetra-Pak®, os dados da temperatura interna do ar foram sempre de menor magnitude e, os de massa fresca de plantas de alface, superiores aos demais tratamentos. Essas diferenças foram estatisticamente significativas pelo teste de Tukey ao nível de 5%. No período noturno, nenhuma diferença de comportamento foi obtida entre os três tratamentos usados.

  5. Vacuna frente a infestaciones provocadas por artrópodos hematófagos

    OpenAIRE

    Fuente García, José de la; Villar, Margarita; Prudencio, Carlos Roberto; Pérez de Lastra, José Manuel

    2012-01-01

    [ES] La presente invención describe una vacuna frente a infestaciones provocadas por artrópodos hematófagos preferentemente garrapatas, mosquitos, flebótomos, ácaros rojos de las gallinas, pulgas, piojos, piojos de mar, etc. Así mismo, se protege un péptido capaz de inducir una respuesta inmune protectora y de reacción cruzada frente a una infestación provocada por artrópodos hematófagos, un polinucleótido, un vector de expresión, una célula hospedadora, un animal no humano, un anticuerpo, y ...

  6. Vacuna frente a infestaciones provocadas por artrópodos hematófagos

    OpenAIRE

    Fuente García, José de la; Villar, Margarita; Prudencio, Carlos Roberto; Pérez de Lastra, José Manuel

    2012-01-01

    La presente invención describe una vacuna frente a infestaciones provocadas por artrópodos hematófagos preferentemente garrapatas, mosquitos, flebótomos, ácaros rojos de las gallinas, pulgas, piojos, piojos de mar, etc. Así mismo, se protege un péptido capaz de inducir una respuesta inmune protectora y de reacción cruzada frente a una infestación provocada por artrópodos hematófagos, un polinucleótido, un vector de expresión, una célula hospedadora, un animal no hum...

  7. Modelo de simulação da temperatura e umidade relativa do ar no interior de estufa plástica Simulation model of air temperature and relative humidity in to plastic greenhouses

    Directory of Open Access Journals (Sweden)

    Edilson Costa

    2004-04-01

    Full Text Available A simulação dos parâmetros climáticos de temperatura e umidade relativa do ar no interior de uma estufa plástica, por meio do balanço de energia, pode propiciar ao produtor uma ferramenta de auxílio na tomada de decisão. Nesse propósito, realizou-se uma simulação das condições no interior de estufa plástica, em função de parâmetros externos e internos a ela. A simulação revelou uma temperatura no interior da estufa plástica de 23,6 ºC, e os sensores revelaram um valor médio de 24,1 ºC para o período de cultivo da alface. Para a umidade relativa no interior da estufa plástica, o valor simulado foi de 61,6%, e o obtido com o auxílio de sensores foi de 66,0%. Os valores simulados apresentaram-se próximos dos valores obtidos pelos sensores, mostrando que o modelo pode ser usado para a estimativa da temperatura e umidade relativa do ar no interior da estufa plástica.Simulation of climatic parameters inside air temperature and relative humidity of plastic greenhouse, trough energy balance, allows to growers a good technical tool on the decision making to improve the performance of inside environments. A simulation of internal conditions based on external and internal parameters was evaluated. The results showed the inside mean temperature of 23.6 ºC in comparison with the experimental value of 24.1 ºC, for the cultivated period. The simulated relative humidity presented a value of 61.6% against 66.0% obtained by the sensors. The simulated values were closed to the values obtained by the sensors, which means that the model can be used to determine the internal conditions of plastic greenhouses.

  8. Ars disyecta Ars disyecta

    Directory of Open Access Journals (Sweden)

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  9. Atención médica de lesiones intencionales provocadas por la violencia familiar

    Directory of Open Access Journals (Sweden)

    Híjar-Medina Martha

    2003-01-01

    Full Text Available OBJETIVO: Describir y analizar las características de la demanda provocada por lesiones intencionales, en especial las provocadas por violencia familiar en los servicios de urgencias de hospitales públicos de la Ciudad de México. MATERIAL Y MÉTODOS: Se realizó un estudio transversal, en el cual se incluyeron variables relacionadas con el agresor, el agredido y con la atención médica. Se diseñó un cuestionario, que se aplicó durante los meses de enero a abril de 1998 en cuatro hospitales seleccionados. Se realizó un análisis con base en frecuencias simples, ji cuadrado, razón de momios con sus respectivos intervalos de confianza de 95%, y se aplicó modelo de regresión logística ajustado por las variables asociadas con este tipo de demanda. RESULTADOS: De los 598 casos que presentaron lesiones intencionales, 16% correspondió a violencia familiar. Los más afectados fueron el sexo femenino (76%, y jóvenes entre 15 y 29 años de edad (46%. Las variables que se encontraron asociadas con la demanda por lesiones provocadas por violencia familiar, en comparación con otro tipo de violencia, fueron: edad mayor de 30 años (RM 2.36, IC 95% 1.13-4.90, sexo femenino (RM 8.60, IC 95%/4.25-17.40 antecedentes de lesiones previas (RM 4.93, IC 95% 2.03-11.95, el hogar como lugar de ocurrencia (RM 36.25, IC 95% 16.598-79.18 y escolaridad primaria o menos (RM 2.33, IC 95% 1.03-5.26. CONCLUSIONES: Los resultados encontrados coinciden con reportes de otros estudios sobre el tema, y son de gran utilidad como antecedentes para la aplicación de la Norma Oficial Mexicana para la Atención Médica de la Violencia Familiar, que entró en vigencia en marzo de 2000.

  10. Interior Design.

    Science.gov (United States)

    Texas Tech Univ., Lubbock. Home Economics Curriculum Center.

    This document contains teacher's materials for an eight-unit secondary education vocational home economics course on interior design. The units cover period styles of interiors, furniture and accessories, surface treatments and lighting, appliances and equipment, design and space planning in home and business settings, occupant needs, acquisition…

  11. Ars Electronica

    DEFF Research Database (Denmark)

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  12. Ambientes climatizados, portaria 3.523 de 28/8/98 do Ministério da Saúde e padrões de qualidade do ar de interiores do Brasil

    Directory of Open Access Journals (Sweden)

    GONTIJO FILHO PAULO PINTO

    2000-01-01

    Full Text Available O artigo analisa criticamente a portaria 3.523 de 28/8/98 do Ministério da Saúde, com ênfase na questão dos contaminantes do ar e suas conseqüências para a saúde em ambientes climatizados. É feita, ainda, uma revisão concisa sobre as infecções hospitalares e as áreas hospitalares em que a transmissão por via aerógena pode ser importante, sendo necessários sistemas de ventilação especial. Os padrões de partículas, mais precisamente os biológicos, são considerados de forma detalhada, destacando-se os contaminantes microbianos mais comuns, as diferenças entre países dos Hemisférios Norte e Sul e as questões relativas à metodologia utilizada em sua análise. Conclui-se que não há, no momento, elementos para uma definição de padrões de partículas biológicas no país.

  13. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  14. Variación de la humedad relativa en el interior del hormigón debido al cambio de humedad relativa y temperatura en el ambiente externo

    OpenAIRE

    Bernal Camacho, Jesús Manuel; Moragues Terrades, Amparo; Reyes Pozo, Encarnación; Galvez Ruiz, Jaime Carlos; González, J.R. (Javier Roberto)

    2015-01-01

    En la durabilidad del hormigón juega un papel fundamental la penetración de iones agresivos en su interior debido a distintos mecanismos de transporte entre los que destacan la difusión y la advección. Esta penetración se ve afectada en gran medida por la humedad relativa existente en el interior del hormigón. El presente trabajo se centra en el estudio de las variaciones de la humedad relativa en el interior del hormigón provocadas por cambios de humedad relativa y temperatura en el ambie...

  15. Estudio de las oscilaciones provocadas por los generadores de inducción en el Parque Eólico La Venta (México)

    OpenAIRE

    Mercedes Lázaro-Gonzaga; Arturo Román-Mesina; Daniel Olguín-Salinas

    2008-01-01

    Este artículo presenta un análisis del comportamiento de las oscilaciones locales provocadas por siete unidades generadoras asíncronas de un parque eólico, localizadas en la zona de La Venta, Oaxaca-México, en el sur del Istmo de Tehuantepec. Este Sistema Eléctrico de Potencia (SEP) forma parte del Sistema Interconectado Nacional Mexicano (SINM). Para su estudio se utiliza una configuración de un Sistema Máquina Bus Infinito (SMBI), el cual está formado por una unidad generadora equivalente, ...

  16. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    OpenAIRE

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  17. Las dos clases de actividad muscular provocada: la neuromuscular y la idiomuscular. Sinopsis fisiopatológica y clínica

    Directory of Open Access Journals (Sweden)

    Luis Barraquer-Bordas

    1950-12-01

    Full Text Available El autor denomina actividad muscular provocada a la contracción del músculo esquelético subsiguiente a la percusión mediante el martillo de reflejos, Esta actividad es llamada respuesta. Existen dos clases de respuestas: la neuromuscular o refleja, proporcionada por el sistema anatómico y funcional músculo-sistema nervioso-músculo, y la idiomuscular. El autor analiza el concepto de las respuestas reflejas fásicas por tracción muscular provocadas por el método clínico de percusión, refiriéndose a las concepciones de los clásicos, de Wartenberg, de Monrad-Krohn, etc. Expone su visión personal. Describe la respuesta idiomuscular y sus modificaciones clínicas. Estudia el régimen habitual de convivencia clínica entre la respuesta neuromuscular o refleja y la idiomuscular y las modificaciones de este régimen en los estados patológicos. Se refiere en especial ao fenómeno denominado por Barraquer-Roviralta "fenómeno del contraste de la contracción", que aparece en las lesiones de las raíces posteriores - p. ej. en la tabes - y que consiste en la pérdida de la respuesta refleja con exageración de la idiomuscular.

  18. Tolerância a agente curarizante provocada pela administração repetida da droga

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Zanini

    1974-03-01

    Full Text Available Baseados em teoria discutível segundo a qual a miastenia grave é provocada pela presença no sangue de substância curarizante liberada pelo timo, tentou-se reproduzir um modelo experimental. Foram utilizados 40 ratos, criados nas mesmas condições, nascidos no mesmo dia, pesando ao redor de 350 g e divididos em 4 grupos: o Grupo I não foi manuseado; no Grupo II foi injetada solução fisiológica, 1 ml i.p. durante 6 semanas; no Grupo III foi injetada a dimetil tubocurarina (DMT 2,8 mcg/kg i.p., durante o mesmo tempo; no Grupo IV 14 mcg/kg da mesma droga foram injetados i.p. Uma semana após a última injeção i.p. os ratos, anestesiados, foram preparados para registro neuromuscular. O nervo ciático foi estimulado nas freqüências de 0,33 pulsos/seg, 70 pulsos/seg (séries de 10 pulsos a intervalos de 3 seg, 70 pulsos/seg (mantidos por 15 seg e novamente 0,33 pulsos/seg logo após a tetanização. A dose curarizante de DMT foi determinada por uma "terceira parte cega" quando 80% do bloqueio era alcançado. Quando apenas 10 estímulos em alta freqüência foram aplicados ao nervo, foi observada diferença significativa (p<0.05 na resposta: Grupo I, 46,50 ± 20,00 g+; Grupo II, 55,25 ± 11,33 g+; Grupo III, 37,25 ± 10,77 g+; Grupo IV 37,00 ± 12,74 g+. Diferenças significantes de força muscular foram também observadas após a tetanização mantida: Grupo I, 79,00 ± 16,21 g+; Grupo II, 76,75 ± 15,23 g+; Grupo III, 59,12 ± 17,38 g+; Grupo IV, 61,62 ± 14,74 g. Doses significamente mais altas de curare i.v. foram necessárias no grupo injetado diariamente com a maior dose de curare do que em qualquer dos outros grupos (p < 0,01: Grupo I, 3,62 ± 1,17 mcg/kg; Grupo II, 3,69 ± 1,21 mcg/kg; Grupo III, 4,01 ± 0,80 mcg/kg; Grupo IV, 5,48 ± 1,40 mcg/kg. Tais resultados mostram que a administração crônica do curare leva ao enfraquecimento físico e hiposensibilidade à droga. Isto sugere que embora a existência de subst

  19. Interior intrusion detection systems

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, J.R.; Matter, J.C. (Sandia National Labs., Albuquerque, NM (United States)); Dry, B. (BE, Inc., Barnwell, SC (United States))

    1991-10-01

    The purpose of this NUREG is to present technical information that should be useful to NRC licensees in designing interior intrusion detection systems. Interior intrusion sensors are discussed according to their primary application: boundary-penetration detection, volumetric detection, and point protection. Information necessary for implementation of an effective interior intrusion detection system is presented, including principles of operation, performance characteristics and guidelines for design, procurement, installation, testing, and maintenance. A glossary of sensor data terms is included. 36 figs., 6 tabs.

  20. Interior intrusion detection systems

    International Nuclear Information System (INIS)

    The purpose of this NUREG is to present technical information that should be useful to NRC licensees in designing interior intrusion detection systems. Interior intrusion sensors are discussed according to their primary application: boundary-penetration detection, volumetric detection, and point protection. Information necessary for implementation of an effective interior intrusion detection system is presented, including principles of operation, performance characteristics and guidelines for design, procurement, installation, testing, and maintenance. A glossary of sensor data terms is included. 36 figs., 6 tabs

  1. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Science.gov (United States)

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  2. Earth-atmosphere evolution based on new determination of Devonian atmosphere Ar isotopic composition

    Science.gov (United States)

    Stuart, Finlay M.; Mark, Darren F.; Gandanger, Pierre; McConville, Paul

    2016-07-01

    The isotopic composition of the noble gases, in particular Ar, in samples of ancient atmosphere trapped in rocks and minerals provides the strongest constraints on the timing and rate of Earth atmosphere formation by degassing of the Earth's interior. We have re-measured the isotopic composition of argon in the Rhynie chert from northeast Scotland using a high precision mass spectrometer in an effort to provide constraints on the composition of Devonian atmosphere. Irradiated chert samples yield 40Ar/36Ar ratios that are often below the modern atmosphere value. The data define a 40Ar/36Ar value of 289.5 ± 0.4 at K/36Ar = 0. Similarly low 40Ar/36Ar are measured in un-irradiated chert samples. The simplest explanation for the low 40Ar/36Ar is the preservation of Devonian atmosphere-derived Ar in the chert, with the intercept value in 40Ar-39Ar-36Ar space representing an upper limit. In this case the Earth's atmosphere has accumulated only 3% (5.1 ± 0.4 ×1016 mol) of the total 40Ar inventory since the Devonian. The average accumulation rate of 1.27 ± 0.09 ×108 mol40Ar/yr overlaps the rate over the last 800 kyr. This implies that there has been no resolvable temporal change in the outgassing rate of the Earth since the mid-Palaeozoic despite the likely episodicity of Ar degassing from the continental crust. Incorporating the new Devonian atmosphere 40Ar/36Ar into the Earth degassing model of Pujol et al. (2013) provides the most precise constraints on atmosphere formation so far. The atmosphere formed in the first ∼100 Ma after initial accretion during a catastrophic degassing episode. A significant volume of 40Ar did not start to accumulate in the atmosphere until after 4 Ga which implies that stable K-rich continental crust did not develop until this time.

  3. 78 FR 5202 - Notice of Inventory Completion: Arkansas State University Museum, Jonesboro, AR

    Science.gov (United States)

    2013-01-24

    ... National Park Service Notice of Inventory Completion: Arkansas State University Museum, Jonesboro, AR AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Arkansas State University Museum... culturally affiliated with the human remains may contact the Arkansas State University Museum....

  4. 78 FR 5199 - Notice of Inventory Completion: Arkansas State University Museum, Jonesboro, AR

    Science.gov (United States)

    2013-01-24

    ... National Park Service Notice of Inventory Completion: Arkansas State University Museum, Jonesboro, AR AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Arkansas State University Museum... associated funerary objects may contact the Arkansas State University Museum. Repatriation of the...

  5. Cuidados de enfermagem na prevenção da insuficiência renal provocada por contraste após cateterismo Cuidados de enfermagem na prevenção da insuficiência renal provocada por contraste após cateterismo Nursing care in the prevention of renal failure caused by post-catheterism contrast

    Directory of Open Access Journals (Sweden)

    Flavia Giron Camerini

    2008-01-01

    Full Text Available O estudo teve como objetivo identificar produções científicas de enfermagem sobre insuficiência renal aguda provocada por contraste iodado após cateterismo cardíaco, no período de 2002 a 2007, analisando sua aplicabilidade à prática. Foi realizada ainda uma análise crítica das produções científicas selecionadas, delineando os cuidados de enfermagem. Este estudo é uma pesquisa bibliográfica de artigos de enfermagem, encontrados através de busca computadorizada. Dos 47 artigos encontrados, 10 foram selecionados por terem atendido os critérios de inclusão. Após a análise dos artigos, verificamos a importância da atuação do enfermeiro na prevenção da insuficiência renal aguda provocada por contraste. Além disso, evidenciamos a melhor prática de enfermagem para a prevenção da insuficiência renal aguda provocada por contraste.El presente estudio tuvo como objetivo identificar producciones científicas de enfermería sobre la insuficiencia renal aguda provocada por contraste yodado después del cateterismo cardíaco, en el período de 2002 a 2007, analizando su aplicabilidad a la práctica. Se realizó además el análisis crítico de las producciones científicas seleccionadas, delineando los cuidados de enfermería. Este estudio es una investigación bibliográfica de artículos de enfermería, encontrados por medio de búsqueda computarizada. De los 47 artículos encontrados, 10 fueron seleccionados por haber atendido a los criterios de inclusión. Después del análisis de los artículos, verificamos la importancia de la actuación del enfermero en la prevención de la insuficiencia renal aguda provocada por contraste. Además de lo referido, evidenciamos una mejor práctica de enfermería para la prevención de la insuficiencia renal aguda provocada por contraste.The purpose of this study was to identify the nursing scientific production on acute renal failure caused by post-catheterism iodized cardiac contrast

  6. ARS Biodiesel Research Initiatives

    Science.gov (United States)

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  7. The Interior of Saturn

    CERN Document Server

    Fortney, Jonathan J; Nettelmann, Nadine; Stevenson, David J; Marley, Mark S; Hubbard, William B; Iess, Luciano

    2016-01-01

    We review our current understanding of the interior structure and thermal evolution of Saturn, with a focus on recent results in the Cassini era. There has been important progress in understanding physical inputs, including equations of state of planetary materials and their mixtures, physical parameters like the gravity field and rotation rate, and constraints on Saturnian free oscillations. At the same time, new methods of calculation, including work on the gravity field of rotating fluid bodies, and the role of interior composition gradients, should help to better constrain the state of Saturn's interior, now and earlier in its history. However, a better appreciation of modeling uncertainties and degeneracies, along with a greater exploration of modeling phase space, still leave great uncertainties in our understanding of Saturn's interior. Further analysis of Cassini data sets, as well as precise gravity field measurements from the Cassini Grand Finale orbits, will further revolutionize our understanding ...

  8. Department of the Interior

    Science.gov (United States)

    ... Pinterest View info Katahdin Woods and Waters National Monument, the first national monument to preserve the landscape and honor the history ... Outdoors Land and Water Conservation Fund Climate Change Natural Resources Investment Center Reducing Interior's Carbon Footprint Conservation ...

  9. Studies in Interior Design

    Science.gov (United States)

    Environ Planning Design, 1970

    1970-01-01

    Floor plans and photographs illustrate a description of the Samuel C. Williams Library at Stevens Institute of Technology, Hoboken, N.J. The unusual interior design allows students to take full advantage of the library's resources. (JW)

  10. Ars Electronica tulekul / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  11. ARABIC LIGHT STEMMER (ARS

    Directory of Open Access Journals (Sweden)

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  12. Atención médica de lesiones intencionales provocadas por la violencia familiar Medical care of injuries caused intentionally by domestic violence

    Directory of Open Access Journals (Sweden)

    Martha Híjar-Medina

    2003-08-01

    Full Text Available OBJETIVO: Describir y analizar las características de la demanda provocada por lesiones intencionales, en especial las provocadas por violencia familiar en los servicios de urgencias de hospitales públicos de la Ciudad de México. MATERIAL Y MÉTODOS: Se realizó un estudio transversal, en el cual se incluyeron variables relacionadas con el agresor, el agredido y con la atención médica. Se diseñó un cuestionario, que se aplicó durante los meses de enero a abril de 1998 en cuatro hospitales seleccionados. Se realizó un análisis con base en frecuencias simples, ji cuadrado, razón de momios con sus respectivos intervalos de confianza de 95%, y se aplicó modelo de regresión logística ajustado por las variables asociadas con este tipo de demanda. RESULTADOS: De los 598 casos que presentaron lesiones intencionales, 16% correspondió a violencia familiar. Los más afectados fueron el sexo femenino (76%, y jóvenes entre 15 y 29 años de edad (46%. Las variables que se encontraron asociadas con la demanda por lesiones provocadas por violencia familiar, en comparación con otro tipo de violencia, fueron: edad mayor de 30 años (RM 2.36, IC 95% 1.13-4.90, sexo femenino (RM 8.60, IC 95%/4.25-17.40 antecedentes de lesiones previas (RM 4.93, IC 95% 2.03-11.95, el hogar como lugar de ocurrencia (RM 36.25, IC 95% 16.598-79.18 y escolaridad primaria o menos (RM 2.33, IC 95% 1.03-5.26. CONCLUSIONES: Los resultados encontrados coinciden con reportes de otros estudios sobre el tema, y son de gran utilidad como antecedentes para la aplicación de la Norma Oficial Mexicana para la Atención Médica de la Violencia Familiar, que entró en vigencia en marzo de 2000.OBJECTIVE: To describe and analyze the causes of emergency care services for intentional injuries, especially those caused by domestic violence, at four public hospitals in Mexico City. MATERIAL AND METHODS: A cross-sectional study was conducted between January and April 1998, which included

  13. Understanding Jupiter's Interior

    CERN Document Server

    Militzer, Burkhard; Wahl, Sean M; Hubbard, William

    2016-01-01

    This article provides an overview of how models of giant planet interiors are constructed. We review measurements from past space missions that provide constraints for the interior structure of Jupiter. We discuss typical three-layer interior models that consist of a dense central core and an inner metallic and an outer molecular hydrogen-helium layer. These models rely heavily on experiments, analytical theory, and first-principle computer simulations of hydrogen and helium to understand their behavior up to the extreme pressures ~10 Mbar and temperatures ~10,000 K. We review the various equations of state used in Jupiter models and compare them with shock wave experiments. We discuss the possibility of helium rain, core erosion and double diffusive convection may have important consequences for the structure and evolution of giant planets. In July 2016 the Juno spacecraft entered orbit around Jupiter, promising high-precision measurements of the gravitational field that will allow us to test our understandi...

  14. Prefab-Interiority

    DEFF Research Database (Denmark)

    Frier, Marie; Fisker, Anna Marie; Kirkegaard, Poul Henning

    2010-01-01

    qualities is significantly dependent on our constructive ability to economically and production-technically join building elements. Consequently this paper explores the potential for developing interiority as a theory and design principle for transforming constructive challenges within prefab practice....../S. As a research result the paper suggests a positioning of interiority as a theory and design principle for developing a sensuous prefab practice......., and practical realm of prefabrication, leaving the produced houses as monotonous box-like constructions rather than inhabitable homes. But what are the sensuous qualities actually spatially defining a home, and how to formulate design principles for developing and revealing these qualities within prefab...

  15. Planetary Interiors and Geodesy

    Science.gov (United States)

    Dehant, Veronique

    2013-04-01

    Lander and orbiter, even rover at the surface of planets or moons of the solar system help in determining their interior properties. First of all orbiters feel the gravity of the planet and its change. In particular, the tidal mass redistribution induces changes in the acceleration of the spacecraft orbiting around a planet. The Love number k2 has been determined for Venus, Mars and the Earth, as well as for Titan and will be deduced for instance for Mercury (MESSENGER and BepiColombo missions) and for the Galilean satellite from new missions such as JUICE (Jupiter Icy satellite Explorer). The properties of the interior can also be determined from the observation of the rotation of the celestial body. Radar observation from the Earth ground stations of Mercury has allowed Margo et al. (2012, JGR) to determine the moments of inertia of Mercury with an unprecedented accuracy. Rovers such as the MERs (Mars Exploration Rovers) allow as well to obtain the precession and nutation of Mars from which the moments of inertia of the planet and its core can be deduced. Future missions such as InSIGHT (Interior exploration using Seismic Investigations, Geodesy, and Heat Transport) will further help in the determination of Mars interior and evolution.

  16. Interior Design in Architectural Education

    Science.gov (United States)

    Gurel, Meltem O.; Potthoff, Joy K.

    2006-01-01

    The domain of interiors constitutes a point of tension between practicing architects and interior designers. Design of interior spaces is a significant part of architectural profession. Yet, to what extent does architectural education keep pace with changing demands in rendering topics that are identified as pertinent to the design of interiors?…

  17. b174ar.m77t - MGD77 data file for Geophysical data from field activity B-1-74-AR in Arctic from 07/13/1974 to 08/30/1974

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry, gravity, and magnetics data along with transit satellite navigation data was collected as part of field activity B-1-74-AR in Arctic from...

  18. l977ar.m77t - MGD77 data file for Geophysical data from field activity L-9-77-AR in Arctic from 08/25/1977 to 10/08/1977

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry, magnetics, and gravity data along with transit satellite navigation data was collected as part of field activity L-9-77-AR in Arctic from...

  19. Geological Dating by 40 Ar - 39 Ar method

    International Nuclear Information System (INIS)

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  20. Ecologism in Interior Design

    OpenAIRE

    Ruizhou Liu; Yunkai Xu

    2008-01-01

    With the progress of our mankind, great changes have taken place in economy as well as our society, so have the natural environment and ecological system in which we live. Nowadays, we are faced with decreasing natural environment, forest, species, clean water, air and cultivable land. In addition, some urgent issues such as global warming, exhausted energy and widespread rubbish force us to reflect on our future life style. In this situation, interior designers are expected to introduce ecol...

  1. 40Ar/39Ar age calibration against counted annuallayers

    DEFF Research Database (Denmark)

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  2. Interior of the Moon

    Science.gov (United States)

    Weber, Renee C.

    2013-01-01

    A variety of geophysical measurements made from Earth, from spacecraft in orbit around the Moon, and by astronauts on the lunar surface allow us to probe beyond the lunar surface to learn about its interior. Similarly to the Earth, the Moon is thought to consist of a distinct crust, mantle, and core. The crust is globally asymmetric in thickness, the mantle is largely homogeneous, and the core is probably layered, with evidence for molten material. This chapter will review a range of methods used to infer the Moon's internal structure, and briefly discuss the implications for the Moon's formation and evolution.

  3. 40Ar-39Ar geochronology and thermochronology: principles and potential

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  4. Ars Poetica : [luuletused] / Mats Traat

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  5. Pulsed discharge production Ar* metastables

    Science.gov (United States)

    Han, Jiande; Heaven, Michael C.; Emmons, Daniel; Perram, Glen P.; Weeks, David E.; Bailey, William F.

    2016-03-01

    The production of relatively high densities of Ar* metastables (>1012 cm-3) in Ar/He mixtures, at total pressures close to 1 atm, is essential for the efficient operation of an optically pumped Ar* laser. We have used emission spectroscopy and diode laser absorption spectroscopy measurements to observe the production and decay of Ar* in a parallel plate pulsed discharge. With discharge pulses of 1 μs duration we find that metastable production is dominated by processes occurring within the first 100 ns of the gas break-down. Application of multiple, closely spaced discharge pulses yields insights concerning conditions that favor metastable production. This information has been combined with time-resolved measurements of voltage and current. The experimental results and preliminary modeling of the discharge kinetics are presented.

  6. Interior design and healing architecture

    DEFF Research Database (Denmark)

    Mogensen, Jeppe; Poulsen, Søren Bolvig; Hansen, Allan Grutt

    2015-01-01

    and materials are rather limited. To compliment research in hospital interior design with particular focus on the use of interior textiles, this pilot study explores if the patients’ preferences for more home-like hospital interiors can be linked to a preference for textile-based furniture and materials...... the interpretation of the quantitative and qualitative data. 21% of the participants requested interior design improvements, and had a pronounced preference for the textile-based furniture and materials. For this particular group, the link between home-like hospital interiors and textile materials were thus......Hospital design is today influenced by the design concept healing architecture, stating that the patients’ healing process is promoted through accommodating physical surroundings. However, despite the increasing amount of research in the field of healing architecture, research on interior design...

  7. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Science.gov (United States)

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  8. Interior design conceptual basis

    CERN Document Server

    Sully, Anthony

    2015-01-01

    Maximizing reader insights into interior design as a conceptual way of thinking, which is about ideas and how they are formulated. The major themes of this book are the seven concepts of planning, circulation, 3D, construction, materials, colour and lighting, which covers the entire spectrum of a designer’s activity. Analysing design concepts from the view of the range of possibilities that the designer can examine and eventually decide by choice and conclusive belief the appropriate course of action to take in forming that particular concept, the formation and implementation of these concepts is taken in this book to aid the designer in his/her professional task of completing a design proposal to the client. The purpose of this book is to prepare designers to focus on each concept independently as much as possible, whilst acknowledging relative connections without unwarranted influences unfairly dictating a conceptual bias, and is about that part of the design process called conceptual analysis. It is assu...

  9. Analysis list: AR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  10. Analysis list: Ar [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscien...cedbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscien

  11. Whole-rock Ar-Ar dating for low-grade metavolcanics within the Dabie orogen and its geological significance

    Institute of Scientific and Technical Information of China (English)

    GAO Tianshan; TANG Jiafu; SANG Haiqing; HU Shiling; QIAN Cunchao

    2006-01-01

    The genetic relationship between low- grade and ultrahigh-pressure (UHP) metamorphic units in the interior of the Dabie orogen has been controversial with respect to preservation of volcanic texture during continental subduction to mantle depths. In order to resolve this issue, whole-rock Ar-Ar dating was carried out for greenschist-facies metatuff that is in contact with UHP eclogite in Yuexi County, Anhui Province. One sample gave a plateau age of 784.4±2.0 Ma and an isochron age of 785.0± 4.7 Ma, and the other sample a plateau age of 770.9± 2.0 Ma and an isochron age of 769.5±3.1 Ma. It appears that the Ar isotopic system was not disturbed since the volcanic eruption at the middle Neoproterozoic. Because of the low closure temperature of Ar diffusion in volcanic rocks, retention of the Neoproterozoic ages indicates that the low-grade metavolcanics did not experience high-grade metamorphism up to eclogite-facies conditions during the Triassic subduction of continental crust. Furthermore, the Neoproterozoic Ar-Ar ages are also in agreement with protolith ages of UHP metaigneous rocks in the Dabie orogen. Therefore, the metatuff is interpreted as a tectonic relict that was scraped off during the Triassic subduction and thus was not subducted to mantle depths like the adjacent eclogite. This lends support to the model for crustal detachment between cover and basement during continental collision. A tectonic mélange model is proposed to explain the occurrence of contrasting grades of metamorphic rock within the UHP metamorphic zone.

  12. 40Ar/39Ar dating of Daqingshan thrust

    Institute of Scientific and Technical Information of China (English)

    LIU Zhenghong; XU Zhongyuan; YANG Zhensheng

    2003-01-01

    The Daqingshan thrust system, to the south of the Shiguai Mesozoic basin, is a complex system of top-to- the-north thrusting tectonic sheets. The thrust system has a complicated evolution due to multi-stage thrusting. In order to date the thrusting events, syntectonic muscovite and biotite grains are respectively analyzed with normal 40Ar/39Ar dating and laser 40Ar/39Ar dating, which yield 2 isochron ages, i.e. 193.74 ± 3.88 Ma and 121.6 ± 1.6 Ma. These ages suggest that faults within the Daqingshan thrust system formed during 2 stages of thrusting, one the early Indosinian and the other the late Yanshanian. The isotopic dating is consistent with field geological relations. Indosinan deformation is evidenced by top-to-the-north thrusting, with the occurrence of a series of large-scale east-west trending thrust faults and folds, while the Yanshanian thrusting is characterized by top-to-the-NNW thrusting. It is superposed on and modifies early Indosinian thrust faults.

  13. "Ars Electronica 2009" / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  14. AR DOC: Augmented reality documentaries

    DEFF Research Database (Denmark)

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  15. Graviatoms with de Sitter Interior

    Directory of Open Access Journals (Sweden)

    Irina Dymnikova

    2013-01-01

    Full Text Available We present a graviatom with de Sitter interior as a new candidate to atomic dark matter generically related to a vacuum dark energy through its de Sitter vacuum interior. It is a gravitationally bound quantum system consisting of a nucleus represented by a regular primordial black hole (RPBH, its remnant or gravitational vacuum soliton G-lump, and a charged particle. We estimate probability of formation of RPBHs and G-lumps in the early Universe and evaluate energy spectrum and electromagnetic radiation of graviatom which can in principle bear information about a fundamental symmetry scale responsible for de Sitter interior and serve as its observational signatures.

  16. Mirador - Earth Surface and Interior

    Data.gov (United States)

    National Aeronautics and Space Administration — Earth Science data access made simple. The goal of the Earth Surface and Interior focus area is to assess, mitigate and forecast the natural hazards that affect...

  17. Desain Interior Gedung Kesenian Jakarta

    Directory of Open Access Journals (Sweden)

    Sri Rachmayanti

    2011-03-01

    Full Text Available The purpose of this study was to examine the interior design of Gedung Kesenian Jakarta in detail. Another thing is to obtain complete data and analyze the interior design development of GKJ. This study will described in terms of design style and different designs since the early period of this building, the arrival of the Dutch until the present era. Besides aesthetic of interior design, it will review technical factors in the building that related to its interior design, such as acoustic, air conditioning, lighting system, sound system. This research is based on data literartures and interviews with the GKJ. In conclusion, it will discuss the existence of GKJ in relation to local identity, culture and heritage.

  18. How Technology Influences Interior Design.

    Science.gov (United States)

    McDavitt, Tish

    1999-01-01

    Examines telecommunication technology's influences on interior school design and effective learning, and discusses how to implement this technology into the school. Building the infrastructure to support telecommunications in an educational setting and the importance of effective lighting are discussed. (GR)

  19. La temperatura del interior de la tierra

    Directory of Open Access Journals (Sweden)

    Eslava R. Jesús A.

    1993-10-01

    Full Text Available AR-SA;" lang="EN-US">The problem of defining the Earth interior temperature is analized from Heat Flow observations and the acceptance of convection processes in the mantle. Comparative analyses of thermal, adiabatic, and melting point profiles, allow to obtain the optimum temperature profile, wich fits the seismic model of a liquid external core.

    EI problema de definir la temperatura del interior de la Tierra, se analiza a partir de las observaciones del flujo térmico y la aceptación de procesos de convección en el manto.

    Análisis comparativos de perfiles térmicos, adiabáticos y de puntos de fusión, permiten obtener un perfil óptimo de distribución de temperaturas, que además satisface la observación sísmica de un núcleo externo líquido.

  20. Linear waves in the interior of extremal black holes II

    CERN Document Server

    Gajic, Dejan

    2015-01-01

    We consider solutions to the linear wave equation in the interior region of extremal Kerr black holes. We show that axisymmetric solutions can be extended continuously beyond the Cauchy horizon and moreover that, if we assume suitably fast polynomial decay in time along the event horizon, their local energy is finite. We also extend these results to non-axisymmetric solutions on slowly rotating extremal Kerr-Newman black holes. These results are the analogues of results obtained in [D. Gajic, Linear waves in the interior of extremal black holes I, arXiv:1509.06568] for extremal Reissner-Nordstr\\"om and stand in stark contrast to previously established results for the subextremal case, where the local energy was shown to generically blow up at the Cauchy horizon.

  1. Tolerância a agente curarizante provocada pela administração repetida da droga Tolerance to curarizing drug induced by chronic administration: an experimental study

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Zanini

    1974-03-01

    Full Text Available Baseados em teoria discutível segundo a qual a miastenia grave é provocada pela presença no sangue de substância curarizante liberada pelo timo, tentou-se reproduzir um modelo experimental. Foram utilizados 40 ratos, criados nas mesmas condições, nascidos no mesmo dia, pesando ao redor de 350 g e divididos em 4 grupos: o Grupo I não foi manuseado; no Grupo II foi injetada solução fisiológica, 1 ml i.p. durante 6 semanas; no Grupo III foi injetada a dimetil tubocurarina (DMT 2,8 mcg/kg i.p., durante o mesmo tempo; no Grupo IV 14 mcg/kg da mesma droga foram injetados i.p. Uma semana após a última injeção i.p. os ratos, anestesiados, foram preparados para registro neuromuscular. O nervo ciático foi estimulado nas freqüências de 0,33 pulsos/seg, 70 pulsos/seg (séries de 10 pulsos a intervalos de 3 seg, 70 pulsos/seg (mantidos por 15 seg e novamente 0,33 pulsos/seg logo após a tetanização. A dose curarizante de DMT foi determinada por uma "terceira parte cega" quando 80% do bloqueio era alcançado. Quando apenas 10 estímulos em alta freqüência foram aplicados ao nervo, foi observada diferença significativa (pThe trial is a temptative experimental model of myasthenia gravis based on a doubtful theory whereby this disease is atributed to circulating curare in blood. Forty rats kept under the same conditions, bom on the same day and weighing around 350 g entered the trial, divided in four groups. Group I was not handled, Group II was injected with saline, 1 ml i.p. Group III was submitted to dimethyl tubocurarine iodide (DMT 2,8 mcg/kg i.p. and Group IV received 14 mcg/kg, all solutions being administered daily for a six-week period. One week after the last rats were anesthetized and prepared for cyatic-gastrocnemius neuro-muscular recording. Monopolar pulses were given at frequencies of 0.33 p/sec, 70 p/sec, (trains of 10 pulses at 3 sec intervals, 70 p/sec (kept for 15 sec and again 0.33 p/sec right after tetanus. Curarizing

  2. ARS - Helsinki - 2006 / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  3. Ars Industrialis, arsindustrialis.org

    Directory of Open Access Journals (Sweden)

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  4. Efecto de la administración subcrónica de glucosamina oral en la regulación del peso corporal, glucemia y dislipidemias provocada por una dieta hipercalórica en rata Wistar

    Directory of Open Access Journals (Sweden)

    Cornelio Barrientos Alvarado

    2014-12-01

    Full Text Available Objetivo: Este estudio evaluó el efecto de la glucosamina oral en el sobrepeso y dislipidemia provocada por una dieta hipercalórica en ratas. Métodos: En 4 grupos de ratas Wistar: alimentados con dieta comercial para roedores y agua de beber sin grupo de control y con glucosamina (500 mg/kg-1 por día grupo glucosamina y con dieta hipercalórica enriquecida al 24% (g/g compuesta por manteca de cerdo y agua de beber sin grupo hipercalórico y con glucosamina grupo hipercalórico + grupo glucosamina, durante 22 semanas, se evaluaron el peso corporal, grasa abdominal, niveles de glucemia, triglicéridos, colesterol total y lipoproteínas de alta densidad en suero. Resultados: Se observó un aumento del peso corporal y glucemia en suero con dislipidemias en el grupo con dieta hipercalórica grupo hipercalórico versus grupo de controle (p0.05 y regulándose el peso corporal, las lipoproteínas de alta densidad y la glucemia basal (p<0.05. Conclusion: La glucosamina reguló el peso corporal y la glucemia en sangre y minimizó las dislipidemias provocadas por la dieta hipercalórica, favoreciendo el aumento de colesterol lipoproteínas de alta densidad en las ratas. No afectó el peso corporal y el metabolismo lipídico cuando se administró con dieta comercial.

  5. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  6. Occurrences of Excess 40Ar in Hydrothermal Tourmaline:Interpretations from 40Ar-39Ar Dating Results by Stepwise Heating

    Institute of Scientific and Technical Information of China (English)

    QIU Huaning; PU Zhiping; DAI Tongmo

    2007-01-01

    The occurrences of excess 40Ar within a hydrothermal tourmaline is discussed in term of the analysis data of syngenetic muscovite and tourmaline from the Lushui hydrothermal tin-tungsten deposit in western Yunnan, China, using the 40Ar-39Ar stepwise heating technique. About 80% excess 40Ar was released in the last step when the tourmaline was fused, corresponding to a release of only ~3% 39Ar (K), which indicates that most excess 40Ar was held in the mineral lattice rather than in the channels parallel to the Z-axis. This suggests that the excess 40Ar was incorporated during crystallization and not diffused into the tourmaline during the post-crystallization history.

  7. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian;

    2011-01-01

    , but more precise (±0.10%) than, the previous 40Ar/39Ar age determined by intercalibration with astronomically tuned tephras from the Melilla Basin (Morocco). Using this proposed age for FCs, combined with measurements using the A1Ts as the neutron fluence monitor, a weighted mean Bishop Tuff 40Ar/39Ar...

  8. Variational Principle for Planetary Interiors

    Science.gov (United States)

    Zeng, Li; Jacobsen, Stein B.

    2016-09-01

    In the past few years, the number of confirmed planets has grown above 2000. It is clear that they represent a diversity of structures not seen in our own solar system. In addition to very detailed interior modeling, it is valuable to have a simple analytical framework for describing planetary structures. The variational principle is a fundamental principle in physics, entailing that a physical system follows the trajectory, which minimizes its action. It is alternative to the differential equation formulation of a physical system. Applying the variational principle to the planetary interior can beautifully summarize the set of differential equations into one, which provides us some insight into the problem. From this principle, a universal mass-radius relation, an estimate of the error propagation from the equation of state to the mass-radius relation, and a form of the virial theorem applicable to planetary interiors are derived.

  9. Variational Principle for Planetary Interiors

    CERN Document Server

    Zeng, Li

    2016-01-01

    In the past few years, the number of confirmed planets has grown above 2000. It is clear that they represent a diversity of structures not seen in our own solar system. In addition to very detailed interior modeling, it is valuable to have a simple analytical framework for describing planetary structures. Variational principle is a fundamental principle in physics, entailing that a physical system follows the trajectory which minimizes its action. It is alternative to the differential equation formulation of a physical system. Applying this principle to planetary interior can beautifully summarize the set of differential equations into one, which provides us some insight into the problem. From it, a universal mass-radius relation, an estimate of error propagation from equation of state to mass-radius relation, and a form of virial theorem applicable to planetary interiors are derived.

  10. Dewatering tailings impoundments : interior drains

    International Nuclear Information System (INIS)

    For the design of a new uranium tailings impoundment in the western United States, it was proposed that an interior drainage system be considered to economically and reliably minimize potential short- and long-term environmental impacts. The objectives were to decrease the effective hydraulic head on the clay liner, to dewater and stabilize the tailings, and to increase the amount of water recycled to the mill. In addition, desaturation of the impoundment would induce capillary pressure (negative porewater pressure), further reducing the potential movement of dissolved pollutants. This paper presents saturated and unsaturated seepage principles and reviews the concept, criteria and design of the various interior drainage systems considered

  11. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Directory of Open Access Journals (Sweden)

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  12. Newly combined 40Ar/39Ar and U-Pb ages of the Upper Cretaceous timescale from Hokkaido, Japan

    Science.gov (United States)

    Gaylor, J. R.; Heredia, B. D.; Quidelleur, X.; Takashima, R.; Nishi, H.; Mezger, K.

    2011-12-01

    The main targets for GTS next project (www.gtsnext.eu) are to develop highly refined geological time scales, including the Upper Cretaceous. The Cretaceous period is characterised by numerous global anoxic events in the marine realm, rich ammonitic fossil assemblages and specialised foraminifera. However, lack of age diagnostic macro and micro fossils in the North Pacific sections has made it difficult to link these with global sections such as the Western Interior Basin (North America). Using advances with terrestrial C-isotope and planktic foraminifera records within Central Hokkaido we are able to correlate these sections globally. The Cretaceous Yezo group in Central Hokkaido comprises deep marine mudstones and turbidite sandstones interbedded with acidic volcanic tuffs. Using various sections within the Yezo group, we radiometrically dated tuffs at the main stage boundaries in the Upper Cretaceous. The samples derive from the Kotanbetsu, Shumarinai, Tiomiuchi and the Hakkin river sections, spanning the time from the Albian-Cenomanian up until the Campanian-Santonian boundaries, and were dated using 40Ar/39Ar, K/Ar and U-Pb techniques. Recent age constraints in the Hokkaido counterparts (Kotanbetsu sections) show good coherence between radiometric chronometers on the various Upper Cretaceous stage boundaries. These additional ages together with our isotope ages from the different sections around the Hokkaido basin are well linked by the various faunal assemblages and C-isotope curves. The combined radio isotope ages contribute to previous attempts (such as those focused in the Western Interior Basin) supporting the synchronicity of events such as global oceanic anoxic events. Finally, the ages obtained here also compliment the previous C-isotope and planktic foraminifera records allowing for a more precise climatic history of the Northwest Pacific during the Cretaceous. The research within the GTSnext project is funded by the European Community's Seventh

  13. PF-AR upgrading project

    CERN Document Server

    Kasuga, T

    2002-01-01

    The upgrading project of the dedicated pulse X-ray source PF-AR has been completed by the end of the 2001 fiscal year. Machine commissioning exclusively using the injector linac was successfully accomplished in the beginning of January 2002. After fine tuning of the machine and cleaning of the vacuum system with the beams from the middle of January to the middle of March, routine operation for users has begun in April. The historical details, commissioning and results of the project are reported. (author)

  14. Interior Design: Challenges and Solutions.

    Science.gov (United States)

    School Planning and Management, 1999

    1999-01-01

    Presents solutions to architectural challenges in school interior design; these solutions made the indoor environments more conducive and attractive for learning. Addresses four challenges: making a long corridor look less like a tunnel; maintaining tradition and minimizing cost in a new athletic facility; designing a kindergarten that is secure…

  15. Interior Design: Teacher's Instructional Guide.

    Science.gov (United States)

    Hays, Tricia

    This teacher's instructional guide, which is part of a family and consumer sciences education series focusing on a broad range of employment opportunities, is intended to assist teachers responsible for teaching one- and two-year interior design programs for Texas high school students. The following are among the items included: (1) introductory…

  16. Interior Design Trends in Libraries.

    Science.gov (United States)

    Sager, Don, Ed.

    2000-01-01

    Four contributing authors discuss perspectives on current trends in library interior design. Articles include: "Trends in Library Furnishings: A Manufacturer's Perspective" (Andrea Johnson); "Libraries, Architecture, and Light: The Architect's Perspective" (Rick McCarthy); "The Library Administrator's Perspective" (Chadwick Raymond); and "The…

  17. 40Ar/39Ar dating of the Late Cretaceous

    International Nuclear Information System (INIS)

    As part of the wider European GTS Next project, I propose new constraints on the ages of the Late Cretaceous, derived from a multitude of geochronological techniques, and successful stratigraphic interpretations from Canada and Japan. In the Western Canada Sedimentary Basin, we propose a new constraint on the age of the K/Pg boundary in the Red Deer River section (Alberta, Canada). We were able to cyclo-stratigraphically tune sediments in a non-marine, fluvial environment utilising high-resolution proxy records suggesting a 11-12 precession related cyclicity. Assuming the 40Ar/39Ar method is inter-calibrated with the cyclo-stratigraphy, the apparent age for C29r suggests that the K/Pg boundary falls between eccentricity maxima and minima, yielding an age of the C29r between 65.89 ± 0.08 and 66.30 ± 0.08 Ma. Assuming that the bundle containing the coal horizon represents a precession cycle, the K/Pg boundary is within the analytical uncertainty of the youngest zircon population achieving a revised age for the K/Pg boundary as 65.75 ± 0.06 Ma. The Campanian - Maastrichtian boundary is preserved in the sedimentary succession of the Horseshoe Canyon Formation and has been placed 8 m below Coal nr. 10. Cyclo-stratigraphic studies show that the formation of these depositional sequences (alternations) of all scales are influenced directly by sea-level changes due to precession but more dominated by eccentricity cycles proved in the cyclo-stratigraphic framework and is mainly controlled by sand horizons, which have been related by auto-cyclicity in a dynamic sedimentary setting. Our work shows that the Campanian - Maastrichtian boundary in the Western Canada Sedimentary Basin coincides with 2.5 eccentricity cycles above the youngest zircon age population at the bottom of the section and 4.9 Myr before the Cretaceous - Palaeogene boundary (K/Pg), and thus corresponds to an absolute age of 70.65 ± 0.09 Ma producing an 1.4 Myr younger age than recent published ages

  18. Ars discendi, ars docendi : programme Pascal

    OpenAIRE

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  19. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    DEFF Research Database (Denmark)

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian....... XRD-data indicated that some mineral separates prepared for Ar-Ar stepwise heating analysis were monomineralic, whereas others were composed of two white micas (muscovite with paragonite or margarite), or biotite and chlorite. In monomineralic samples 37Ar/39Ar and 38Ar/39Ar (proportional to Ca....../K and Cl/K ratios) did not change and the resulting ages can be interpreted unambiguously. In mineral separates containing two white micas, Ca/K and Cl/K ratios were variable, reflecting non-simultaneous laboratory degassing of the two heterochemical Ar-reservoirs. These ratios were used to identify each...

  20. l676ar.m77t - MGD77 data file for Geophysical data from field activity L-6-76-AR in Arctic from 08/27/1976 to 09/03/1976

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry, gravity, and magnetic data along with DGPS navigation data was collected as part of field activity L-6-76-AR in Arctic from 08/27/1976 to...

  1. k177ar.m77t - MGD77 data file for Geophysical data from field activity K-1-77-AR in Beaufort Sea, Arctic from 07/15/1977 to 08/25/1977

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-1-77-AR in Beaufort Sea, Arctic from 07/15/1977 to 08/25/1977,...

  2. k482ar.m77t - MGD77 data file for Geophysical data from field activity K-4-82-AR in Arctic from 09/13/1982 to 10/10/1982

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-4-82-AR in Arctic from 09/13/1982 to 10/10/1982,...

  3. k279ar.m77t - MGD77 data file for Geophysical data from field activity K-2-79-AR in Prudhoe Bay, Alaska, Arctic from 08/25/1979 to 09/23/1979

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-2-79-AR in Prudhoe Bay, Alaska, Arctic from 08/25/1979 to...

  4. k179ar.m77t - MGD77 data file for Geophysical data from field activity K-1-79-AR in Prudhoe Bay, Alaska, Arctic Ocean from 07/23/1979 to 08/20/1979

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-1-79-AR in Prudhoe Bay, Alaska, Arctic Ocean from 07/23/1979...

  5. k176ar.m77t - MGD77 data file for Geophysical data from field activity K-1-76-AR in Arctic from 07/24/1976 to 09/26/1976

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-1-76-AR in Arctic from 07/24/1976 to 09/26/1976,...

  6. k283ar.m77t - MGD77 data file for Geophysical data from field activity K-2-83-AR in Arctic and Beaufort Sea, Alaska from 08/05/1983 to 08/22/1983

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-2-83-AR in Arctic and Beaufort Sea, Alaska from 08/05/1983 to...

  7. l678ar.m77t - MGD77 data file for Geophysical data from field activity L-6-78-AR in Arctic from 08/26/1978 to 09/20/1978

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry and gravity data along with DGPS navigation data was collected as part of field activity L-6-78-AR in Arctic from 08/26/1978 to 09/20/1978,...

  8. k382ar.m77t - MGD77 data file for Geophysical data from field activity K-3-82-AR in Arctic from 08/25/1982 to 09/08/1982

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-3-82-AR in Arctic from 08/25/1982 to 09/08/1982,...

  9. k281ar.m77t - MGD77 data file for Geophysical data from field activity K-2-81-AR in Arctic from 08/04/1981 to 08/07/1981

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-2-81-AR in Arctic from 08/04/1981 to 08/07/1981,...

  10. k178ar.m77t - MGD77 data file for Geophysical data from field activity K-1-78-AR in Barrows to Pt. Barrows, Arctic from 08/18/1978 to 09/18/1978

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-1-78-AR in Barrows to Pt. Barrows, Arctic from 08/18/1978 to...

  11. k183ar.m77t - MGD77 data file for Geophysical data from field activity K-1-83-AR in Arctic from 07/22/1983 to 08/03/1983

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-1-83-AR in Arctic from 07/22/1983 to 08/03/1983,...

  12. g176ar.m77t - MGD77 data file for Geophysical data from field activity G-1-76-AR in Arctic from 09/07/1976 to 10/02/1976

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity G-1-76-AR in Arctic from 09/07/1976 to 10/02/1976,...

  13. INTERIORITY - a prefab case study

    DEFF Research Database (Denmark)

    Hvejsel, Marie Frier

    been motivated by the particular hypothesis that an introduction of the notion of interiority, as an ability of the spatial envelope itself to address the sensuous scale of furniture, unfolds a particular dual critical potential signifying our experience of domestic architectural quality: On the one...... an interrelation of the functional and emotional dimensions of furniture and envelope as form, with the necessary economy and logic of construction, can be developed as a critical architctural theory for transforming the technical and economical elements of construction into experiences of interiority within...... of furnishing ‘gestures’ requiring of the envelope itself to guide, reveal, cover, caress and embrace us. These ‘gestures’ unite function and emotion by describing at once a physical movement and a feeling which is intrinsic of the spatial envelope itself. - The explanatory level has resulted in the development...

  14. Functional textiles in hospital interiors

    DEFF Research Database (Denmark)

    Mogensen, Jeppe

    This PhD thesis explores the possibilities and design qualities of using functional textiles in the interior of hospital environments, and is the result of a three years collaboration between Aalborg University, Department of Civil Engineering, and VIA University College, VIA Design. The project...... is overall related to the construction of new Danish hospitals, where the design concept healing architecture is introduced in a national context, representing the vision of a promoted healing process of hospitalised patients, supported by design related influence. Past research studies provides evidence...... that the physical environments affect the patients’ level of stress and influence their process of recovery and healing. However, although research in this field of hospital design has increased substantially in recent years, knowledge on the use of new materials and textiles in hospital interiors is still rather...

  15. Ars grammatica de Dionisio Tracio

    Directory of Open Access Journals (Sweden)

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  16. Black Hole: The Interior Spacetime

    CERN Document Server

    Ong, Yen Chin

    2016-01-01

    The information loss paradox is often discussed from the perspective of the observers who stay outside of a black hole. However, the interior spacetime of a black hole can be rather nontrivial. We discuss the open problems regarding the volume of a black hole, and whether it plays any role in information storage. We also emphasize the importance of resolving the black hole singularity, if one were to resolve the information loss paradox.

  17. 40Ar/39Ar Interlaboratory Calibration into the Holocene.

    Science.gov (United States)

    Heizler, M. T.; Jicha, B.; Koppers, A. A. P.; Miggins, D. P.

    2015-12-01

    Advances in 40Ar/39Ar analytical precision for very young rocks requires collaborative efforts amongst argon geochronology labs to demonstrate age reproducibility commensurate with high precision. NM Tech (NMT), the University of Wisconsin (UW) and Oregon State University (OSU) have each dated Quaternary flux monitor standard AC-2 sanidine (~1.185 Ma), a blind sanidine described as being 50-100 ka (BS) and sanidine from the Qixiangshan (QIX) flow (~10 ka), Changbaishan volcano, China. The samples were irradiated in a single package with FC-2 sanidine (28.201 Ma) as the flux monitor and the irradiated material was distributed amongst the labs. Heizler was present during analysis at both OSU and UW and Jicha attended OSU during analysis. Physical presence was key towards gaining understanding of individual protocols and prompted valuable discussions. Analyses were carried out on single crystals using total fusion and/or step heating approaches. Age agreement was achieved within 2s uncertainty that ranged between (0.03-0.3%, 0.13-0.37% and 1.8-2.6%) for AC-2, BS and QIX, respectively. Each lab found AC-2 to vary somewhat beyond a normal distribution and to yield an age relative to FC-2 of ~1.185 Ma that is ~1.3% (~5-10 sigma) lower than some published estimates. A key cause of the variation between this study and previous results may be variable gas pressure equilibration times between extraction line and mass spectrometer coupled with variable choices to estimate time zero by other laboratories. The majority of our efforts concentrated on the QIX sanidine where prior data obtained by our labs revealed a factor of two spread in age (~11 and 23 ka) based on experiments carried out by total fusion and bulk incremental heating. By conducting single crystal age spectrum analysis we were able to mitigate effects of melt inclusion hosted excess argon and xenocrystic contamination towards obtaining analytical agreement with apparent ages near 10 ka. However, philosophical

  18. k185ar.m77t and k185ar.h77t: MGD77T data and header files for single-beam bathymetry data for field activity K-1-85-AR in the Arctic from 09/04/1985 to 09/04/1985

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with SINS navigation data was collected as part of the U.S. Geological Survey cruise K-1-85-AR. The cruise was conducted in the...

  19. p194ar.m77t and p194ar.h77t: MGD77T data and header files for single-beam bathymetry data for field activity P-1-94-AR in Arctic Ocean from 07/25/1994 to 08/30/1994

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with SINS navigation data was collected as part of the U.S. Geological Survey cruise P-1-94-AR. The cruise was conducted in...

  20. Department of the Interior : Bison Conservation Initiative

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This framework for managing bison by the Department of the Interior (DOI) bureaus articulates a basis for improved management of the species and provides a...

  1. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  2. Study of the symbiotic star AR Pavonis

    Directory of Open Access Journals (Sweden)

    C. Quiroga

    2001-01-01

    Full Text Available We present a study of the optical spectra and linear polarization of the eclipsing binary AR Pavonis. The optical spectra were obtained between 1990 and 1998, and polarimetric data between 1995 and 1998. From spectroscopic variations along the orbital motion we analized the nature of the system. Polarimetric studies indicate that AR Pav has intrinsic polarization.

  3. The Coronae of AR Lac

    CERN Document Server

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  4. Revised error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, Pieter

    2015-12-01

    The main advantage of the 40Ar/39Ar method over conventional K-Ar dating is that it does not depend on any absolute abundance or concentration measurements, but only uses the relative ratios between five isotopes of the same element -argon- which can be measured with great precision on a noble gas mass spectrometer. The relative abundances of the argon isotopes are subject to a constant sum constraint, which imposes a covariant structure on the data: the relative amount of any of the five isotopes can always be obtained from that of the other four. Thus, the 40Ar/39Ar method is a classic example of a 'compositional data problem'. In addition to the constant sum constraint, covariances are introduced by a host of other processes, including data acquisition, blank correction, detector calibration, mass fractionation, decay correction, interference correction, atmospheric argon correction, interpolation of the irradiation parameter, and age calculation. The myriad of correlated errors arising during the data reduction are best handled by casting the 40Ar/39Ar data reduction protocol in a matrix form. The completely revised workflow presented in this paper is implemented in a new software platform, Ar-Ar_Redux, which takes raw mass spectrometer data as input and generates accurate 40Ar/39Ar ages and their (co-)variances as output. Ar-Ar_Redux accounts for all sources of analytical uncertainty, including those associated with decay constants and the air ratio. Knowing the covariance matrix of the ages removes the need to consider 'internal' and 'external' uncertainties separately when calculating (weighted) mean ages. Ar-Ar_Redux is built on the same principles as its sibling program in the U-Pb community (U-Pb_Redux), thus improving the intercomparability of the two methods with tangible benefits to the accuracy of the geologic time scale. The program can be downloaded free of charge from

  5. Market Aspects of an Interior Design Program.

    Science.gov (United States)

    Gold, Judy E.

    A project was conducted to evaluate a proposed interior design program in order to determine the marketability (job availability in the field of interior design and home furnishings merchandising) and the feasibility (educational requirements for entrance into the interior design and home furnishings merchandising job market) of the program. To…

  6. State Skill Standards: Housing and Interior Design

    Science.gov (United States)

    Nevada Department of Education, 2008

    2008-01-01

    Meeting the Housing and Interior Design Standards will provide students with skills for personal family life and towards becoming a professional in the interior design field. The mission of Housing and Interior Design education is to prepare students for family life, work life, and careers in the fashion industry by creating opportunities to…

  7. Interior Design Research: A Human Ecosystem Model.

    Science.gov (United States)

    Guerin, Denise A.

    1992-01-01

    The interior ecosystems model illustrates effects on the human organism of the interaction of the natural, behavioral, and built environment. Examples of interior lighting and household energy consumption show the model's flexibility for organizing study variables in interior design research. (SK)

  8. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    CERN Document Server

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  9. 40Ar/39Ar and K-Ar data bearing on the metamorphic and tectonic history of western New England.

    Science.gov (United States)

    Sutter, J.F.; Ratcliffe, N.M.; Mukasa, S.B.

    1985-01-01

    40Ar/39Ar ages of coexisting biotite and hornblende from Proterozoic Y gneisses of the Berkshire and Green Mt massifs, as well as 40Ar/39Ar and K/Ar mineral and whole-rock ages from Palaeozoic metamorphic rocks, suggest that the thermal peaks for the dominant metamorphic recrystallization in western New England occurred 465 + or - 5 m.y. (Taconian). 40Ar/39Ar age data from a poorly-defined terrain along the eastern strip of the area suggests that the area has been retrograded during a metamorphism that peaked at least 376 + or - 5 m.y. (Acadian). Available age and petrological data from western New England indicate the presence of at least three separate metamorphic-structure domains of Taconic age: 1) a small area of relict high-P and low-T metamorphism, 2) a broad area of normal Barrovian metamorphism from chlorite to garnet grade characterized by a gentle metamorphic gradient and, 3) a rather narrow belt of steep-gradient, Barrovian series metamorphic rocks. Areas of maximum metamorphic intensity within the last domain coincide with areas of maximum crustal thickening in the later stage of Taconic orogeny. -L.di H

  10. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    International Nuclear Information System (INIS)

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  11. Spatial evaluation of Ar-systematics in rocks from the British Channel Islands: a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Sherlock, S.; Kelley, S. P.

    2010-12-01

    The Ar-Ar method is a powerful tool for constraining thermal histories of metamorphic and plutonic rocks, most commonly undertaken on potassium rich mineral separates rather than whole rocks. While this approach usually yields reasonable thermal histories, it is rarely as precise as dating volcanics, and such rocks are also frequently contaminated by excess argon, artificially elevating the Ar-Ar ages. Understanding the evolution of excess argon represents a challenge; whilst it is possible to discern the ‘sink’ as the host mineral now contaminated by excess argon, examining the ‘source’ and ‘transport’ mechanism is more challenging. The approach we have taken here is to combine measurements of potassium rich and potassium poor minerals to understand the argon reservoirs and argon transfer between minerals, grain boundaries and fluids. Considering the system as a whole provides a method for understanding the complete history of the rock and thus assessing any interactions which may impact on the interpretation of ages and thermal history [Kelley, 2002, Chem. Geol. 188]. Here we have studied a series of plutonic and metamorphic basement samples from the British Channel Islands with different ages and post-emplacement histories, namely Icart Gneiss, Perelle Quartz Diorite, L’Ancresse Granodiorite, and Bordeaux Diorite. The formation age of Icart Gneiss is ~2000 Ma [D’Lemos et al., 1990, Geol. Soc. Spec. Pub. 51]. Ar-Ar ages of hornblendes and biotites from quartz diorites on Guernsey and Sark range between 606 and 596 Ma [Dallmeyer et al. 1991, J. Geol. Soc. London 148], whilst U-Pb zircon ages are in the range 710 to 613 Ma [Dallmeyer et al. 1991; Samson & D’Lemos 1998, J. Geol. Soc. London 155; Miller et al. 1999, Tectonophysics 132]. Detailed petrograpic (microscope, electron microprobe) investigations established the crystallization and deformation history of the samples, and revealed that post-magmatic alteration is unevenly distributed. This

  12. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Science.gov (United States)

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  13. Spatial heterogeneity in the radiogenic activity of the lunar interior: Inferences from CHACE and LLRI on Chandrayaan-1

    CERN Document Server

    Sridharan, R; Ahmed, S M; Supriya, Gogulapati; Bhardwaj, Anil; Kamalakar, J A; 10.1016/j.asr.2012.08.005

    2013-01-01

    In the past, clues on the potential radiogenic activity of the lunar interior have been obtained from the isotopic composition of noble gases like Argon. Excess Argon (40) relative to Argon (36), as compared to the solar wind composition, is generally ascribed to the radiogenic activity of the lunar interior. Almost all the previous estimates were based on, 'on-the-spot' measurements from the landing sites. Relative concentration of the isotopes of 40Ar and 36Ar along a meridian by the Chandra's Altitudinal Composition Explorer (CHACE) experiment, on the Moon Impact Probe (MIP) of India's first mission to Moon, has independently yielded clues on the possible spatial heterogeneity in the radiogenic activity of the lunar interior in addition to providing indicative 'antiquity' of the lunar surface along the ground track over the near side of the moon. These results are shown to broadly corroborate the independent topography measurements by the Lunar Laser Ranging Instrument (LLRI) in the main orbiter Chandrayaa...

  14. AR-40 AR-39 Age of an Impact-Melt Lithology in DHOFAR 961

    Science.gov (United States)

    Frasl, B.; Cohen, B. A.; Li, Z.-H.; Jolliff, B.; Korotev, R.; Zeigler, R.

    2016-01-01

    The South Pole-Aitken (SPA) basin is the stratigraphically oldest identifiable lunar basin and is therefore one of the most important targets for absolute age-dating to help understand whether ancient lunar bombardment history smoothly declined or was punctuated by a cataclysm. The SPA basin also has another convenient property, a geochemically distinct interior, unobscured by extensive mare basalt fill. A case has been made for the possible origin of the Dhofar 961 lunar meteorite in the South Pole-Aitken (SPA) basin, based on comparing its composition with Lunar Prospector gamma-ray data for the interior of the SPA basin. Dhofar 961 contains several different impact-melt (IM) lithologies. Jolliff et al. described two classes of mafic impact-melt lithologies, one dominated by olivine (Lithology A) and the other by plagioclase (An 95-96.5) (Lithology B). Broad-beam analyses of these lithologies yielded (is) approximately 14.0 wt% FeO, 11.7 wt% MgO, and 15.4 wt% Al2O3. Lithologies A and B differ by approximately 2.5% Al2O3, 1.5% FeO and 1.5% MgO, consistent with the occurrence of olivine phenocrysts in A and plagioclase clasts in B. Both lithologies are considerably more mafic than the Apollo mafic impact-melt breccias, corresponding to olivine gabbronorite. Joy et al. used U-Pb dating to investigate phosphate fragments in the Dhofar 961 matrix and impact-melt clasts. Matrix phosphates have 4.34 to 4 Ga ages, consistent with ancient KREEP-driven magmatic episodes and Pre-Nectarian ((is) greater than 3.92 Ga). Phosphates found within Dhofar 961 crystalline impact melt breccia clasts range from 4.26 to 3.89 Ga, potentially recording events throughout the basin forming epoch of lunar history. The youngest reset ages in the Dhofar 961 sample represent an upper limit for the time of formation of the meteorite. Joy et al suggested this age represents the final impact that mixed and consolidated several generations of precursor rocks into the Dhofar meteorite group

  15. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  16. Development and Applications of Interior Tomography - Multi-source Interior Tomography for Ultrafast Performance

    OpenAIRE

    Wang, Ge; Ritman, Erik; Ye, Yangbo; Katsevich, Alexander; Yu, Hengyong; Cao, Guohua; Zhou, Otto

    2010-01-01

    Conventional tomography allows excellent reconstruction of an object from non-truncated projections. The long-standing interior problem is to reconstruct an interior ROI accurately only from local projection segments. Interior tomography solves the interior problem with practical knowledge such as a known sub-region or a sparsity model using compressive sensing. Advantages of interior tomography include radiation dose reduction (no x-rays go outside an ROI), scattering artifact suppression (n...

  17. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Science.gov (United States)

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  18. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    Index Scriptorium Estoniae

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  19. Age of the Lava Creek supereruption and magma chamber assembly at Yellowstone based on 40Ar/39Ar and U-Pb dating of sanidine and zircon crystals

    Science.gov (United States)

    Matthews, Naomi E.; Vazquez, Jorge A.; Calvert, Andrew T.

    2015-01-01

    The last supereruption from the Yellowstone Plateau formed Yellowstone caldera and ejected the >1000 km3 of rhyolite that composes the Lava Creek Tuff. Tephra from the Lava Creek eruption is a key Quaternary chronostratigraphic marker, in particular for dating the deposition of mid Pleistocene glacial and pluvial deposits in western North America. To resolve the timing of eruption and crystallization history for the Lava Creek magma, we performed (1) 40Ar/39Ar dating of single sanidine crystals to delimit eruption age and (2) ion microprobe U-Pb and trace-element analyses of the crystal faces and interiors of single zircons to date the interval of zircon crystallization and characterize magmatic evolution. Sanidines from the two informal members composing Lava Creek Tuff yield a preferred 40Ar/39Ar isochron date of 631.3 ± 4.3 ka. Crystal faces on zircons from both members yield a weighted mean 206Pb/238U date of 626.5 ± 5.8 ka, and have trace element concentrations that vary with the eruptive stratigraphy. Zircon interiors yield a mean 206Pb/238U date of 659.8 ± 5.5 ka, and reveal reverse and/or oscillatory zoning of trace element concentrations, with many crystals containing high U concentration cores that likely grew from highly evolved melt. The occurrence of distal Lava Creek tephra in stratigraphic sequences marking the Marine Isotope Stage 16–15 transition supports the apparent eruption age of ∼631 ka. The combined results reveal that Lava Creek zircons record episodic heating, renewed crystallization, and an overall up-temperature evolution for Yellowstone's subvolcanic reservoir in the 103−104 year interval before eruption.

  20. Ars ornata / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  1. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Index Scriptorium Estoniae

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  2. Differential AR algorithm for packet delay prediction

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Different delay prediction algorithms have been applied in multimedia communication, among which linear prediction is attractive because of its low complexity. AR (auto regressive) algorithm is a traditional one with low computation cost, while NLMS (normalize least mean square) algorithm is more precise. In this paper, referring to ARIMA (auto regression integrated with moving averages) model, a differential AR algorithm (DIAR) is proposed based on the analyses of both AR and NLMS algorithms. The prediction precision of the new algorithm is about 5-10 db higher than that of the AR algorithm without increasing the computation complexity.Compared with NLMS algorithm, its precision slightly improves by 0.1 db on average, but the algorithm complexity reduces more than 90%. Our simulation and tests also demonstrate that this method improves the performance of the average end-to-end delay and packet loss ratio significantly.

  3. "Ars Ornata" Mediterrania / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  4. The mass of $^{32}Ar$ and $^{33}Ar$ for fundamental tests

    CERN Document Server

    Blaum, K; Beck, D; Bollen, G; Herfurth, F; Kellerbauer, A G; Kluge, H J; Sauvan, E; Schwarz, S

    2003-01-01

    Masses of the short-lived radionuclides ^32Ar (T_1/2=98 ms) and ^33Ar (T_1/2=173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10_-8 (deltam=1.8 keV) and 1.4 x 10_-8 (deltam=0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaric-multiplet mass equation IMME. Furthermore, the improved accuracy for the mass of ^32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for ^44Ar and ^45Ar, and a 20sigma deviation for ^44Ar from the literature value was found and interpreted.

  5. Interior insulation in existing; Innendaemmung im Bestand

    Energy Technology Data Exchange (ETDEWEB)

    Geburtig, Gerd (ed.)

    2010-07-01

    Within the third expert meeting of the regional German group of the International Association for Science and Technology of Building and Maintenance and Monuments Preservation (WTA, Pfaffenhofen, Federal Republic of Germany) in November 2009 in Weimar (Federal Republic of Germany) the following lectures were held: (a) Interior insulation according to WTA - The leaflet 6-4 (Anatol Worch); (b) Dimensioning of interior insulation (Hartwig M. Kuenzel); (c) Interior insulation in the field of monument conservation (Roswitha Kaiser); (d) Possibilities of interior insulation (Frank Essmann); (e) Interior insulation - everything considered? (Uwe Gronau); (f) Interior insulation - considered under another view (Georg Dittie); (g) Built practice - this is it (Manuela Kramp); (h) Some practical considerations (Klaus Graupner).

  6. Architecture, or the Presence of an Interior

    OpenAIRE

    Hedrick, Martin Joseph

    2014-01-01

    An object or thing with no interiority is sculpture. Architecture begins with the making of an interior. The real character of Architecture is revealed in the distinguishing qualities of the interior: the arrangement of spaces, the heights of the ceilings and the placement of walls, the entrance of light, the colors, the textures, the patterns and the surfaces. Emphasis on and development of these formal elements elevates a work from the world of building into the realm of Architecture. The s...

  7. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    International Nuclear Information System (INIS)

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  8. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  9. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Science.gov (United States)

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  10. Black Hole Interior in Quantum Gravity.

    Science.gov (United States)

    Nomura, Yasunori; Sanches, Fabio; Weinberg, Sean J

    2015-05-22

    We discuss the interior of a black hole in quantum gravity, in which black holes form and evaporate unitarily. The interior spacetime appears in the sense of complementarity because of special features revealed by the microscopic degrees of freedom when viewed from a semiclassical standpoint. The relation between quantum mechanics and the equivalence principle is subtle, but they are still consistent. PMID:26047218

  11. Interior Design Students Perceptions of Sustainability

    Science.gov (United States)

    Stark, Johnnie; Park, Jin Gyu

    2016-01-01

    Purpose: This longitudinal study assessed student perceptions of sustainable design issues in the context of an accredited interior design program. Although literature exists documenting the integration of sustainable strategies into interior design curriculum, more analysis is needed to determine the impact of program experiences on students'…

  12. Black Hole Interior in Quantum Gravity.

    Science.gov (United States)

    Nomura, Yasunori; Sanches, Fabio; Weinberg, Sean J

    2015-05-22

    We discuss the interior of a black hole in quantum gravity, in which black holes form and evaporate unitarily. The interior spacetime appears in the sense of complementarity because of special features revealed by the microscopic degrees of freedom when viewed from a semiclassical standpoint. The relation between quantum mechanics and the equivalence principle is subtle, but they are still consistent.

  13. 14 CFR 121.215 - Cabin interiors.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Cabin interiors. 121.215 Section 121.215 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS..., FLAG, AND SUPPLEMENTAL OPERATIONS Special Airworthiness Requirements § 121.215 Cabin interiors....

  14. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    OpenAIRE

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This is an Operating System Setup Guide. This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  15. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    International Nuclear Information System (INIS)

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  16. A refined astronomically calibrated 40Ar/39Ar age for Fish Canyon sanidine

    NARCIS (Netherlands)

    Rivera, T.A.; Storey, M.; Zeeden, C.; Hilgen, F.J.; Kuiper, K.

    2011-01-01

    Intercalibration between the astronomical and radio-isotopic dating methods provides a means to improving accuracy and reducing uncertainty of an integrated, multi-chronometer geologic timescale. Here we report a high-precision 40Ar/39Ar age for the FishCanyon sanidine (FCs) neutron fluence monitor,

  17. Modeling Augmented Reality User Interfaces with SSIML/AR

    Directory of Open Access Journals (Sweden)

    Arnd Vitzthum

    2006-06-01

    Full Text Available Augmented Reality (AR technologies open up new possibilities especially for task-focused domains such as assembly and maintenance. However, it can be noticed that there is still a lack of concepts and tools for a structured AR development process and an application specification above the code level. To address this problem we introduce SSIML/AR, a visual modeling language for the abstract specification of AR applications in general and AR user interfaces in particular. With SSIML/AR, three different aspects of AR user interfaces can be described: The user interface structure, the presentation of relevant information depending on the user’s current task and the integration of the user interface with other system components. Code skeletons can be generated automatically from SSIML/AR models. This enables the seamless transition from the design level to the implementation level. In addition, we sketch how SSIML/AR models can be integrated in an overall AR development process.

  18. Accurate and precise 40Ar/39Ar dating by high-resolution, multi-collection, mass spectrometry

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie

    analog enabling precise measurement of very small 36Ar signals for accurate correction for atmospheric-derived 40Ar; (iii) higher mass resolution allows pseudo resolution of hydrocarbon isobaric interferences from 36Ar through to 40Ar; (iv) multi-collection, allowing more data to be gathered in a fixed...

  19. Neutrino Capture Reactions on $^{40}$Ar

    CERN Document Server

    Suzuki, Toshio

    2012-01-01

    Gamow-Teller (GT) strength in $^{40}$Ar is studied by shell-model calculations with monopole-based universal intearction, which has tensor components of $\\pi$\\rho$-meson exchanges. Calculated GT strength is found to be consistent with the experimental data obtained by recent ($p, n$) reactions. Neutrino capture cross sections on $^{40}$Ar for solar neutrinos from $^{8}$B are found to be enhanced compared with previous calculations. The reaction cross sections for multipoles other than $0^{+}$ and $1^{+}$ are obtained by random-phase approximation (RPA). Their contributions become important for neutrino energies larger than 50 MeV.

  20. Improved Ar(II) transition probabilities

    OpenAIRE

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  1. AR-扩增实境

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  2. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Science.gov (United States)

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  3. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Science.gov (United States)

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  4. Modification of stearic acid in Ar and Ar-O{sub 2} pulsed DC discharges

    Energy Technology Data Exchange (ETDEWEB)

    Bernardelli, E.A.; Souza, T.; Maliska, A.M.; Kleinjohann, K.J.; Bendo, T. [Federal University of Santa Catarina (UFSC), Florianopolis, SC (Brazil); Mafra, M. [Nancy-Universite (France). Institut Jean Lamour; CNRS, Nancy (France); Belmonte, T. [Federal University of Technology from Parana (UTFPR), Curitiba, PR (Brazil)

    2010-07-01

    Stearic acid (C{sub 1}8H{sub 36}O{sub 2}) was treated into Ar and Ar-O{sub 2}(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O{sub 2} plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O{sub 2} in all states) strongly enhance the etching process with regards to A{sup *} species, regardless of their concentration. After treatment by Ar and Ar-O{sub 2} plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O{sub 2} plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  5. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    International Nuclear Information System (INIS)

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  6. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Science.gov (United States)

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  7. "Ars Dictaminis" and Modern Rhetorical Practice.

    Science.gov (United States)

    Sewell, Ernestine P.

    Although not all the problems of writing are solved by practice in letter writing, a review of the classical texts on "ars dictaminis"--letter writing--creates a strong argument for its increased use as an exercise in college composition classrooms. By incorporating the lessons of dictamen as a device for achieving rhetorical modes--narration,…

  8. 78 FR 9448 - Arkansas Disaster #AR-00061

    Science.gov (United States)

    2013-02-08

    ... ADMINISTRATION Arkansas Disaster AR-00061 AGENCY: U.S. Small Business Administration. ACTION: Notice SUMMARY: This is a Notice of the Presidential declaration of a major disaster for Public Assistance Only for the... Disaster Assistance, U.S. Small Business Administration, 409 3rd Street SW., Suite 6050, Washington,...

  9. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Index Scriptorium Estoniae

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  10. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    International Nuclear Information System (INIS)

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  11. Theoretical prediction on vibrational spectra of [Ar…Ar-H]+

    Institute of Scientific and Technical Information of China (English)

    李巍; 赵新生

    2003-01-01

    Centrosymmetric linear [Ar-H-Ar]+ and asymmetric linear [Ar…Ar-H]+ are two stable configurations of [Ar2H]+. Based on the global potential energy surface of [Ar2H]+ provided by our group recently, we calculated the vibrational spectra of [Ar…Ar-H]+ with total angular momentum J = 0 by time-dependent quantum mechanical method, and the influence of quantum tunneling effect on vibrational spectra was found. With the help of the observation on the eigenstate functions and the modified potential energy surface, assignments were made to the spectra. The strong coupling between the excited bending mode of [Ar-H-Ar]+ and the vibrational states of [Ar…Ar-H]+ was discussed.

  12. Interior of a Schwarzschild black hole revisited

    CERN Document Server

    Doran, R; Lobo, F S N; Crawford, Paulo; Doran, Rosa; Lobo, Francisco S. N.

    2006-01-01

    The Schwarzschild solution has played a fundamental conceptual role in general relativity, and beyond, for instance, regarding event horizons, spacetime singularities and aspects of quantum field theory in curved spacetimes. However, one still encounters the existence of misconceptions and a certain ambiguity inherent in the Schwarzschild solution in the literature. By taking into account the point of view of an observer in the interior of the event horizon, one verifies that new conceptual difficulties arise. In this work, besides providing a very brief pedagogical review, we further analyze the interior Schwarzschild black hole solution. Firstly, by deducing the interior metric by considering time-dependent metric coefficients, the interior region is analyzed without the prejudices inherited from the exterior geometry. We also pay close attention to several respective cosmological interpretations, and briefly address some of the difficulties associated to spacetime singularities. Secondly, we deduce the con...

  13. Seismic View of the Solar Interior

    Indian Academy of Sciences (India)

    H. M. Antia

    2002-03-01

    The interior of the Sun is not directly observable to us. Nevertheless, it is possible to infer the physical conditions prevailing in the solar interior with the help of theoretical models coupled with observational input provided by measured frequencies of solar oscillations. The frequencies of these solar oscillations depend on the internal structure and dynamics of the Sun and from the knowledge of these frequencies it is possible to infer the internal structure as well as the large scale flows inside the Sun, in the same way as the observations of seismic waves on the surface of Earth help us in the study of its interior. With the accumulation of seismic data over the last six years it has also become possible to study temporal variations in the solar interior. Some of these seismic inferences would be described.

  14. Material Ramah Lingkungan untuk Interior Rumah Tinggal

    Directory of Open Access Journals (Sweden)

    Dila Hendrassukma

    2011-03-01

    Full Text Available Housing is one of the biggest contributors in polluting the ozone layer and consuming the natural resources in making one. Home interior takes part in the over-produced material used for covering the interior elements, such as floor, wall, ceiling, and furniture. The article conducting is to study the green aspect of building materials to find alternative material to beautify the house that is not harming the earth. The result is options of eco material to be used in the making of greener home interior. It is materials that can be renewed, recycled, and low in embodied energy. Materials used in home interior have impact to the natures. Thus, awareness in choosing the right material to decorate the house is very important.

  15. Interior Design and Navigation in Virtual Reality

    OpenAIRE

    Tingvall, Jesper

    2015-01-01

    This thesis examined how virtual reality could be used in interior design. The thesis was limited to virtual reality experienced using a head mounted display. The Method was to integrate virtual reality into an existing interior design software called CET Designer. After investigating the available commercial virtual reality hardware and software Oculus SDK and OpenVR was chosen. Unity 3D was used as a prototyping tool for experimenting with different interaction and navigation methods. An use...

  16. Project management in interior design services

    OpenAIRE

    Şahinoglu, Alp

    1997-01-01

    Ankara : Bilkent University, Department of Interior Architecture and Environmental Design and Institute of Fine Arts, 1997. Thesis (Master's) -- Bilkent University, 1997. Includes bibliographical references. In this study, the concept of project management is analyzed within the framework of interior design services. Project management has been defined as the managing and coordination of all human and physical resources, in order to accomplish the predetermined goals (aim of the proj...

  17. Colour-emotion associations in interior spaces

    OpenAIRE

    Helvacıoğlu, Elif

    2011-01-01

    Colour as an effective design tool influences people’s emotions in interior spaces. Depending on the assumption that colour has an impact on human psychology, this study stresses the need for further studies that comprise colour and emotion association in interior space in order to provide healthier spaces for inhabitants. Emotional reactions to colour in a living room were investigated by using self report measure. Pure red, green and blue were chosen to be investigated as ...

  18. Determining building interior structures using compressive sensing

    Science.gov (United States)

    Lagunas, Eva; Amin, Moeness G.; Ahmad, Fauzia; Nájar, Montse

    2013-04-01

    We consider imaging of the building interior structures using compressive sensing (CS) with applications to through-the-wall imaging and urban sensing. We consider a monostatic synthetic aperture radar imaging system employing stepped frequency waveform. The proposed approach exploits prior information of building construction practices to form an appropriate sparse representation of the building interior layout. We devise a dictionary of possible wall locations, which is consistent with the fact that interior walls are typically parallel or perpendicular to the front wall. The dictionary accounts for the dominant normal angle reflections from exterior and interior walls for the monostatic imaging system. CS is applied to a reduced set of observations to recover the true positions of the walls. Additional information about interior walls can be obtained using a dictionary of possible corner reflectors, which is the response of the junction of two walls. Supporting results based on simulation and laboratory experiments are provided. It is shown that the proposed sparsifying basis outperforms the conventional through-the-wall CS model, the wavelet sparsifying basis, and the block sparse model for building interior layout detection.

  19. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Science.gov (United States)

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  20. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    International Nuclear Information System (INIS)

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  1. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    Institute of Scientific and Technical Information of China (English)

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  2. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Science.gov (United States)

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  3. Dicty_cDB: FC-AR02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  4. On concentration of $^{42}$Ar in the Earth's atmosphere

    CERN Document Server

    Barabash, A S

    2016-01-01

    Data from the DBA liquid argon ionization chamber experiment have been used to obtain an estimate on the concentration of $^{42}$Ar in the Earth's atmosphere, $6.8^{+1.7}_{-3.2}\\cdot10^{-21}$ atoms of $^{42}$Ar per atom of $^{40}$Ar corresponding to the $^{42}$Ar activity of $1.2^{+0.3}_{-0.5}$ $\\mu$Bq per cubic meter of air.

  5. High-spin yrast levels of 38Ar

    NARCIS (Netherlands)

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  6. Age of the Lava Creek supereruption and magma chamber assembly at Yellowstone based on 40Ar/39Ar and U-Pb dating of sanidine and zircon crystals

    Science.gov (United States)

    Vazquez, J. A.; Matthews, N. E.; Calvert, A. T.

    2015-12-01

    The last supereruption from the Yellowstone Plateau formed Yellowstone caldera and ejected the >1000 km3 of rhyolite that composes the Lava Creek Tuff (LCT). Tephra from the eruption blanketed much of the western United States, and is a key Quaternary chronostratigraphic marker, in particular for dating deposition of mid-Pleistocene glacial and pluvial deposits in western North America. We performed 40Ar/39Ar dating of single sanidines to delimit eruption age, and ion microprobe U-Pb and trace-element analyses of crystal faces on single zircons to characterize magmatic evolution and date near-eruption crystallization, as well as analyses of crystal interiors to date the interval of zircon crystallization. Sanidines from the two LCT members A and B yield an 40Ar/39Ar isochron date of 631 ± 4 ka (2σ). Crystal faces on zircons from both members yield a weighted mean 206Pb/238U date of 627 ± 6 ka (2σ) and have trace element concentrations that vary with eruptive stratigraphy. Zircon interiors yield a weighted mean 206Pb/238U date of 660 ± 6 ka, and reveal reverse and/or oscillatory zoning of trace element concentrations, with many crystals containing high-U concentrations and dark cathodoluminescence (CL) cores. These crystals with high-U cores are possibly sourced from 'defrosting' of melt-impregnated margins of the growing subvolcanic reservoir. LCT sanidines mirror the variation of zircon composition within the eruptive stratigraphy, with crystals from upper LCT-A and basal LCT-B having bright-CL rims with high Ba concentrations, suggesting late crystallization after addition of less evolved silicic magma. The occurrence of distal LCT in stratigraphic sequences marking the Marine Isotope Stage 16-15 transition supports the apparent eruption age of ca. 631 ka. These results reveal that Lava Creek zircons record episodic heating, renewed crystallization, and an overall up-temperature evolution for Yellowstone's subvolcanic reservoir in the 103-104 year interval

  7. Growth Rate Estimates of Supergene Manganese Nodule by 40Ar/39Ar Isotopic Dating

    Institute of Scientific and Technical Information of China (English)

    Li Jianwei; Vasconcelos P M

    2004-01-01

    Increasing world-class, high-grade, and metals-enriched supergene manganese ore deposits have been discovered in the last two decades, making them more and more economically important. However, data on the timing and duration of their formation are sparse, mainly due to the difficulties extracting datable minerals suited to traditional radiometric dating methods. Hollandite, cryptomelane, coronadite, todorokite, and manjiroite are common manganese oxide minerals in supergene environments. These minerals host potassium of variable amounts from 0.1 wt% to 5.0 wt% in their structural sites. This geochemical property provides possibility to date supergene manganese ores by using K-Ar and 40Ar/39Ar methods. In this study, we perform 40Ar/39Ar dating on a 7.1-cm-thick botryoidal manganese nodule from an ancient weathering profile at Mount Tabor, central Queensland, Australia. Laser microprobe incremental analyses of distinct growth bands, from the inner core through the intermediate bands to the outermost crusts of the nodule, have yielded high quality 40Ar/39Ar ages at 27.3 Ma, 20.9 Ma, 19.2 Ma, and 16.1 Ma, respectively. The age results permit preliminary estimates on the average growth rates of the nodule varying from 4.7×10-3 mm/ka to 7.6×10-3 mm/ka to 9.0×10-3 mm/ka, from the core to the rim. Results of this study are of significance in our understanding of the mode, mechanism, process, and climatic conditions in the formation of supergene manganese ore deposits.

  8. Crater Retention Ages from (4) Vesta Matching Independent Ar-Ar Ages of HED Meteorites

    Science.gov (United States)

    Schmedemann, Nico; Kneissl, Thomas; Ivanov, Boris A.; Michael, Gregory G.; Neukum, Gerhard; Nathues, Andreas; Sierks, Holger; Wagner, Roland; Krohn, Katrin; Le Corre, Lucille; Reddy, Vishnu; Ruesch, Ottaviano; Hiesinger, Harald; Jaumann, Ralf; Raymond, Carol A.; Russell, Christopher T.

    2013-04-01

    In July 2012 the Dawn spacecraft completed its mapping task of the Main Belt asteroid Vesta with a second high altitude mapping orbit. Dawn is now on its way to the dwarf planet (1) Ceres, where it will perform a similar mapping campaign like that at Vesta [1]. The Main Belt is the source region of most impactors in the inner solar system [2,3,4], making it a key region for understanding the early history of our Solar System. In order to determine absolute surface ages from Vesta we derived a crater production function and a chronology function for Vesta. We derived these functions from the respective lunar functions [2] and scaled [5] them to the impact conditions on Vesta [6]. In general we find good agreement between the derived crater production function and the measured crater distribution. However, we also find disagreement between 8 and 15 km crater size, on areas older ~2.2 Ga. Older areas show a steep (~-6 cumulative) slope, which we link to a decaying influence of the vestan collisional family (Vestoids). The lower boundary of 8 km crater size may be explained by fast ejected small spalls and/or a more efficient Yarkovsky effect [7]. This influence is not observed for instance inside the large Rheasilvia basin, which we date with ~2.2 Ga. Since the formation of this basin is believed to be a major source of replenishment of the Vestoids, it's currently observed cratering record is not indicative for the basin formation age in contrast to [8]. The young interior of the Rheasilvia basin is likely a result of repeated resets of the crater retention age due to mass wasting processes on the basin walls. We use topographic heights, which are less affected by mass wasting such as the top of the central peak of the basin as well as proximal ejecta blankets outside the basin to date the formation age of Rheasilvia. For the central peak we derive a surface age of 3.59 (+0.079/-0.18) Ga. The proximal ejecta blanket at the Oppia crater is dated with 3.62 (+0

  9. Antarlides: A New Type of Androgen Receptor (AR) Antagonist that Overcomes Resistance to AR-Targeted Therapy.

    Science.gov (United States)

    Saito, Shun; Fujimaki, Takahiro; Panbangred, Watanalai; Igarashi, Yasuhiro; Imoto, Masaya

    2016-02-18

    Prostate cancer is treated with androgen receptor (AR) antagonists but most patients experience disease progression after long-term treatment with these compounds. Therefore, new AR antagonists are required for patient follow-up treatment. In the course of screening for a new AR antagonist, we isolated the novel compounds antarlides A-E (1-5) from Streptomyces sp. BB47. Antarlides are mutually isomeric with respect to the double bond and have a 22-membered-ring macrocyclic structure. The full stereostructure of 1 was established by chemical modifications, including methanolysis, the Trost method, acetonide formation, and the PGME method. 1-5 inhibited the binding of androgen to ARs in vitro. In addition, 2 inhibited the transcriptional activity of not only wild-type AR but also mutant ARs, which are seen in patients with acquired resistance to clinically used AR antagonists. Therefore, antarlides are a potent new generation of AR antagonists that overcome resistance.

  10. Tracking fluid action in Little Sark Pluton (Channel Islands, UK): a UV laserprobe Ar/Ar study of excess 40Ar

    Science.gov (United States)

    Schwenzer, S. P.; Schwanethal, J.; Tindle, A. G.; Kelley, S. P.; Sherlock, S. C.

    2011-12-01

    Little Sark pluton (Channel Islands, UK) is a weakly to moderately deformed pluton of quartz diorite composition. Zircon from Little Sark has been dated as 611.4(+2.1/-1.3) Ma [Miller et al. 1991, Tectonophysics, 312], whereas titanite has an age of 606.2±0.6 Ma. Hornblende yields an Ar-Ar age of 606.4±3.4 Ma [Dallmeyer et al., 1991, J. Geol. Soc. London 148]. The rocks show evidence for post-magmatic hydrous alteration including chloritisation of biotite, and sericite formation in feldspar. We investigated the alteration in order to understand its influence on the Ar-Ar system. Detailed petrographic investigations of two samples indicate different deformation levels - S1, (less deformed), and S2 (more deformed). The feldspar is andesine to oligoclase in composition, but contains K-rich areas with patchy and sometimes cleavage guided sericitization. Mafic minerals include hornblende and biotite (the latter partially chloritized). Ar-Ar investigations were carried out using high spatial resolution UV laser ablation gas release in combination with a Nu instruments Noblesse gas mass spectrometer using spots of 80 to 140 μm diameter. Mafic minerals in S1 have highly variable 38Ar/39Ar and 37Ar/39Ar ratios and unusually high atmospheric contents for such old samples, possibly reflecting the presence of fluid inclusions associated with the sericite, particularly in the feldspar. The apparent ages in their entirety range from 429 to 668 Ma. Hornblende yields homogeneous apparent ages, whereas the younger and older ages are measured in both micas and feldspars, whose apparent ages range from 245-670 Ma. The modal age for feldspar is around 400-450 Ma, but this may not have geological meaning. Sample S2 shows many of the same features as S1. Mafic minerals span a slightly smaller age range and feldspars display apparent ages of ~245-645 Ma with a mode around 480 Ma. The alteration of both samples appears to have been accompanied by the introduction of 40Ar-rich fluids

  11. Interior design. Mastering the master plan.

    Science.gov (United States)

    Mesbah, C E

    1995-10-01

    Reflecting on the results of the survey, this proposed interior design master planning process addresses the concerns and issues of both CEOs and facility managers in ways that focus on problem-solving strategies and methods. Use of the interior design master plan process further promotes the goals and outcomes expressed in the survey by both groups. These include enhanced facility image, the efficient selection of finishes and furnishings, continuity despite staff changes, and overall savings in both costs and time. The interior design master plan allows administrators and facility managers to anticipate changes resulting from the restructuring of health care delivery. The administrators and facility managers are then able to respond in ways that manage those changes in the flexible and cost-effective manner they are striving for. This framework permits staff members to concentrate their time and energy on the care of their patients--which is, after all, what it's all about.

  12. Dicty_cDB: FC-AR12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  13. Dicty_cDB: FC-AR03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  14. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    CERN Document Server

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  15. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Science.gov (United States)

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  16. Planetary deep interiors, geodesy, and habitability

    Science.gov (United States)

    Dehant, Veronique

    2014-05-01

    The evolution of planets is driven by the composition, structure, and thermal state of their internal core, mantle, lithosphere, crust, and by interactions with possible ocean and atmosphere. This presentation puts in perspective the fundamental understanding of the relationships and interactions between those different planetary reservoirs and their evolution through time. It emphasizes on the deep interior part of terrestrial planets and moons. The core of a planet, when composed of liquid iron alloy, may provide magnetic field and further interaction with the magnetosphere, ingredients believed to be important for the evolution of an atmosphere and of a planet in general. The deep interior is believed to be of high importance for its habitability. Lander and orbiter, even rover at the surface of planets or moons of the solar system help in determining their interior properties. First of all orbiters feel the gravity of the planet and its variations. In particular, the tidal mass redistribution induces changes in the acceleration of the spacecraft orbiting around a planet. The Love number k2 has been determined for Venus, Mars, and the Earth, as well as for Titan and will be deduced for Mercury and for some of the Galilean satellites from new missions such as JUICE (Jupiter Icy satellite Explorer). The properties of the interior can also be determined from the observation of the rotation of the celestial body. Radar observation from the Earth ground stations of Mercury has allowed Margo et al. (2012, JGR) to determine the moments of inertia of Mercury with an unprecedented accuracy. Rovers such as the MERs (Mars Exploration Rovers) allow as well to obtain the precession and nutation of Mars from which the moments of inertia of the planet and its core can be deduced. Future missions such as the InSIGHT (Interior exploration using Seismic Investigations, Geodesy, and Heat Transport) NASA mission will further help in the determination of Mars interior and evolution

  17. The Prefabricated Interior Design Studio: An Exploration into the History and Sustainability of Interior Prefabrication

    Science.gov (United States)

    Schneiderman, Deborah; Freihoefer, Kara

    2013-01-01

    This article examines the integration of prefabrication into an interior design studio. A review of the literature revealed that while there is a paucity of categorical research focused on this subject, the subject is historically significant with an abundance of evidence regarding the prefabrication of the interior environment dating back…

  18. Material Ramah Lingkungan untuk Interior Rumah Tinggal

    OpenAIRE

    Dila Hendrassukma

    2011-01-01

    Housing is one of the biggest contributors in polluting the ozone layer and consuming the natural resources in making one. Home interior takes part in the over-produced material used for covering the interior elements, such as floor, wall, ceiling, and furniture. The article conducting is to study the green aspect of building materials to find alternative material to beautify the house that is not harming the earth. The result is options of eco material to be used in the making of greener hom...

  19. Interior point algorithms theory and analysis

    CERN Document Server

    Ye, Yinyu

    2011-01-01

    The first comprehensive review of the theory and practice of one of today's most powerful optimization techniques. The explosive growth of research into and development of interior point algorithms over the past two decades has significantly improved the complexity of linear programming and yielded some of today's most sophisticated computing techniques. This book offers a comprehensive and thorough treatment of the theory, analysis, and implementation of this powerful computational tool. Interior Point Algorithms provides detailed coverage of all basic and advanced aspects of the subject.

  20. Ar + NO microwave plasmas for Escherichia coli sterilization

    Energy Technology Data Exchange (ETDEWEB)

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  1. Argon defect complexes in low energy Ar irradiated molybdenum

    Energy Technology Data Exchange (ETDEWEB)

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  2. MEIS1 functions as a potential AR negative regulator

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  3. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    International Nuclear Information System (INIS)

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  4. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Science.gov (United States)

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  5. SUMER-IRIS Observations of AR11875

    Science.gov (United States)

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  6. Neutron Star Interior Composition Explorer (NICE)

    Science.gov (United States)

    Gendreau, Keith C.; Arzoumanian, Zaven

    2008-01-01

    This viewgraph presentation contains an overview of the mission of the Neutron Star Interior Composition Explorer (NICE), a proposed International Space Station (ISS) payload dedicated ot the study of neutron stars. There are also reviews of the Science Objectives of the payload,the science measurements, the design and the expected performance for the instruments for NICE,

  7. 24 CFR 3280.107 - Interior privacy.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Interior privacy. 3280.107 Section 3280.107 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... privacy. Bathroom and toilet compartment doors shall be equipped with a privacy lock....

  8. Solar Powered Automobile Interior Climate Control System

    Science.gov (United States)

    Howard, Richard T. (Inventor)

    2003-01-01

    There is provided a climate control system for a parked vehicle that includes a solar panel, thermostatic switch, fans, and thermoelectric coolers. The solar panel can serve as the sole source of electricity for the system. The system affords convenient installation and removal by including solar panels that are removably attached to the exterior of a vehicle. A connecting wire electrically connects the solar panels to a housing that is removably mounted to a partially opened window on the vehicle. The thermostatic switch, fans, and thermoelectric coolers are included within the housing. The thermostatic switch alternates the direction of the current flow through the thermoelectric coolers to selectively heat or cool the interior of the vehicle. The interior surface of the thermoelectric coolers are in contact with interior heat sinks that have air circulated across them by an interior fan. Similarly, the exterior surface of the thermoelectric coolers are in contact with exterior heat sinks that have air circulated across them by an exterior fan.

  9. 14 CFR 29.853 - Compartment interiors.

    Science.gov (United States)

    2010-01-01

    ... electrical wire and cable insulation, and for small parts (such as knobs, handles, rollers, fasteners, clips... Compartment interiors. For each compartment to be used by the crew or passengers— (a) The materials (including finishes or decorative surfaces applied to the materials) must meet the following test criteria...

  10. The interiors of the giant planets - 1983

    International Nuclear Information System (INIS)

    The last few years brought progress in understanding the interiors of the giant planets especially of the two larger ones which have been visited by Pioneer and Voyager spacecraft. An analysis of the formation of the giant planets also helped to clarify certain important common features. The presently available model of Jupiter is still based on certain somewhat bothersome approximations but it appears to satisfy the main observational constraints. Saturn's interior is much better understood than it was previously although the quantitative aspects of the role of the miscibility gap in the hydrogen-helium system have not yet been entirely resolved. Much attention has been directed at the interiors of Uranus and Neptune and the outstanding question appears to be the location and the amount of ices and methane present in their outer layers. Both the two- and the three-layer models are moderately successful. Serious difficulties arise from the considerable uncertainties concerning the rotational periods of both planets. Also the estimates of the internal heat fluxes and of the magnetic fields of both planets are not sufficiently certain. It is hoped that the forthcoming flyby of these two planets by a Voyager spacecraft will provide important new data for a future study of their interiors. (Auth.)

  11. Dicty_cDB: FC-AR10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  12. Dicty_cDB: FC-AR05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  13. Dicty_cDB: FC-AR16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  14. Dicty_cDB: FC-AR17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  15. Dicty_cDB: FC-AR01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  16. Dicty_cDB: FC-AR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  17. The role of mitochondrial fusion and StAR phosphorylation in the regulation of StAR activity and steroidogenesis.

    Science.gov (United States)

    Castillo, Ana F; Orlando, Ulises; Helfenberger, Katia E; Poderoso, Cecilia; Podesta, Ernesto J

    2015-06-15

    The steroidogenic acute regulatory (StAR) protein regulates the rate-limiting step in steroidogenesis, i.e. the delivery of cholesterol from the outer (OMM) to the inner (IMM) mitochondrial membrane. StAR is a 37-kDa protein with an N-terminal mitochondrial targeting sequence that is cleaved off during mitochondrial import to yield 30-kDa intramitochondrial StAR. StAR acts exclusively on the OMM and its activity is proportional to how long it remains on the OMM. However, the precise fashion and the molecular mechanism in which StAR remains on the OMM have not been elucidated yet. In this work we will discuss the role of mitochondrial fusion and StAR phosphorylation by the extracellular signal-regulated kinases 1/2 (ERK1/2) as part of the mechanism that regulates StAR retention on the OMM and activity.

  18. Qualitative and quantitative assessment of interior moisture buffering by enclosures

    DEFF Research Database (Denmark)

    Janssen, Hans; Roels, Staf

    2009-01-01

    an alternative basis for quantitative evaluation of interior moisture buffering by the effective moisture penetration depth and effective capacitance models. The presented methodology uses simple and fast measurements only and can also be applied to multimaterial and/or multidimensional interior elements.......The significance of interior humidity in attaining sustainable, durable, healthy and comfortable buildings is increasingly recognised. Given their significant interaction, interior humidity appraisals need a qualitative and/or quantitative assessment of interior moisture buffering. While...

  19. Behavior of argon gas release from manganese oxide minerals as revealed by 40Ar/39Ar laser incremental heating analysis

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Manganese oxides in association with paleo- weathering may provide significant insights into the multiple factors affecting the formation and evolution of weathering profiles, such as temperature, precipitation, and biodiversity. Laser probe step-heating analysis of supergene hollandite and cryptomelane samples collected from central Queensland, Australia, yield well-defined plateaus andconsistent isochron ages, confirming the feasibility dating very-fined supergene manganese oxides by 40Ar/39Ar technique. Two distinct structural sites hostingAr isotopes can be identified in light of their degassing behaviors obtained byincremental heating analyses. The first site, releasing its gas fraction at thelaser power 0.2-0.4 W, yields primarily 40Aratm, 38Aratm, and 36Aratm (atmospheric Ar isotopes). The second sites yield predominantly 40Ar* (radiogenic 40Ar),39ArK, and 38ArK (nucleogenic components), at ~0.5-1.0 W. There is no significant Ar gas released at the laser power higher than 1.0 W, indicating the breakdown of the tunnel sites hosting the radiogenic and nucleogenic components. The excellent match between the degassing behaviors of 40Ar*, 39ArK, and 38ArK suggests that these isotopes occupy the same crystallographic sites and that 39ArK lossfrom the tunnel site by recoil during neutron irradiation and/or bake-out procedure preceding isotopic analysis does not occur. Present investigation supports that neither the overwhelming atmospheric 40Ar nor the very-fined nature of the supergene manganese oxides poses problems in extracting meaningful weathering geochronological information by analyzing supergene manganese oxides minerals.

  20. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Science.gov (United States)

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  1. Androgen Receptor-Mediated Growth Suppression of HPr-1AR and PC3-Lenti-AR Prostate Epithelial Cells.

    Directory of Open Access Journals (Sweden)

    Young-Chae Kim

    Full Text Available The androgen receptor (AR mediates the developmental, physiologic, and pathologic effects of androgens including 5α-dihydrotestosterone (DHT. However, the mechanisms whereby AR regulates growth suppression and differentiation of luminal epithelial cells in the prostate gland and proliferation of malignant versions of these cells are not well understood, though they are central to prostate development, homeostasis, and neoplasia. Here, we identify androgen-responsive genes that restrain cell cycle progression and proliferation of human prostate epithelial cell lines (HPr-1AR and PC3-Lenti-AR, and we investigate the mechanisms through which AR regulates their expression. DHT inhibited proliferation of HPr-1AR and PC3-Lenti-AR, and cell cycle analysis revealed a prolonged G1 interval. In the cell cycle, the G1/S-phase transition is initiated by the activity of cyclin D and cyclin-dependent kinase (CDK complexes, which relieve growth suppression. In HPr-1AR, cyclin D1/2 and CDK4/6 mRNAs were androgen-repressed, whereas CDK inhibitor, CDKN1A, mRNA was androgen-induced. The regulation of these transcripts was AR-dependent, and involved multiple mechanisms. Similar AR-mediated down-regulation of CDK4/6 mRNAs and up-regulation of CDKN1A mRNA occurred in PC3-Lenti-AR. Further, CDK4/6 overexpression suppressed DHT-inhibited cell cycle progression and proliferation of HPr-1AR and PC3-Lenti-AR, whereas CDKN1A overexpression induced cell cycle arrest. We therefore propose that AR-mediated growth suppression of HPr-1AR involves cyclin D1 mRNA decay, transcriptional repression of cyclin D2 and CDK4/6, and transcriptional activation of CDKN1A, which serve to decrease CDK4/6 activity. AR-mediated inhibition of PC3-Lenti-AR proliferation occurs through a similar mechanism, albeit without down-regulation of cyclin D. Our findings provide insight into AR-mediated regulation of prostate epithelial cell proliferation.

  2. Constraining Ceres' interior from its Rotational Motion

    CERN Document Server

    Rambaux, Nicolas; Dehant, Véronique; Kuchynka, Petr

    2011-01-01

    Context. Ceres is the most massive body of the asteroid belt and contains about 25 wt.% (weight percent) of water. Understanding its thermal evolution and assessing its current state are major goals of the Dawn Mission. Constraints on internal structure can be inferred from various observations. Especially, detailed knowledge of the rotational motion can help constrain the mass distribution inside the body, which in turn can lead to information on its geophysical history. Aims. We investigate the signature of the interior on the rotational motion of Ceres and discuss possible future measurements performed by the spacecraft Dawn that will help to constrain Ceres' internal structure. Methods. We compute the polar motion, precession-nutation, and length-of-day variations. We estimate the amplitudes of the rigid and non-rigid response for these various motions for models of Ceres interior constrained by recent shape data and surface properties. Results. As a general result, the amplitudes of oscillations in the r...

  3. Recent Advances in Modeling Stellar Interiors

    CERN Document Server

    Guzik, Joyce Ann

    2010-01-01

    Advances in stellar interior modeling are being driven by new data from large-scale surveys and high-precision photometric and spectroscopic observations. Here we focus on single stars in normal evolutionary phases; we will not discuss the many advances in modeling star formation, interacting binaries, supernovae, or neutron stars. We review briefly: 1) updates to input physics of stellar models; 2) progress in two and three-dimensional evolution and hydrodynamic models; 3) insights from oscillation data used to infer stellar interior structure and validate model predictions (asteroseismology). We close by highlighting a few outstanding problems, e.g., the driving mechanisms for hybrid gamma Dor/delta Sct star pulsations, the cause of giant eruptions seen in luminous blue variables such as eta Car and P Cyg, and the solar abundance problem.

  4. The Neutron Star Interior Composition Explorer

    Science.gov (United States)

    Gendreau, Keith C.

    2008-01-01

    The Neutron star Interior Composition Explorer (NICE) will be a Mission of Opportunity dedicated to the study of neutron stars, the only places in the universe where all four fundamental forces of nature are simultaneously in play. NICE will explore the exotic states of matter within neutron stars, revealing their interior and surface compositions through rotation resolved X-ray spectroscopy. Absolute time-referenced data will allow NICE to probe the extreme physical environments associated with neutron stars, leveraging observations across the electromagnetic spectrum to answer decades-old questions about one of the most powerful cosmic accelerators known. Finally, NICE will definitively measure stabilities of pulsars as clocks, with implications for navigation, a pulsar-based timescale, and gravitational-wave detection. NICE will fly on the International Space Station, while GLAST is on orbit and post-RXTE, and will allow for the discovery of new high-energy pulsars and provide continuity in X-ray timing astrophysics.

  5. Interior Models of Uranus and Neptune

    CERN Document Server

    Helled, Ravit; Podolak, Morris; Schubert, Gerald

    2010-01-01

    'Empirical' models (pressure vs. density) of Uranus and Neptune interiors constrained by the gravitational coefficients J_2, J_4, the planetary radii and masses, and Voyager solid-body rotation periods are presented. The empirical pressure-density profiles are then interpreted in terms of physical equations of state of hydrogen, helium, ice (H_2O), and rock (SiO_2) to test the physical plausibility of the models. The compositions of Uranus and Neptune are found to be similar with somewhat different distributions of the high-Z material. The big difference between the two planets is that Neptune requires a non-solar envelope while Uranus is best matched with a solar composition envelope. Our analysis suggests that the heavier elements in both Uranus' and Neptune's interior might increase gradually towards the planetary centers. Indeed it is possible to fit the gravitational moments without sharp compositional transitions.

  6. Solar Interior Rotation and its Variation

    Directory of Open Access Journals (Sweden)

    Howe Rachel

    2009-02-01

    Full Text Available This article surveys the development of observational understanding of the interior rotation of the Sun and its temporal variation over approximately forty years, starting with the 1960s attempts to determine the solar core rotation from oblateness and proceeding through the development of helioseismology to the detailed modern picture of the internal rotation deduced from continuous helioseismic observations during solar cycle 23. After introducing some basic helioseismic concepts, it covers, in turn, the rotation of the core and radiative interior, the “tachocline” shear layer at the base of the convection zone, the differential rotation in the convection zone, the near-surface shear, the pattern of migrating zonal flows known as the torsional oscillation, and the possible temporal variations at the bottom of the convection zone. For each area, the article also briefly explores the relationship between observations and models.

  7. Recent advances in modeling stellar interiors (u)

    Energy Technology Data Exchange (ETDEWEB)

    Guzik, Joyce Ann [Los Alamos National Laboratory

    2010-01-01

    Advances in stellar interior modeling are being driven by new data from large-scale surveys and high-precision photometric and spectroscopic observations. Here we focus on single stars in normal evolutionary phases; we will not discuss the many advances in modeling star formation, interacting binaries, supernovae, or neutron stars. We review briefly: (1) updates to input physics of stellar models; (2) progress in two and three-dimensional evolution and hydrodynamic models; (3) insights from oscillation data used to infer stellar interior structure and validate model predictions (asteroseismology). We close by highlighting a few outstanding problems, e.g., the driving mechanisms for hybrid {gamma} Dor/{delta} Sct star pulsations, the cause of giant eruptions seen in luminous blue variables such as {eta} Car and P Cyg, and the solar abundance problem.

  8. Calidad ambiental interior: bienestar, confort y salud

    Directory of Open Access Journals (Sweden)

    Francisco Vargas Marcos

    2005-01-01

    Full Text Available Distintas formas de interpretar las condiciones ambientales han llevado al desarrollo de conceptos tales como edificio enfermo, calidad del aire o calidad ambiental interior, todos ellos encaminados a entender la complejidad de los contaminantes en los ambientes cerrados y las implicaciones sobre la salud de la población. La propuesta de "Calidad ambiental interior" es un avance conceptual y operativo que supera ampliamente a los anteriores, puesto que orienta las acciones hacia ambientes saludables sin limitar al aire la idea de contaminación. El objetivo del trabajo es identificar las competencias y el marco legislativo que permiten actuar en la prevención de riesgos asociados a la exposición de contaminantes en ambientes interiores. Óptimas condiciones en los ambientes interiores deben redundar en salud, bienestar y confort, tanto en lo que respecta a la vida laboral como a los ámbitos donde se desarrollan las actividades cotidianas extralaborales, escolares, de descanso y de ocio. La sociedad actual exige lugares seguros, limpios y bien climatizados, para lo que es necesario integrar percepciones y exigencias de los habitantes y alcanzar un óptimo equilibrio entre estándares sociales, uso de la energía y desarrollo sostenible, buscando confort sin contaminar y sin aumentar el consumo de fuentes energéticas que degraden el medio ambiente. El desarrollo legislativo se orienta a la seguridad y la salud en los lugares de trabajo y la regulación de las sustancias químicas. La Sanidad Ambiental lleva a cabo tareas de prevención y control, participa en la ejecución de convenios internacionales de reducción de contaminantes y desechos y promueve acciones para el desarrollo de la Estrategia Europea de Salud y Medio Ambiente.

  9. Gravitational Higgs Mechanism in Neutron Star Interiors

    CERN Document Server

    Coates, Andrew; Sotiriou, Thomas P

    2016-01-01

    We suggest that nonminimally coupled scalar fields can lead to modifications of the microphysics in the interiors of relativistic stars. As a concrete example, we consider the generation of a non-zero photon mass in such high-density environments. This is achieved by means of a light gravitational scalar, and the scalarization phase transition in scalar-tensor theories of gravitation. Two distinct models are presented, and phenomenological implications are briefly discussed.

  10. Identification and analysis of ARS function of six plant MARs

    Institute of Scientific and Technical Information of China (English)

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  11. Quantum state of the black hole interior

    CERN Document Server

    Brustein, Ram

    2015-01-01

    If a black hole (BH) is initially in an approximately pure state and it evaporates by a unitary process, then the emitted radiation will be in a highly quantum state. As the purifier of this radiation, the state of the BH interior must also be in some highly quantum state. So that, within the interior region, the mean-field approximation cannot be valid and the state of the BH cannot be described by some semiclassical metric. On this basis, we model the state of the BH interior as a collection of a large number of excitations that are packed into closely spaced but single-occupancy energy levels; a sort-of "Fermi sea" of all light-enough particles. This highly quantum state is surrounded by a semiclassical region that lies close to the horizon and has a non-vanishing energy density. It is shown that such a state looks like a BH from the outside and decays via gravitational pair production in the near-horizon region at a rate that agrees with the Hawking rate. We also consider the fate of a classical object th...

  12. Plasma AR and abiraterone-resistant prostate cancer.

    Science.gov (United States)

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone.

  13. Efeito de ciclos de umidade relativa e temperatura do ar na resistência de juntas colodas com lâminas de Eucalyptus grandis W. Hill ex Maiden, Eucalyptus saligna Smith e chapas de fibra de densidade média (MDF Air relative humidity and temperature cycle effects on the resistence of glued joints between bords of Eucalyptus grandis, Eucalyptus saligna and medium density fiberbord (MDF

    Directory of Open Access Journals (Sweden)

    Benedito Rocha Vital

    2005-10-01

    Full Text Available Este trabalho teve como objetivo avaliar o efeito de ciclos de umidade relativa e temperatura do ar na resistência da linha de cola, em juntas coladas entre lâminas de madeira de Eucalyptus grandis, Eucalyptus saligna e lâminas de chapa de fibras de média densidade (MDF cujas densidades foram iguais a 0,60, 0,66, e 0,72g/cm³, respectivamente. Foram empregados adesivos de poliacetato de média viscosidade e uréia-formaldeído nas gramaturas de 150,0g/m² e 180,0g/m², respectivamente, em face simples. O teor médio de umidade no momento da colagem foi igual a 14%. Foram observadas diferenças significativas tanto na resistência da linha de cola quanto na percentagem de falha na madeira provocada pela composição das amostras, etapa de equilíbrio e tipo de adesivo. Os valores mais elevados de resistência foram observados nas juntas coladas com madeira de Eucalyptus saligna após a primeira etapa de equilíbrio, enquanto os menores valores ocorreram nas juntas combinando lâminas de eucalipto e MDF. Considerando apenas as lâminas de madeira, os valores mais elevados de falha na madeira foram observados nas juntas coladas entre lâminas de Eucalyptus grandis. Nas amostras compostas de madeira de eucalipto e lâminas de MDF, a porcentagem de falha foi total e o rompimento ocorreu exclusivamente no interior da chapa de MDF. Observou-se interação significativa entre a composição das amostras lâminas e o tipo de adesivo, em que os valores mais altos de resistência ocorreram nas juntas coladas com madeira de Eucalyptus saligna e adesivo à base de uréia-formaldeído.The objectives of this work was to evaluate the effect of air relative humidity and air temperature cycles on glue line resistance of glued veneer joints of Eucalyptus grandis, Eucalyptus saligna and medium density fiberboard (MDF. Densities of Eucalyptus grandis, Eucalyptus saligna wood and MDF were equal to 0,60, 0.66, e 0.72g/cm³ respectively. Medium viscosity

  14. Practical reactor production of {sup 41}Ar from argon clathrate

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  15. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  16. Reactivation episodes of the romeral fault system in the northwestern part of central andes, colombia, through 39ar-40ar and k-ar results

    OpenAIRE

    VINASCO VALLEJO, CESAR JAVIER; Cordani, Umberto

    2013-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  17. Estudo exploratorio da qualidade do ar em escolas de educacao basica, Coimbra, Portugal

    Directory of Open Access Journals (Sweden)

    Ana Maria Conceicao Ferreira

    2013-12-01

    Full Text Available OBJETIVO : Analisar a qualidade do ar em escolas de educação básica e suas condições estruturais e funcionais. MÉTODOS : Foi avaliada a qualidade do ar de 51 escolas (81 salas de aula de educação básica da cidade de Coimbra, Portugal, tanto na parte interior das salas como na exterior, durante as quatro estações do ano, de 2010 a 2011. Foram avaliadas a temperatura (Tº, umidade relativa (Hr, concentrações de monóxido de carbono (CO, dióxido de carbono (CO 2 , ozona (O 3 , dióxido de nitrogênio (NO 2 , dióxido de enxofre (SO 2 , compostos orgânicos voláteis (COV, formaldeído e material particulado (PM 10 , de novembro de 2010 a fevereiro de 2011 (outono/inverno e de março de 2011 a junho de 2011 (primavera/verão. Procedeu-se ao preenchimento de uma grelha de caracterização das condições estruturais e funcionais das escolas. Aplicaram-se os testes estatísticos t- Student para amostras emparelhadas e o teste t de Wilcoxon. RESULTADOS : Em 47 escolas, as concentrações médias de CO 2 encontravam-se acima da concentração máxima de referência (984 ppm mencionada na legislação portuguesa. Os valores máximos de concentração encontrados no interior das salas foram críticos, principalmente no outono/inverno (5.320 ppm. As concentrações médias de COV e de PM 10 no interior ultrapassaram a concentração máxima de referência legislada em algumas escolas. Não foram detetados valores relevantes (risco de CO, formaldeído, NO 2 , SO 2 e O 3 . CONCLUSÕES : Houve maior concentração de poluentes no interior das salas, comparativamente com o exterior. A inadequada ventilação está associada à elevada concentração de CO 2 nas salas de aula.

  18. Ab Initio Potential Curve for ArH+%ArH+势能曲线的从头计算

    Institute of Scientific and Technical Information of China (English)

    王胜龙; 屈军艳; 郭锐; 赵新生

    2001-01-01

    The molecular parameters of ArH+ have been calculated with different quantum chemistry methods and basis sets.Based on the data from QCISD/Aug cc pVTZ ab initio calculation for different configurations of ArH+ and the experimental data,an accurate potential curve for ArH+ has been constructed.The molecular properties,such as dissociation energy,equilibrium bond length,and vibrational energy levels,can be accurately reproduced.

  19. 40Ar/39Ar Age of the Lathrop Wells Volcanic Center, Yucca Mountain, Nevada.

    Science.gov (United States)

    Turrin, B D; Champion, D; Fleck, R J

    1991-08-01

    Paleomagnetic and (40)Ar/(39)Ar analyses from the Lathrop Wells volcanic center, Nevada, indicate that two eruptive events have occurred there. The ages (136 +/- 8 and 141 +/- 9 thousand years ago) for these two events are analytically indistinguishable. The small angular difference (4.7 degrees ) between the paleomagnetic directions from these two events suggests they differ in age by only about 100 years. These ages are consistent with the chronology of the surficial geological units in the Yucca Mountain area. These results contradict earlier interpretations of the cinder-cone geomorphology and soil-profile data that suggest that at least five temporally discrete eruptive events occurred at Lathrop Wells approximately 20,000 years ago. PMID:17772371

  20. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley, Maghalaya, India

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande

    2001-09-01

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma and 107.5 ± 1.4 Ma, respectively. The weighted mean of these ages, 107.2 ± 0.8 Ma, is the time of emplacement of this complex. This implies that Sung Valley complex and probably other such complexes in the Assam-Meghalaya Plateau postdate the main ood basalt event (i.e., the eruption of tholeiites) in the RBS province by ∼10 Ma.

  1. Acoustic resonance spectroscopy (ARS): ARS300 operations manual, software version 2.01

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-25

    Acoustic Resonance Spectroscopy (ARS) is a nondestructive evaluation technology developed at the Los Alamos National Laboratory. The ARS technique is a fast, safe, and nonintrusive technique that is particularly useful when a large number of objects need to be tested. Any physical object, whether solid, hollow, or fluid filled, has many modes of vibration. These modes of vibration, commonly referred to as the natural resonant modes or resonant frequencies, are determined by the object`s shape, size, and physical properties, such as elastic moduli, speed of sound, and density. If the object is mechanically excited at frequencies corresponding to its characteristic natural vibrational modes, a resonance effect can be observed when small excitation energies produce large amplitude vibrations in the object. At other excitation frequencies, i.e., vibrational response of the object is minimal.

  2. 40Ar/39Ar dating and paleo-magnetism of traps from Ethiopia, Deccan and Siberia

    International Nuclear Information System (INIS)

    Recent studies have shown that major flood basalt provinces have been emplaced as short events (∼ 1 Myr), more or less synchronous with climatic crises and mass extinctions. We present new geochronologic (40Ar/39Ar) and magneto-stratigraphic results for the Ethiopian traps, one of the last remaining flood basalts for which little of such data were available. The ages obtained in a 2000 m thick section are indistinguishable. Moreover, magneto-stratigraphy reveals a simple 3-chron reverse-normal-reverse sequence. Although magnetic chrons cannot be yet unambiguously identified, there is more likelihood for the normal sub-chron in the main basaltic pile to correspond to 11N, supporting a brief duration (less than 1.5 Ma). The Ethiopian traps erupted near 30 Ma at or near the time of the cold and dry climate, major Antarctic ice sheet advance, and the largest sea-level drop in the Tertiary. Bhandari et al. (GRL, 1995) have discovered inter-traps sediments with a triple iridium anomaly in a series of seven basaltic lava flows in the Kutch area of the North Western Deccan traps of India. Plagioclases from three flows above the iridium bearing sediments yield 39Ar/40Ar plateau ages near 65.0 Ma: these flows have unambiguously reversed magnetic polarity interpreted as chron 29R. As a preliminary summary, evidence of the KTB asteroid impact is confirmed in the Deccan traps, showing that they are coeval events in a general sense (in a Ma long window) though clearly with vastly different time constants. This is compatible with paleontologic evidence of two scales of extinctions, one quasi-instantaneous and the other on the order of 105 to 106 yrs. Clearly, the impact cannot have caused trap eruptions. On the other hand, the exact age and significance of the lower flows more altered remains to be analyzed further as they pertained to the much debated question of duration of Deccan trap volcanism. (author)

  3. 40 Ar/ 39 Ar radiometric dating to constrain the volcanic stratigraphy: The Mt. Etna methodological case.

    OpenAIRE

    De Beni, E.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Groppelli, G.; Istituto per la Dinamica dei Processi Ambientali–Sezione di Milano, Consiglio Nazionale delle Ricerche, via Mangiagalli 34, 20133 Milano, Italy

    2010-01-01

    Although ~50 radiometric age analyses have been performed on Etna, and there are many historical references, these are not enough to temporally constrain the geo- logical evolution of the volcano. In particular, a new stratigraphic framework based on lithostratigraphic and unconformity-bounded units has pointed out the presence of some stratigraphic uncertainty that can be resolved only with radiometric dating. For this reason, a dating project applying the 40 Ar/ ...

  4. Spatial autocorrelation method using AR model; Kukan jiko sokanho eno AR model no tekiyo

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, H.; Obuchi, T.; Saito, T. [Iwate University, Iwate (Japan). Faculty of Engineering

    1996-05-01

    Examination was made about the applicability of the AR model to the spatial autocorrelation (SAC) method, which analyzes the surface wave phase velocity in a microtremor, for the estimation of the underground structure. In this examination, microtremor data recorded in Morioka City, Iwate Prefecture, was used. In the SAC method, a spatial autocorrelation function with the frequency as a variable is determined from microtremor data observed by circular arrays. Then, the Bessel function is adapted to the spatial autocorrelation coefficient with the distance between seismographs as a variable for the determination of the phase velocity. The result of the AR model application in this study and the results of the conventional BPF and FFT method were compared. It was then found that the phase velocities obtained by the BPF and FFT methods were more dispersed than the same obtained by the AR model. The dispersion in the BPF method is attributed to the bandwidth used in the band-pass filter and, in the FFT method, to the impact of the bandwidth on the smoothing of the cross spectrum. 2 refs., 7 figs.

  5. Dicty_cDB: FC-AR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR21 (Link to dictyBase) - - - Contig-U16455-1 FC-AR21Z (Li...nk to Original site) - - FC-AR21Z 528 - - - - Show FC-AR21 Library FC (Link to library) Clone ID FC-AR21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR21Q.Seq.d/ Representative seq. ID FC-AR...21Z (Link to Original site) Representative DNA sequence >FC-AR21 (FC-AR21Q) /CSM/FC/FC-AR/FC-AR21Q.Seq....omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR21 (FC-AR

  6. Particle irradiation and electron work function: Fe single crystal bombarded with Ar+ ions

    Science.gov (United States)

    Horváth, Ákos; Nagy, Norbert; Schiller, Robert

    2016-07-01

    Accelerated Ar+ ions of 30 keV energy were used to mimic the effect of fast neutrons on Fe single crystal. Both Monte-Carlo calculations and X-ray Photoelectron Spectroscopy (XPS) measurements indicated that the fast ions did not alter the surface causing damage only at several nm depth. The change in the electrode potential, characteristic also to corrosion processes, was determined by the Kelvin method of work function measurement in order to avoid any post-irradiation process. Irradiation with fluences between 5×1014 and 6×1015 cm-2 decreased the electrode potential of the sample by about 60 mV in qualitative agreement with earlier results about the work functions of Fe single crystal and polycrystalline sample. Thus ion irradiation turns the interior of the single crystal into a disordered, polycrystalline substance increasing the crystal's readiness to be corroded.

  7. Burning and browsing effects on willow growth in interior Alaska

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The dominant species in mature forests of interior Alaska is either white spruce (Picea glauca} or black spruce (P. mariana), with wood shrubs present at lower...

  8. Avian populations and habitat use in interior Alaska taiga

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Avian community structure, habitat occupancy levels, and species habitat use patterns were examined in the woody habitats of interior Alaska taiga. Some birds...

  9. The Interior of Numerical Ranges of Op erators

    Institute of Scientific and Technical Information of China (English)

    DOU Yan-ni; LI Chen-xin; LI Rong; DU Hong-ke

    2015-01-01

    In this note, some properties of the interior of numerical ranges of operators are established, and an alternative proof of Embry’s theorem associated with the interior of a numerical ranges of an operator is given(see [3]).

  10. Tidal constraints on the interior of Venus

    Science.gov (United States)

    Dumoulin, Caroline; Tobie, Gabriel; Verhoeven, Olivier; Rosenblatt, Pascal; Rambaux, Nicolas

    2016-10-01

    As a prospective study for a future exploration of Venus, we propose to systematically investigate the signature of the internal structure in the gravity field and the rotation state of Venus, through the determination of the moment of inertia and the tidal Love number.We test various mantle compositions, core size and density as well as temperature profiles representative of different scenarios for formation and evolution of Venus. The mantle density ρ and seismic vP and vS wavespeeds are computed in a consistent manner from given temperature and composition using the Perple X program. This method computes phase equilibria and uses the thermodynamics of mantle minerals developped by Stixrude and Lithgow-Bertelloni (2011).The viscoelastic deformation of the planet interior under the action of periodic tidal forces are computed following the method of Tobie et al. (2005).For a variety of interior models of Venus, the Love number, k2, and the moment of inertia factor are computed following the method described above. The objective is to determine the sensitivity of these synthetic results to the internal structure. These synthetic data are then used to infer the measurement accuracies required on the time-varying gravitational field and the rotation state (precession rate, nutation and length of day variations) to provide useful constraints on the internal structure.We show that a better determination of k2, together with an estimation of the moment of inertia, the radial displacement, and of the time lag, if possible, will refine our knowledge on the present-day interior of Venus (size of the core, mantle temperature, composition and viscosity). Inferring these quantities from a future ex- ploration mission will provide essential constraints on the formation and evolution scenarios of Venus.

  11. Interior Structure and Tidal Response of Mercury

    Science.gov (United States)

    Steinke, Teresa; Sohl, Frank; Hussmann, Hauke; Knapmeyer, Martin; Wagner, Frank Walter

    2013-04-01

    Recent determinations of Mercury's mean density, polar moment of inertia factor, and the inertia of its solid outer shell provide strong constraints on the radius of its liquid core. We present an ensemble of spherically symmetric interior structure models that all satisfy the observational constraints. The models consist of a pure iron solid inner core, a liquid Fe-FeS outer core, a peridotite mantle and a crust predominantly composed of plagioclase. The sulfur content in the outer core, the iron and magnesium content of the mantle, and the crustal thickness vary throughout the ensemble. Comparison of observed and predicted moments of inertia yields admissible ranges for the outer core radius and the mantle density. From this model ensemble we derive geophysical observables that would allow further constraining the interior structure of Mercury in future experiments. The moment of inertia constraints allow for both forsterite and fayalite rich mantle compositions. Variations of mantle density trade off with crustal thickness and core composition. This non-uniqueness could be resolved using seismic travel time observations: since the P wave velocity of a fayalite mantle is significantly lower than that of the plagioclase-rich crust, a shadow zone arises as a clear discriminant between the two end-member compositions. The planet's response to solar tidal forcing strongly depends on its interior structure and rheological properties and can be parameterized in terms of the surface body tide Love numbers k2 and h2, respectively. We employ the frequency-dependent Maxwell rheology to calculate the body tide Love numbers for the main tidal period (87.97 days) using the density, rigidity and viscosity profiles of our structural models. We obtain values between 0.38 and 0.65 for k2 and between 0.70 and 1.12 for h2, respectively, thereby indicating the substantial tidal response of Mercury's interior. Furthermore we find that, via viscosity and rigidity, both k2 and h2 are

  12. Interior Models of Uranus and Neptune

    OpenAIRE

    Helled, Ravit; Anderson, John D.; Podolak, Morris; Schubert, Gerald

    2010-01-01

    'Empirical' models (pressure vs. density) of Uranus and Neptune interiors constrained by the gravitational coefficients J_2, J_4, the planetary radii and masses, and Voyager solid-body rotation periods are presented. The empirical pressure-density profiles are then interpreted in terms of physical equations of state of hydrogen, helium, ice (H_2O), and rock (SiO_2) to test the physical plausibility of the models. The compositions of Uranus and Neptune are found to be similar with somewhat dif...

  13. Perspectives on the Interior of the Sun

    Indian Academy of Sciences (India)

    S. Μ. Chitre

    2000-09-01

    The interior of the Sun is not directly accessible to observations. Nonetheless, it is possible to infer the physical conditions inside the Sun with the help of structure equations governing its equilibrium and with the powerful observational tools provided by the neutrino fluxes and oscillation frequencies. The helioseismic data show that the internal constitution of the Sun can be adequately represented by a standard solar model. It turns out that a cooler solar core is not a viable solution for the measured deficit of neutrino fluxes, and the resolution of the solar neutrino puzzle should be sought in the realm of particle physics.

  14. RECONSTRUCTION OF AR DEPTH PROFILES FROM PIXE MEASUREMENTS

    NARCIS (Netherlands)

    OSIPOWICZ, T; LIEW, SC; LOH, KK; ORLIC, [No Value; TANG, SM; WEBER, T

    1994-01-01

    We report on the application of an iterative maximum likelihood algorithm [1] to the reconstruction of depth profiles from PIXE measurements. PIXE spectra of 450 and 800 keV Ar implanted Al samples were taken at 1.5 and 1.3 MeV He+ energy and at angles ranging from 18 to 83-degrees. The measured Ar

  15. Experimental introduction of excess Ar40 into a granitic melt

    Science.gov (United States)

    Fyfe, W.S.; Lanphere, M.A.; Dalrymple, G.B.

    1969-01-01

    Samples of a Precambrian granite were melted in sealed capsules to produce a radiogenic Ar40 atmosphere over the melt. The amount of Ar40 incorporated in the quenched charge was then determined. Under these experimental conditions the amount of argon dissolved in the quenched melt was appreciable and could be an important source of error in potassiumargon dating. ?? 1969 Springer-Verlag.

  16. In Vitro Activity of AR-709 against Streptococcus pneumoniae▿

    OpenAIRE

    Jansen, W.T.M.; Verel, A.; Verhoef, J.; Milatovic, D.

    2008-01-01

    We investigated the in vitro activity of AR-709, a novel diaminopyrimidine antibiotic currently in development for treatment of community-acquired upper and lower respiratory tract infections, against 151 Streptococcus pneumoniae strains from various European countries. AR-709 showed excellent activity against both drug-susceptible and multidrug-resistant pneumococci.

  17. Aspects of What Makes or Breaks a Museum AR Experience

    DEFF Research Database (Denmark)

    Madsen, Claus B.; Madsen, Jacob Boesen; Morrison, Ann

    2012-01-01

    The paper critically evaluates central aspects of an iPad AR application developed for a museum context. The application is designed for children aged 8 to 12 and mixes AR and mini-game elements to convey dramatized historical events. The game has been deployed for roughly 3 months and the findin...

  18. Space station interior design: Results of the NASA/AIA space station interior national design competition

    Science.gov (United States)

    Haines, R. F.

    1975-01-01

    The results of the NASA/AIA space station interior national design competition held during 1971 are presented in order to make available to those who work in the architectural, engineering, and interior design fields the results of this design activity in which the interiors of several space shuttle size modules were designed for optimal habitability. Each design entry also includes a final configuration of all modules into a complete space station. A brief history of the competition is presented with the competition guidelines and constraints. The first place award entry is presented in detail, and specific features from other selected designs are discussed. This is followed by a discussion of how some of these design features might be applied to terrestrial as well as space situations.

  19. Ar-40/Ar-39 age constraints for the Jaramillo Normal Subchron and the Matuyama-Brunhes geomagnetic boundary

    Science.gov (United States)

    Izett, Glen A.; Obradovich, John D.

    1994-02-01

    Our mid-Pleistocene Ar-40/Ar-39 age recalibration of the geomagnetic polarity timescale is nearly in accord with the oxygen isotope, climate record calibration of the astronomical timescale proposed by Johnson (1982) and Shackleton et al. (1990). Ar-40/Ar-39 ages of a normally magnetized rhyolite dome in the Valles caldera, northern Mexico, yielded a weighted-mean age of 1.004 +/- 0.019 Ma. A K-Ar age of 0.909 +/- 0.019 Ma for this rock by Doell and Dalrymple (1966) was the linchpin for the recognition and calibration of the Jaramillo Normal Subchron (JNS). Other Ar-40/Ar-39 ages from the Valles caldera and Ar-40/Ar-39 ages of Ivory Coast tektites indicate that the JNS began at about 1.11 Ma and ended before 0.92 Ma, probably near 0.97 Ma. The Matuyama-Brunhes boundary occurred between 0.79 Ma and 0.76 Ma on the basis of Ar-40/Ar-39 sanidine ages from (1) three reversely magnetized rhyolite domes of the Valles caldera (0.793 +/- 0.018 Ma, 0.794 +/- 0.007 Ma, and 0.812 +/- 0.023 Ma) and pumice (0.789 +/- 0.006 Ma) from the reversely magnetized Oldest Toba Tuff of Sumatra and (2) pumice (0.764 +/- 0.005 Ma and 0.757 +/- 0.009 Ma) from the lower and upper units of the normally magnetized Bishop Tuff. The age of the boundary may be close to 0.77 Ma as deduced from rates of sedimentation in ancient Lake Bonneville, Utah.

  20. Interior design students win two IDEC Student Design Competition awards

    OpenAIRE

    Watson-Bloch, Cathy

    2005-01-01

    Interior Design students in the School of Architecture + Design at Virginia Tech won two of the four awards presented in the 2004-2005 Interior Design Educators Council (IDEC) Student Design Competition. Winners were selected at the International IDEC Conference in Savannah, Ga. with Virginia Tech Interior Design students winning second place and honorable mention.

  1. 77 FR 45650 - Interior Fire Program Assessment 2012

    Science.gov (United States)

    2012-08-01

    ... Office of the Secretary Interior Fire Program Assessment 2012 AGENCY: Office of Wildland Fire, Interior... Assessment 2012; and (2) potential options being considered as a result of the Interior Fire Program Assessment 2012. DATES: See the SUPPLEMENTARY INFORMATION section of this notice for consultation...

  2. 24 CFR 3285.803 - Interior close-up.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Interior close-up. 3285.803 Section... DEVELOPMENT MODEL MANUFACTURED HOME INSTALLATION STANDARDS Exterior and Interior Close-Up § 3285.803 Interior close-up. (a) All shipping blocking, strapping, or bracing must be removed from appliances, windows,...

  3. Touch interface for markless AR based on Kinect

    Science.gov (United States)

    Hsieh, Ching-Tang; Kuo, Tai-Ku; Wang, Hui-Chun; Wu, Yeh-Kuang; Chang, Liung-Chun

    2014-01-01

    We develop an augmented reality (AR) environment with hidden-marker via touch interface using Kinect device, and then also set up a touch painting game with the AR environment. This environment is similar to that of the touch screen interface which allows user to paint picture on a tabletop with his fingers, and it is designed with depth image information from Kinect device setting up above a tabletop. We incorporate support vector machine (SVM) to classify painted pictures which correspond to the inner data and call out its AR into the tabletop in color images information from Kinect device. Because users can utilize this similar touch interface to control AR, we achieve a marker-less AR and interactive environment.

  4. AR Sco: A White Dwarf Synchronar

    CERN Document Server

    Katz, J I

    2016-01-01

    The emission of the white dwarf-M dwarf binary AR Sco is driven by the rapid synchronization of its white dwarf, rather than by accretion. This requires a comparatively large magnetic field $\\sim 100$ gauss at the M dwarf and $\\sim 10^8$ gauss on the white dwarf, larger than the fields of most intermediate polars but within the range of fields of known magnetic white dwarfs. The spindown power is dissipated in the atmosphere of the M dwarf by magnetic reconnection, accelerating particles that produce the observed synchrotron radiation. The displacement of the optical maximum from conjunction may be explained either by dissipation in a bow wave as the white dwarf's magnetic field sweeps past the M dwarf or by a misaligned white dwarf's rotation axis and oblique magnetic moment. In the latter case the rotation axis precesses with a period of decades, predicting a drift in the orbital phase of maximum. Binaries whose emission is powered by synchronization may be termed synchronars, in analogy to magnetars.

  5. Asymmetric interiors for small black holes

    CERN Document Server

    Kabat, Daniel

    2016-01-01

    We develop the representation of infalling observers and bulk fields in the CFT as a way to understand the black hole interior in AdS. We first discuss properties of CFT states which are dual to black holes. Then we show that in the presence of a Killing horizon bulk fields can be decomposed into pieces we call ingoing and outgoing. The ingoing field admits a simple operator representation in the CFT, even inside a small black hole at late times, which leads to a simple CFT description of infalling geodesics. This means classical infalling observers will experience the classical geometry in the interior. The outgoing piece of the field is more subtle. In an eternal two-sided geometry it can be represented as an operator on the left CFT. In a stable one-sided geometry it can be described using entanglement via the PR construction. But in an evaporating black hole trans-horizon entanglement changes at the Page time, which means that for old black holes the PR construction fails and the outgoing field does not s...

  6. Interior structure models of GJ 436b

    CERN Document Server

    Nettelmann, N; Redmer, R; Neuhaeuser, R

    2010-01-01

    GJ436b is the first extrasolar planet discovered that resembles Neptune in mass and radius, two more are known (HAT-P-11b and Kepler-4b), and many more are expected to be found in the upcoming years. The particularly interesting property of Neptune-sized planets is that their mass Mp and radius Rp are close to theoretical M-R relations of water planets. Given Mp, Rp, and equilibrium temperature however, various internal compositions are possible. A broad set of interior structure models is presented here that illustrates the dependence of internal composition and possible phases of water in presumably water-rich planets such as GJ436b on the uncertainty in atmospheric temperature profile and mean density. We model the interior by assuming either three layers (hydrogen-helium envelope, water layer, rock core) or two layers (H/He/H2O envelope, rocky core). For water we use the equation of state H2O-REOS based on FT-DFT-MD. Some admixture of H/He appears mandatory for explaining the measured radius. In case of t...

  7. On Full Disclosure and Transparent Data Flow from 40Ar/39Ar Geochronology Measurements to Data Reduction to Online Repositories

    Science.gov (United States)

    Koppers, A. A. P.

    2015-12-01

    Arguably 40Ar/39Ar geochronology is one of the most versatile techniques available to Earth scientists today for the dating of rocks and minerals and determining the rates of geological processes on Earth and in our solar system. Over the last four decades large quantities of high (and lower) quality 40Ar/39Ar data have been produced using many different generations of mass spectrometry instrumentation. This wealth of data is only as useful as its description and availability of metadata allows. Many online data sets or compilations available in the science literature only carry the resulting product, an age and a related uncertainty in millions of years, for example. These data points are far from desirable as these don't allow recalculation against modern-day age standards, decay constants and other parameters essential in 40Ar/39Ar geochronology. Over time these data will become less useful to the research community and eventually these will be put by the wayside. In this presentation I will emphasize the need for full disclosure of all data and metadata involved in 40Ar/39Ar geochronology. I will give examples of how a complex data flow can be kept transparent from sample preparation to measurement to data reduction and eventually the uploading into online data repositories. Without the full disclosure of our data and a transparent data flow, it is evident that we cannot live up to one of the governing doctrines in the sciences, namely reproducibility of our scientific experiments and findings.

  8. 40Ar/39Ar ages of adularia from the Golden Cross, Neavesville, and Komata epithermal deposits, Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar ages of adularia from three epithermal vein deposits in the Hauraki Goldfield constrain when these deposits formed. Adularia from veins at Neavesville has 40Ar/39Ar plateau and isochron ages of 6.89 ± 0.02 and 6.86 ± 0.02 Ma, respectively, similar to the 40Ar/39Ar plateau and isochron ages of adularia from veins at Golden Cross of 6.96 ± 0.04 and 6.93 ± 0.03 Ma, respectively. In contrast, Komata mineralisation formed at 5.99 ± 0.02 to 6.07 ± 0.03 Ma, based on the 40Ar/39Ar isochron and plateau ages of the adularia in these veins, similar to the previously reported 6.0 Ma age of mineralisation at Waihi/Favona. These preliminary data suggest that mineralisation in the Hauraki Goldfields occurred episodically. (author). 19 refs., 3 figs., 1 tab

  9. Dicty_cDB: FC-AR11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR11 (Link to dictyBase) - - - Contig-U14938-1 FC-AR11E (Li...nk to Original site) - - - - - - FC-AR11E 918 Show FC-AR11 Library FC (Link to library) Clone ID FC-AR11 (Li... 8.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: endoplasmic reticulum >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR11Q.Seq.d/ Representative seq. ID FC-AR...11E (Link to Original site) Representative DNA sequence >FC-AR11 (FC-AR11Q) /CSM/FC/FC-AR/FC-AR11Q.Seq.

  10. Dicty_cDB: FC-AR19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR19 (Link to dictyBase) - - - Contig-U16521-1 FC-AR19Z (Li...nk to Original site) - - FC-AR19Z 565 - - - - Show FC-AR19 Library FC (Link to library) Clone ID FC-AR19 (Li... 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR19 is .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR19Q.Seq.d/ Representative seq. ID FC-AR...19Z (Link to Original site) Representative DNA sequence >FC-AR19 (FC-AR19Q) /CSM/FC/FC-AR/FC-AR19Q.Seq.

  11. Dicty_cDB: FC-AR15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR15 (Link to dictyBase) - - - Contig-U16022-1 FC-AR15E (Li...nk to Original site) - - - - - - FC-AR15E 390 Show FC-AR15 Library FC (Link to library) Clone ID FC-AR15 (Li..., including cell wall 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR15 is cyt 5' .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR15Q.Seq.d/ Representative seq. ID FC-AR...15E (Link to Original site) Representative DNA sequence >FC-AR15 (FC-AR15Q) /CSM/FC/FC-AR/FC-AR15Q.Seq.

  12. Dicty_cDB: FC-AR07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR07 (Link to dictyBase) - - - Contig-U16276-1 FC-AR07Z (Li...nk to Original site) - - FC-AR07Z 604 - - - - Show FC-AR07 Library FC (Link to library) Clone ID FC-AR07 (Li...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: cytoplasmic 36.0 %: nuclear 8.0 %: cytoskeletal 8.0 %: mitochondrial >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR07Q.Seq.d/ Representative seq. ID FC-AR...07Z (Link to Original site) Representative DNA sequence >FC-AR07 (FC-AR07Q) /CSM/FC/FC-AR/FC-AR07Q.Seq.

  13. Dicty_cDB: FC-AR24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR24 (Link to dictyBase) - G24050 DDB0191443 Contig-U16141-1 FC-AR...24E (Link to Original site) - - - - - - FC-AR24E 785 Show FC-AR24 Library FC (Link to library) Clone ID FC-AR...sicles of secretory system 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-AR...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR24Q.Se...q.d/ Representative seq. ID FC-AR24E (Link to Original site) Representative DNA sequence >FC-AR24 (FC-AR24Q) /CSM/FC/FC-AR/FC-AR

  14. Dicty_cDB: FC-AR13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR13 (Link to dictyBase) - - - Contig-U16456-1 FC-AR13Z (Li...nk to Original site) - - FC-AR13Z 550 - - - - Show FC-AR13 Library FC (Link to library) Clone ID FC-AR13 (Li... 8.0 %: mitochondrial 4.0 %: extracellular, including cell wall >> prediction for FC-AR13 is nuc 5' e.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR13Q.Seq.d/ Representative seq. ID FC-AR...13Z (Link to Original site) Representative DNA sequence >FC-AR13 (FC-AR13Q) /CSM/FC/FC-AR/FC-AR13Q.Seq.

  15. ``Smoking From The Same Pipe": Developement of an 40Ar/39Ar Datting Intercalibration PIpette System (Invited)

    Science.gov (United States)

    Turrin, B. D.; Swisher, C. C.; Deino, A.; Hemming, S. R.; Hodges, K.; Renne, P. R.

    2010-12-01

    The precision and accuracy of Ar isotope ratio measurements is one of the main limiting factors in the uncertainties of an 40Ar/39Ar age. Currently, it is relatively common to measure Ar isotopic ratios to a precision of 1-2‰ or better on an intralaboratory basis. This level of analytical precision equates to a comparable level of precision (1-3‰) in the calculated age, depending on the extent of atmospheric Ar contamination, importance of nucleogenic interference corrections, and other factors. However, it has become clear that improving the precision of mass spectrometry is not the only bottleneck towards improving the accuracy and precision of 40Ar/39Ar dating in general. Rather, the most urgent issue is interlaboratory reproducibility. This became obvious in a recent EARTHTIME initiative undertaken to intercalibrate two commonly used 40Ar/39Ar standards [the Fish Canyon sanidine (FCs) and the Alder Creek sanidine (ACs)]. This effort revealed variations amongst laboratories (at the 1-2% level), an order of magnitude greater than the internal analytical precisions. To address these issues, we have proposed (to NSF) to construct two identical pipette systems loaded to identical starting pressures and with identical isotopic compositions. One pipette system will travel between participating 40Ar/39Ar labs and the second system will not travel and serve as the “Master” system to test for any fractionation or undocumented depletion of the traveling pipette system. In order to ensure delivery of uniform amounts of homogenous gas, the pipette system will be computer-controlled with preprogrammed routines and lockouts to prevent compromising the reservoirs. The pipette systems will deliver three gas samples with different isotopic ratios at two different pressures/concentrations. One pipette bulb will be of atmospheric isotopic composition, and the other two pipette bulbs will have 40Ar*/39ArK ratios corresponding to co-irradiated ACs and FCs fixed by their

  16. 40Ar/39Ar geochronology and exhumation of mylonitized metamorphic complex in Changle-Nanao ductile shear zone

    Institute of Scientific and Technical Information of China (English)

    王志洪; 卢华复

    1997-01-01

    New 40Ar/39Ar plateau ages from rocks of Changle-Nanao ductile shear zone are 107.9 Ma(Mus), 108.2 Ma(Bi), 107. 1 Ma(Bi), 109. 2 Ma(Hb) and 117. 9 Ma(Bi) respectively, which are concordant with their isochron ages and record the formation age of the ductile shear zone. The similarity and apparent overlap of the cooling ages with respective closure temperatures of 5 minerals document initial rapid uplift during 107-118 Ma following the collision between the Min-Tai microcontinent and the Min-Zhe Mesozoic volcanic arc. The 40Ar/39Ar plateau ages, K-Ar date of K-feldspar and other geochronologic information suggest that the exhumation rate of the ductile shear zone is about 0.18-1.12 mm/a in the range of 107-70 Ma, which is mainly influenced by tectonic extension.

  17. New 40Ar/39Ar dates of adularia from epithermal deposits in the Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar dates of vein and wall rock adularia from seven epithermal deposits and one porphyry copper prospect help constrain the ages of mineralisation in the Hauraki Goldfield. Vein adularia from the Paritu region yielded a single 40Ar/39Ar plateau date of 16.315 ± 0.066 Ma. Five 40Ar/39Ar plateau dates of three samples of vein adularia from the Opitonui deposit overlap within error to yield a preferred age of 13.149 ± 0.016 Ma. Two samples of vein adularia from the Night Reef at the Broken Hills deposit yield exceptionally flat 40Ar/39Ar plateaus, and all date overlap within error to provide an age of 7.121 ± 0.010 Ma. Two 40Ar/39Ar plateau dates of one sample of vein adularia from the Wharekirauponga deposit overlap within error to provide an age of 6.318 ± 0.061 Ma. Four 40Ar/39Ar plateau dates of three samples of vein adularia from the Maratoto deposit overlap within error to provide an age of 6.411 ± 0.022 Ma. Two samples of adularia from altered wall rock at the Sovereign deposit yield three 40Ar/39Ar plateau dates that range from 6.547 ± 0.021 Ma to 6.806 ± 0.028 Ma. This suggest that mineralisation formed around 6.6 Ma, but the results are complicated because the adularia contains minor illite that post-dates adularia formation. Results from the Karangahake deposit are complex. Two samples of vein adularia yield three 40Ar/39Ar plateau dates that range from 6.116 ± 0.116 Ma to 6.901 ± 0.101 Ma, wheras one sample of wall rock adularia that contains minor late illite yields two 40Ar/39Ar plateau dates that overlap within error to provide a date of 5.734 ± 0.041. The range of dates indicates that more work is necessary to understand the history of mineralisation at this deposit. Two samples of vein adularia from the Tui deposit yield four 40Ar/39Ar plateau dates that overlap within error to provide an age of 5.714 ± 0.017 Ma. These results confirm previous work that indicates that the ages of epithermal deposit young southward in the Hauraki

  18. Recombination measurements at low energies with Ar16+ and Ar18+ ions in a dense, cold electron target

    International Nuclear Information System (INIS)

    Recombination of multiply charged ions with electrons at very low relative energies has become a major topic of interest, due to the observation of rates which are enhanced beyond the expectations for radiative recombination. We present results for Ar16+ and Ar18+ ions from systematic measurements along the argon isonuclear sequence using a high density cold electron beam target (ne = 7 x 109 cm-3) at the UNILAC of GSI. The transverse and longitudinal temperatures of the electron beam were determined from DR resonance features observed with metastable Ar16+ (23S) ions. The rate at Erel = 0 for radiative recombination of completely stripped Ar18+ calculated with electron beam temperatures kTparallel = 0.002 eV, kTperpendicular = 0.2 eV amounts to α = 10-9 cm3 s-1. This is exceeded by nearly a factor of 10 by the rate measured in experiments with Ar18+ ions

  19. Evaluation of the IPCC Models (AR4 and AR5) in the Precipitation Simulation in the Northeast of Brazil

    Science.gov (United States)

    Alves, José; Vasconcelos Junior, Francisco; Chaves, Rosane; Silva, Emerson; Servain, Jacques; Costa, Alexandre; Sombra, Sérgio; Barbosa, Augusto; Dos Santos, Antonio

    2016-04-01

    With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC), comparative studies are necessary between observations and the so-called historical run (C20) and future projections of the AR4 (A2) and AR5 (RCP8.5) experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5) in representing the anuall average and seasonal rainfall variation (summer and autumn) in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation) data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  20. Evaluation of the IPCC Models (AR4 and AR5 in the Precipitation Simulation in the Northeast of Brazil

    Directory of Open Access Journals (Sweden)

    José Brabo Alves

    2016-04-01

    Full Text Available With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC, comparative studies are necessary between observations and the so-called historical run (C20 and future projections of the AR4 (A2 and AR5 (RCP8.5 experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5 in representing the anuall average and seasonal rainfall variation (summer and autumn in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  1. Ar-Ar investigations on Quarternary volcanic sequences of Monte Vulture (Southern Italy)

    Science.gov (United States)

    Buettner, A.; Principe, C.; Villa, I. M.

    2003-04-01

    Volcanic sanidines and phlogopites from feldspathoid- or sanidine-bearing volcanic sequences of Monte Vulture (Southern Italy) were analysed using Ar-Ar stepwise heating. In all samples phlogopite and sanidine are internally inhomogeneous as observed in a plot of Cl/K ratio vs step-age. At least two phases that are degassed during different temperature steps can be distinguished, resulting in internal discordance. Hence, all samples are affected by impurities and have to be treated as heterochemical mixtures. These effects are strongest in phlogopite. The high uncertainty of the calculated ages mirrors the statistically significant age discordance. The calculation of average ages was focused on isochemical steps. Isochron calculations necessarily give less precise ages because of the excessive scatter of datapoints. Moreover, most coarse grained phlogopites could contain excess 40Ar (as suggested by non-atmospheric intercepts in isochron plots) which could be of mantle origin. The analysed phlogopites from carbonatitic and melilite-foiditolite rocks of the upper stratigraphical sequence of Monte Vulture are Mg-rich, which indicates a mantle provenance (Stoppa and Woolley, 1997). All calculated phlogopite ages have, therefore, to be considered with caution. One sample, PG5, contains both sanidine and matrix phlogopite. This offers the possibility to directly compare the analytical results and further decipher possible inconsistencies. Ages were calculated as the average of isochemical steps, and errors are indicated at the 95% confidence level. Sanidine gives a weighted average age of 752±13 ka in agreement with the phlogopite age of 801±88 ka. In comparison to these average step ages, an isochron over five sanidine-steps yields an age of 737±35 ka (MSWD=1.5) and an atmospheric intercept of 295±49. The eruptive time-span covered by the analysed samples is 75±20 ka, confirming that the eruption history of Monte Vulture has been organised in clusters of activity

  2. Estudo das pressões no interior dos balonetes de tubos traqueais

    Directory of Open Access Journals (Sweden)

    Aranha André Galante Alencar

    2003-01-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Como não é rotineiro o controle da pressão no interior dos balonetes de tubos traqueais, e não há descrição detalhada na literatura de como mantê-la abaixo dos 30 cmH2O sem utilização de manômetro, decidiu-se verificar as pressões no interior de balonetes de tubos traqueais em pacientes sob intubação traqueal na unidade de terapia intensiva e no cento cirúrgico, testando manobra para manter a pressão no balonete abaixo de 30 cmH2O, mas em níveis mínimos necessários para ciclagem do ventilador sem perda do volume corrente. MÉTODO: Foram estudadas as pressões no interior de balonetes de tubos traqueais de 50 pacientes sob intubação traqueal na unidade de terapia intensiva (Grupo I e 72 pacientes sob intubação traqueal no centro cirúrgico (Grupo II. Testou-se uma manobra para obter a pressão mínima no interior do balonete do tubo traqueal, necessária para adequada ventilação, sem vazamento de ar. Registrou-se a pressão inicial (P1 no interior dos balonetes dos tubos traqueais utilizando-se manômetro digital graduado em centímetros de água, acoplado a seringa de 15 ml. Aspirou-se secreção da orofaringe. Com o meato acústico externo do examinador próximo da boca do paciente entre 10 e 20 cm, conectou-se o manômetro ao balonete, que foi esvaziado lentamente, até se ouvir ruído em sopro, pelo vazamento do volume corrente no período inspiratório da ventilação artificial. Neste momento, encheu-se lentamente o balonete até o desaparecimento do ruído. Anotou-se a pressão final (P2 do balonete e o volume de ar que restou na seringa do manômetro (V. RESULTADOS: As médias das pressões P1 nos grupos I e II foram 85,3 e 56,2 cmH2O, respectivamente. As médias de pressões P2 nos grupos I e II foram 26,7 e 15,5 cmH2O respectivamente. Após a manobra testada, o desvio padrão baixou de 56,3 para 8,2 no grupo I, e de 48 para 6,7 no grupo II. No grupo I, a manobra reduziu o volume e a

  3. Surface modification and biocompatible improvement of polystyrene film by Ar, O2 and Ar + O2 plasma

    International Nuclear Information System (INIS)

    Highlights: ► NVP is successfully grafted onto the different discharge gases (Ar, O2, and Ar + O2) plasma-treated PS film surface by Ar plasma induced graft polymerization. ► Compare with Ar and O2 plasma, the Ar + O2 plasma-treated film surface introduced large amounts of NVP, as known from ATR-FTIR and XPS results. ► According to SEM, the surface roughness increased at different levels after plasma treatment. Contact angle reveal that the hydrophilicity of the PS film surface was greatly improved. ► Cellular compatibility tests indicate that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. - Abstract: This paper reports the surface modification of different discharge gases (Ar, O2, and Ar + O2) plasma-treated polystyrene (PS) film by Ar plasma induced graft polymerization, with biocompatible monomer N-vinyl-2-pyrrolidone (NVP) is carried out to improve biocompatibility. The films are characterized by attenuated total reflectance Fourier transfer infrared (ATR-FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS) and scanning electron microscopy (SEM). Water contact angle measurement demonstrates the modified films possess a relatively hydrophilic surface. Furthermore, the films are also examined cell attachment and proliferation in vitro using mouse fibroblasts (L929 cells). The modified film surface shows a better cell distribution and growth than that of the pristine PS surface. From cell culture experiments, it is also observed that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. This method will provide a potential and effective solution for grafting useful component in future tissue-engineering applications.

  4. A new approach to cosmogenic corrections in 40Ar/39Ar chronometry: Implications for the ages of Martian meteorites

    Science.gov (United States)

    Cassata, W. S.; Borg, L. E.

    2016-08-01

    Anomalously old 40Ar/39Ar ages are commonly obtained from Shergottites and are generally attributed to uncertainties regarding the isotopic composition of the trapped component and/or the presence of excess 40Ar. Old ages can also be obtained if inaccurate corrections for cosmogenic 36Ar are applied. Current methods for making the cosmogenic correction require simplifying assumptions regarding the spatial homogeneity of target elements for cosmogenic production and the distribution of cosmogenic nuclides relative to trapped and reactor-derived Ar isotopes. To mitigate uncertainties arising from these assumptions, a new cosmogenic correction approach utilizing the exposure age determined on an un-irradiated aliquot and step-wise production rate estimates that account for spatial variations in Ca and K is described. Data obtained from NWA 4468 and an unofficial pairing of NWA 2975, which yield anomalously old ages when corrected for cosmogenic 36Ar using conventional techniques, are used to illustrate the efficacy of this new approach. For these samples, anomalous age determinations are rectified solely by the improved cosmogenic correction technique described herein. Ages of 188 ± 17 and 184 ± 17 Ma are obtained for NWA 4468 and NWA 2975, respectively, both of which are indistinguishable from ages obtained by other radioisotopic systems. For other Shergottites that have multiple trapped components, have experienced diffusive loss of Ar, or contain excess Ar, more accurate cosmogenic corrections may aid in the interpretation of anomalous ages. The trapped 40Ar/36Ar ratios inferred from inverse isochron diagrams obtained from NWA 4468 and NWA 2975 are significantly lower than the Martian atmospheric value, and may represent upper mantle or crustal components.

  5. Ar Ar dating of authigenic K-feldspar: Quantitative modelling of radiogenic argon-loss through subgrain boundary networks

    Science.gov (United States)

    Mark, D. F.; Kelley, S. P.; Lee, M. R.; Parnell, J.; Sherlock, S. C.; Brown, D. J.

    2008-06-01

    We have analysed two distinct generations of authigenic K-feldspar in Fucoid Bed sandstones from An-t-Sron and Skiag Bridge, NW Highlands, Scotland, which have experienced post-growth heating to levels in excess of the predicted Ar-closure temperature. Authigenic K-feldspars show microtextural similarities to patch perthites; that is subgrains separated by dislocation-rich boundary networks that potentially act as fast diffusion pathways for radiogenic argon. The two generations of authigenic K-feldspar in the Fucoid Bed sandstones can be distinguished by different microtextural zones, bulk mineral compositions, fluid-inclusion populations, and inferred temperatures and chemistries of parent fluids. Ar-Ar age data obtained using high-resolution ultraviolet laser ablation, show that the first cementing generation is Ordovician and the second cementing generation is Silurian. Modelling of Ar diffusion using subgrain size as the effective diffusion dimension and a simplified tectono-thermal thrust model assuming transient heating of the Fucoid Beds is inconsistent with observed data. Removal of heat from the thrust zone through rapid flushing of heated fluids rather than transient heating can be invoked to explain the observed Ar-Ar ages for both generations of cement. Alternatively, Ar-diffusion modelling using overgrowth thickness as the effective diffusion dimension instead of subgrain size also yields models that are consistent with both the Fucoid Bed palaeothermal maxima and determined Ar-Ar age ages for the two generations of K-feldspar cement. Based on this alternate explanation, we propose a theoretical microtextural model that highlights fundamental differences between the microtextures of deuterically formed patch perthites and authigenic K-feldspars, explaining the apparent robustness of authigenic K-feldspar with respect to Ar-retention.

  6. New 40Ar/39Ar Ages From Southwest Bolivia Refine the Timing of APVC Volcanism

    Science.gov (United States)

    Salisbury, M.; de Silva, S. L.; Jicha, B.; Singer, B.; Jiménez, N.; Ort, M.

    2008-12-01

    The Altiplano-Puna Volcanic Complex (APVC) of the Central Andes has produced prodigious silicic volcanism (at least 11,000 km3 of magma) over the last 10 Ma including some of the largest known ignimbrites on Earth. Despite excellent exposure, little previous work had been conducted on the timing and distribution of ignimbrite volcanism in the Lípez region of southwestern Bolivia, the heart of the APVC. To address this deficiency we have performed ~612 single crystal laser-fusion 40Ar/39Ar analyses from 39 pumice and bulk matrix samples collected from the main ignimbrite units within the Lípez region. Geochemistry of pumice and mineral samples, and paleomagnetic data are also being used to correlate individual ignimbrite units. Our new 40Ar/39Ar results establish new or refined eruption ages (with 2σ error) from the Vilama caldera at 8.41±0.02 Ma, Pastos Grandes caldera at 5.45±0.02 and 2.94±0.01 Ma, and Guacha caldera at 5.65±0.01, and 3.57±0.02 Ma. New ages were also determined for eruptions from the Panizos ignimbrite shield (6.86±0.03 Ma), Juvina ignimbrite shield (5.23±0.01 Ma), and the Laguna Colorado ignimbrite shield (2.21±0.05 and 1.95±0.03 Ma). The oldest ignimbrite we have found in the area is 10.33±0.64 Ma, a local unit beneath the Vilama ignimbrite. The youngest units have been identified west of the Guacha caldera with eruption ages of 1.70±0.6 Ma and 0.70±0.01 Ma. These results demonstrate that ignimbrite-producing eruptions in the Lípez region span the age of APVC volcanism previously established, with the largest eruptions occurring from long-lived, cyclic supervolcano caldera systems like Guacha and Pastos Grandes. The aggregate data from the APVC support the hypothesis that the APVC developed predominantly during distinct pulses of massive ignimbrite eruptions at ~8, 6, and 4 Ma and attest to episodic behavior of the magmatic system. Ignimbrites of geothermal presence and active local surface deformation suggest that the magma

  7. The Neutron Star Interior Composition Explorer (NICER)

    Science.gov (United States)

    Wilson-Hodge, Colleen A.; Gendreau, K.; Arzoumanian, Z.

    2014-01-01

    The Neutron Star Interior Composition Explorer (NICER) is an approved NASA Explorer Mission of Opportunity dedicated to the study of the extraordinary gravitational, electromagnetic, and nuclear-physics environments embodied by neutron stars. Scheduled to be launched in 2016 as an International Space Station payload, NICER will explore the exotic states of matter, using rotation-resolved spectroscopy of the thermal and non-thermal emissions of neutron stars in the soft (0.2-12 keV) X-ray band. Grazing-incidence "concentrator" optics coupled with silicon drift detectors, actively pointed for a full hemisphere of sky coverage, will provide photon-counting spectroscopy and timing registered to GPS time and position, with high throughput and relatively low background. The NICER project plans to implement a Guest Observer Program, which includes competitively selected user targets after the first year of flight operations. I will describe NICER and discuss ideas for potential Be/X-ray binary science.

  8. Wall grid structure for interior scene synthesis

    KAUST Repository

    Xu, Wenzhuo

    2015-02-01

    We present a system for automatically synthesizing a diverse set of semantically valid, and well-arranged 3D interior scenes for a given empty room shape. Unlike existing work on layout synthesis, that typically knows potentially needed 3D models and optimizes their location through cost functions, our technique performs the retrieval and placement of 3D models by discovering the relationships between the room space and the models\\' categories. This is enabled by a new analytical structure, called Wall Grid Structure, which jointly considers the categories and locations of 3D models. Our technique greatly reduces the amount of user intervention and provides users with suggestions and inspirations. We demonstrate the applicability of our approach on three types of scenarios: conference rooms, living rooms and bedrooms.

  9. Magnetic investigations for studying planetary interiors

    Directory of Open Access Journals (Sweden)

    A. De Santis

    1994-06-01

    Full Text Available Most of the magnetic methods used for investigating planetary interiors are based on the reasonable hypothesis that the mechanism for the origin of the field is an Earth-like hydromagnetic dynamo: in this case the planet has an electrically conducting fluid shell within it as in the case of the Earth's core. The present paper describes several techniques of planetary magnetic investigation which give important clues on the internal constitution of planets. Some considerations on the possible mechanisms for maintaining a dynamo and simple concepts with the help of a few non-dimensional numbers are also introduced and discussed. Then some fundamental relationships are given in order to relate the planetary magnetism to other physical parameters, such as angular rotation, core dimensions etc. It finally summarizes some results available for the planets of the Solar System.

  10. Interior design of the lunar outpost

    Science.gov (United States)

    Kennedy, Kriss J.

    1990-01-01

    This paper is part of an ongoing study on the interior design of a lunar outpost habitat facility. The concept presented represents the work done up to and including August 1989. This concept is part of NASA's ongoing effort to explore alternative options for planet surface systems habitation. Results of a volume analog study to determine the required pressurized volume are presented along with an internal layout of the habitat facility. The concept presented in this paper is a constructible lunar habitat that provides a living and working environment for a crew of 12. It is a 16-m diameter spherical pneumatic structure which contains 2145 cubic meters of volume. Five levels of living and working areas make up the 742 sq m of floor space. A 2-m vertical circulation shaft at the center allows for transfer of crew and equipment.

  11. A Survey on Web-based AR Applications

    CERN Document Server

    Parhizkar, Behrang; Lashkari, Arash Habibi; Bartaripou, Mohammad Mehdi; Babae, Hossein Reza

    2011-01-01

    Due to the increase of interest in Augmented Reality (AR), the potential uses of AR are increasing also. It can benefit the user in various fields such as education, business, medicine, and other. Augmented Reality supports the real environment with synthetic environment to give more details and meaning to the objects in the real word. AR refers to a situation in which the goal is to supplement a user's perception of the real-world through the addition of virtual objects. This paper is an attempt to make a survey of web-based Augmented Reality applications and make a comparison among them.

  12. Wellness- joogatyöpajojen tuotekehitys: case ArsMondo

    OpenAIRE

    Koukonen, Heidi; Lintunen, Maiju

    2012-01-01

    Tässä opinnäytetyössä tutkitaan, miten ArsMondo Oy:n joogamatkoja voisi kehittää entistä asiakaslähtöisempään suuntaan tulevaisuudessa. Aihe valittiin, sillä se on erittäin mielenkiintoinen ja ajankohtainen aihe matkailun alalla. ArsMondo on suomalainen kulttuurialan yritys, joka räätälöi kulttuuri- ja liikuntamatkoja Italiaan. Työ rajattiin vain ArsMondo- yrityksen joogamatkoihin Italiassa. Teoreettisessa viitekehyksessä avataan jooga- wellness- matkailun käsite sekä kerrotaan wellness- ...

  13. Mass Spectrometric and Langmuir Probe Measurements in Inductively Coupled Plasmas in Ar, CHF3/Ar and CHF3/Ar/O2 Mixtures

    Science.gov (United States)

    Kim, J. S.; Rao, M. V. V. S.; Cappelli, M. A.; Sharma, S. P.; Meyyappan, M.; Arnold, Jim (Technical Monitor)

    2000-01-01

    Absolute fluxes and energy distributions of ions in inductively coupled plasmas of Ar, CHF3/Ar, and CHF3/Ar/O2 have been measured. These plasmas were generated in a Gaseous Electronics Conference (GEC) cell modified for inductive coupling at pressures 10-50 mTorr and 100-300 W of 13.56 MHz radio frequency (RF) power in various feedgas mixtures. In pure Ar plasmas, the Ar(+) flux increases linearly with pressure as well as RF-power. Total ion flux in CHF3 mixtures decreases with increase in pressure and also CHF3 concentration. Relative ion fluxes observed in the present studies are analyzed with the help of available cross sections for electron impact ionization and charge-exchange ion-molecule reactions. Measurements of plasma potential, electron and ion number densities, electron energy distribution function, and mean electron energy have also been made in the center of the plasma with a RF compensated Langmuir probe. Plasma potential values are compared with the mean ion energies determined from the measured ion energy distributions and are consistent. Electron temperature, plasma potential, and mean ion energy vary inversely with pressure, but increase with CHF3 content in the mixture.

  14. Experimental study of NO2 reduction in N2/Ar and O2/Ar mixtures by pulsed corona discharge.

    Science.gov (United States)

    Zhu, Xinbo; Zheng, Chenghang; Gao, Xiang; Shen, Xu; Wang, Zhihua; Luo, Zhongyang; Cen, Kefa

    2014-11-01

    Non-thermal plasma technology has been regarded as a promising alternative technology for NOx removal. The understanding of NO2 reduction characteristics is extremely important since NO2 reduction could lower the total NO oxidation rate in the plasma atmosphere. In this study, NO2 reduction was experimentally investigated using a non-thermal plasma reactor driven by a pulsed power supply for different simulated gas compositions and operating parameters. The NO2 reduction was promoted by increasing the specific energy density (SED), and the highest conversion rates were 33.7%, 42.1% and 25.7% for Ar, N2/Ar and O2/Ar, respectively. For a given SED, the NO2 conversion rate had the order N2/Ar>Ar>O2/Ar. The highest energy yield of 3.31g/kWh was obtained in N2/Ar plasma and decreased with increasing SED; the same trends were also found in the other two gas compositions. The conversion rate decreased with increasing initial NO2 concentration. Furthermore, the presence of N2 or O2 led to different reaction pathways for NO2 conversion due to the formation of different dominating reactive radicals. PMID:25458679

  15. Dicty_cDB: FC-AR08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR08 (Link to dictyBase) - - - Contig-U15118-1 FC-AR08Z (Li...nk to Original site) - - FC-AR08Z 542 - - - - Show FC-AR08 Library FC (Link to library) Clone ID FC-AR08 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR08Q.Seq.d/ Representative seq. ID FC-AR...08Z (Link to Original site) Representative DNA sequence >FC-AR08 (FC-AR08Q) /CSM/FC/FC-AR/FC-AR08Q.Seq....esfilgfmgyr tscrynrwssqlpirycs*knddasrsc*yslfkhlgllgkdchp*rsncllqrcfikch qrfrwcfs

  16. Dicty_cDB: FC-AR06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR06 (Link to dictyBase) - - - - FC-AR06Z (Link to Original site) - - FC-AR...06Z 316 - - - - Show FC-AR06 Library FC (Link to library) Clone ID FC-AR06 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...06Q.Seq.d/ Representative seq. ID FC-AR06Z (Link to Original s...ite) Representative DNA sequence >FC-AR06 (FC-AR06Q) /CSM/FC/FC-AR/FC-AR06Q.Seq.d/ XXXXXXXXXXTGATCCAAGAAAAGG

  17. Dicty_cDB: FC-AR18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR18 (Link to dictyBase) - G03231 DDB0229952 Contig-U16528-1 FC-AR...18E (Link to Original site) - - - - - - FC-AR18E 567 Show FC-AR18 Library FC (Link to library) Clone ID FC-AR...8-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR18Q.Se...q.d/ Representative seq. ID FC-AR18E (Link to Original site) Representative DNA sequence >FC-AR18 (FC-AR18Q) /CSM/FC/FC-AR/FC-AR...QNRALVAGPHSGVERHIINFKWIN LTPLKVNIQRGARINTLIAAIKAADLETKIAALSAVKKINARATKSNQTDFERFKANLIR RKLNKKVSGEVKKLVNIANRAA

  18. Dicty_cDB: FC-AR14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR14 (Link to dictyBase) - - - Contig-U16311-1 FC-AR14Z (Li...nk to Original site) - - FC-AR14Z 593 - - - - Show FC-AR14 Library FC (Link to library) Clone ID FC-AR14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR14Q.Seq.d/ Representative seq. ID FC-AR...14Z (Link to Original site) Representative DNA sequence >FC-AR14 (FC-AR14Q) /CSM/FC/FC-AR/FC-AR14Q.Seq....epsin, complete cds. 72 8e-09 1 BP130435 |BP130435.1 Nicotiana tabacum cDNA, clone: BY2401, primer: M13 forwar

  19. Dicty_cDB: FC-AR09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR09 (Link to dictyBase) - - - Contig-U15312-1 FC-AR09E (Li...nk to Original site) - - - - - - FC-AR09E 702 Show FC-AR09 Library FC (Link to library) Clone ID FC-AR09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR09Q.Seq.d/ Representative seq. ID FC-AR...09E (Link to Original site) Representative DNA sequence >FC-AR09 (FC-AR09Q) /CSM/FC/FC-AR/FC-AR09Q.Seq....elfikr*kerqvc*nrldsleg*r*srrk *rcw*ir*l*ygwhgyatndarygwygrygwygrygwygrygrhgryarwy

  20. High-precision 40Ar/39Ar Age of the Janisjärvi Impact Structure (Russia)

    Science.gov (United States)

    Jourdan, F.; Renne, P. R.; Reimold, U. W.

    2007-12-01

    The ~14 km Jänisjärvi impact structure occurs within the Svecofennian Proterozoic terrains, in the southeastern part of the Baltic shield, Karelia, Russia. Previous K/Ar and 40Ar/39Ar studies were interpreted to give ages of 700 ± 5 Ma and 698 ± 22 Ma respectively, both results being difficult to interpret. Recent paleomagnetic results challenged those ages and propose instead ages of either 500 Ma or 850-900 Ma. In order to better constrain the age of the Jänisjärvi impact structure, we present new 40Ar/39Ar data for melt rocks from the crater. We obtained five concordant isochron ages (based on a total decay constant of 5.543 x 10-10/y and an age of 28.03 Ma for the FCs standard) that yield a combined isochron age of 682 ± 4 Ma (2 sigma) with a MSWD of 1.2, P = 0.14 and 40Ar/36Ar intercept of 475 ± 3. We suggest that this date indicates the age of the impact and therefore can be used in conjunction with existing paleomagnetic results to refine the position of the Baltica paleocontinent at this time. Argon isotopic results imply that melt homogenization has been achieved at the hundred-micron scale certainly because of the low-silica content of the molten target rock that allows fast 40Ar* diffusion in the melt. However, the large range of F(40Ar*inherited) (3 to 8 percents) observed for seven grains show that complete isotopic homogenization was not reached at the centimeter and perhaps millimeter scale. This result is in good agreement with previous Rb and Sr isotopic data.

  1. Single-crystal 40Ar/39Ar incremental heating reveals bimodal sanidine ages in the Bishop Tuff

    Science.gov (United States)

    Andersen, N. L.; Jicha, B. R.; Singer, B. S.

    2015-12-01

    The 650 km3 Bishop Tuff (BT) is among the most studied volcanic deposits because it is an extensive marker bed deposited just after the Matuyama-Brunhes boundary. Reconstructions of the vast BT magma reservoir from which high-silica rhyolite erupted have long influenced thinking about how large silicic magma systems are assembled, crystallized, and mixed. Yet, the longevity of the high silica rhyolitic melt and exact timing of the eruption remain controversial due to recent conflicting 40Ar/39Ar sanidine vs. SIMS and ID-TIMS U-Pb zircon dates. We have undertaken 21 40Ar/39Ar incremental heating ages on 2 mm BT sanidine crystals from pumice in 3 widely separated outcrops of early-erupted fall and flow units. Plateau ages yield a bimodal distribution: a younger group has a mean of 766 ka and an older group gives a range between 772 and 782 ka. The younger population is concordant with the youngest ID-TIMS and SIMS U-Pb zircon ages recently published, as well as the astronomical age of BT in marine sediment. Of 21 crystals, 17 yield older, non-plateau, steps likely affected by excess Ar that would bias traditional 40Ar/39Ar total crystal fusion ages. The small spread in older sanidine ages, together with 25+ kyr of pre-eruptive zircon growth, suggest that the older sanidines are not partially outgassed xenocrysts. A bimodal 40Ar/39Ar age distribution implies that some fraction of rhyolitic melt cooled below the Ar closure temperature at least 10 ky prior to eruption. We propose that rapid "thawing" of a crystalline mush layer released older crystals into rhyolitic melt from which sanidine also nucleated and grew immediately prior to the eruption. High precision 40Ar/39Ar dating can thus provide essential information on thermo-physical processes at the millenial time scale that are critical to interpreting U-Pb zircon age distributions that are complicated by large uncertainties associated with zircon-melt U-Th systematics.

  2. Hydrothermal fluids, argon isotopes and mineralization ages of the Fankou Pb-Zn deposit in south China: Insights from sphalerite 40Ar/39Ar progressive crushing

    Science.gov (United States)

    Jiang, Ying-De; Qiu, Hua-Ning; Xu, Yi-Gang

    2012-05-01

    Hydrothermal fluid geochemistry and mineralization timing are two important factors in the genesis of a hydrothermal deposit. 40Ar/39Ar analyses of fluid inclusions not only provide time constraints for the mineralization but also help to clarify the K-Ca-Cl-Ar characteristics for the ore-forming fluids. In this study, six sphalerite samples collected from the Fankou lead-zinc sulfide deposit are investigated by 40Ar/39Ar in vacuo crushing. Gases liberated from the early and late crushing steps exhibit distinct Ar isotopic compositions and 40Ar/39Ar apparent ages. Argon released in the early steps has much higher 40Ar and 38ArCl and lower 37ArCa contents than those in the late steps. The significant excess Ar (40ArE) extracted in the early crushing steps shows a strong correlation with 38ArCl with very high 40ArE/38ArCl ratios. In contrast, those of the late steps mainly consist of atmospheric Ar and K-correlated radiogenic Ar with a constant 40ArR/39ArK ratio and the atmospheric initial 40Ar/36Ar ratio. As a result, all samples yield similar declining age spectra: the fore segments with anomalously old apparent ages decline quickly in the early crushing steps and the rear ones are flat with concordant apparent ages in the late crushing steps. The data points of the early steps define linear correlations in plots of 40ArNA/39ArK vs. 38ArCl/39ArK and 38ArCl/40ArNA vs. 39ArK/40ArNA (NA for non-atmospheric) and most yield ages of 240-230 Ma. On the other hand, the data of the late steps always construct well-defined isochrons in the plots of 36ArA/40ArNA vs. 39ArK/40ArNA with consistent ages of ˜300 Ma. We interpret that gases released in the early steps were from the secondary fluid inclusions (SFIs) due to their distribution characteristics along cracks leading to be easily extracted, and those released in the later steps represented the contribution of the primary fluid inclusions (PFIs). The initial 40Ar/36Ar ratios of SFIs, much higher than the modern

  3. Eestlased ARS BALTICA 08-l Austrias / Jüri Hain

    Index Scriptorium Estoniae

    Hain, Jüri, 1941-

    2008-01-01

    Rahvusvaheline kunstinäitus "ARS BALTICA 08" Salzburgi näitusehoones Berchtoldvilla, kuraator Peter Rieder. Osalesid kunstnikud Eestist (Mare Vint, Marje Üksine, Andres Tolts, Tiiu Kirsipuu, Jüri Hain), Lätist, Leedust ja Soomest

  4. H- Beam Stripping Loss at Background Partial Pressure of Ar

    Institute of Scientific and Technical Information of China (English)

    Hu Chundong; Wang Shaohu; Hu Liqun

    2005-01-01

    It has been observed that H- current could be improved by adding Ar to H2 plasma.But due to a slower pumping speed for Ar with the existing pumping scheme, the tank pressure will increase quickly during the length of a beam pulse. Since H- stripping loss depends on the tank pressure and gas species, part of the H- beam can be converted to H0 and then H0 can be converted into H+ with background H2 and Ar gas thickness. Therefore, the H- beam current,measured by a Faraday cup, situated at a distance L from GG (ground grid), will decrease because it will be converted into a H+ current. This gives a ratio of the Faraday cup net current to the H- beam current before stripping at background partial pressure of Ar.

  5. The emission spectra of Ar, Kr and Xe + TEA

    Science.gov (United States)

    Suzuki, Masayo; Strock, Pierre; Sauli, Fabio; Charpak, Georges

    1987-03-01

    The emission spectra of Ar, Kr and Xe + 6% TEA gas mixtures are measured by using a single wire proportional counter as the emission source. Asymmetric emission bands are observed in the range of 270 to 350 nm, which can be attributed to the radiative deexcitation of excited TEA molecules. For the practical application of optical readout of avalanche chambers, the Ar + 2.0% TEA + 20% isobutane gas mixture is also examined, and nearly the same emission band is observed.

  6. Augmented Reality Computer-Aided Drawing (AR-CAD)

    OpenAIRE

    ECT Team, Purdue

    2007-01-01

    While Virtual Reality (VR) replaces the entire real world with virtual images, Augmented Reality (AR) superimposes virtual images on the real world. Augmented Reality (a most useful form of Mixed Reality (MR)) is a popular concept for using computers to overlay virtual information onto a view of the real world. In 2000, Phillip Dunston then at the University of Washington in Seattle and his research team presented the initial concept of AR CAD developed for supporting design and construction....

  7. Mercury's interior from MESSENGER geodetic measurements

    Science.gov (United States)

    Genova, Antonio; Mazarico, Erwan; Goossens, Sander; Lemoine, Frank G.; Neumann, Gregory A.; Smith, David E.; Zuber, Maria T.; Solomon, Sean C.

    2016-04-01

    The MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft completed more than 4 years of operations in orbit about Mercury. One of the main mission goals was the determination of the interior structure of Mercury enabled by geodetic observations of the topography, gravity field, rotation, and tides by the Mercury Laser Altimeter (MLA) and radio science system. MLA acquired over 25 million individual measurements of Mercury's shape that are mostly limited to the northern hemisphere because of MESSENGER's eccentric orbit. However, the lack of laser altimetry in the southern hemisphere has been partly compensated by ˜400 occultations of spacecraft radio signals. X-band radio tracking data collected by the NASA Deep Space Network (DSN) allowed the determination of Mercury's gravity field to spherical harmonic degree and order 100, the planet's obliquity, and the Love number k2. The combination of altimetry and radio measurements provides a powerful tool for the investigation of Mercury's orientation and tides, which enable a better understanding of the interior structure of the planet. The MLA measurements have been assembled into a digital elevation model (DEM) of the northern hemisphere. We then used individual altimetric measurements from the spacecraft for orbit determination, together with the radio tracking, over a continuous span of time using a batch least-squares filter. All observations were combined to recover directly the gravity field coefficients, obliquity, librations, and tides by minimizing the discrepancies between the computed observables and actual measurements. We will present the estimated 100×100 gravity field model, the obliquity, the Love number k2, and, for the first time, the tidal phase lag φ and the amplitude of the longitudinal libration from radio and altimetry data. The k2 phase provides information on Mercury's dissipation and mantle viscosity and allows a determination of the Q factor. A refinement of

  8. Optimal Power Flow by Interior Point and Non Interior Point Modern Optimization Algorithms

    Directory of Open Access Journals (Sweden)

    Marcin Połomski

    2013-03-01

    Full Text Available The idea of optimal power flow (OPF is to determine the optimal settings for control variables while respecting various constraints, and in general it is related to power system operational and planning optimization problems. A vast number of optimization methods have been applied to solve the OPF problem, but their performance is highly dependent on the size of a power system being optimized. The development of the OPF recently has tracked significant progress both in numerical optimization techniques and computer techniques application. In recent years, application of interior point methods to solve OPF problem has been paid great attention. This is due to the fact that IP methods are among the fastest algorithms, well suited to solve large-scale nonlinear optimization problems. This paper presents the primal-dual interior point method based optimal power flow algorithm and new variant of the non interior point method algorithm with application to optimal power flow problem. Described algorithms were implemented in custom software. The experiments show the usefulness of computational software and implemented algorithms for solving the optimal power flow problem, including the system model sizes comparable to the size of the National Power System.

  9. Effect and mechanism of AR-6 in experimental rheumatoid arthritis.

    Science.gov (United States)

    Sun, Shi-xue; Li, Yun-man; Fang, Wei-rong; Cheng, Peng; Liu, Lifang; Li, Fengwen

    2010-06-01

    The root of Clematis chinensis Osbeck has been used widely in rheumatoid arthritis in Chinese traditional medicine and AR-6 is a triterpene saponin isolated from it. In this present study, we investigated in vivo effects of oral AR-6 in chronic rat adjuvant-induced arthritis (AA) and in vitro effect in macrophage and synoviocytes cells. Arthritic scores and serum inflammatory mediators were evaluated 19 days after AA induction by endermic injection of Freund's complete adjuvant in Sprague-Dawley(S-D) rats. Oral administration of AR-6 to arthritic rats resulted in a clear decrease of clinical signs compared to untreated controls. The synoviocyte and macrophage response ex vivo were then analyzed. Anti-arthritic effects of AR-6 correlated with significant decrease of NO and TNF-alpha produced by peritoneal macrophages, ex vivo and in vitro. AR-6 also significant decreased the proliferation of synoviocyte. These data indicate that AR-6 is a potential anti-inflammatory therapeutic and preventive agent. PMID:19842015

  10. Role of expression techniques in interior architecture education

    OpenAIRE

    Özker, Serpil

    2014-01-01

    The Interior Architecture education is examined based on "sketching and presentation" within the framework of "design" by looking into the application patterns, materials used, education, processes and results of these two methods and by providing relevant examples. In the study discusses the knowledge of design, universities providing education, interior architecture presentation process, perspective and focuses on the role of expression techniques in the interior Architecture education. In ...

  11. Marketing and selling techniques for interior design services

    OpenAIRE

    Çetinkaya, Kaan

    1995-01-01

    Ankara : Department of Interior Architecture and Environmental Design and Institute of Fine Arts of Bilkent University, 1995. Thesis (Master's) -- Bilkent University, 1995. Includes bibliographical references leaves 76-79. Throughout the thesis marketing and selling techniques for interior design services are examined. The emergence of marketing professional services and the reasons that create the needs for marketing interior design services are stated. Methods of analyzing client n...

  12. 40Ar/39Ar Dating of the Brunhes-Matuyama Geomagnetic Field Reversal.

    Science.gov (United States)

    Baksi, A K; Hsu, V; McWilliams, M O; Farrar, E

    1992-04-17

    Magnetostratigraphic studies are widely used in conjunction with the geomagnetic polarity time scale (GPTS) to date events in the range 0 to 5 million years ago. A critical tie point on the GPTS is the potassium-argon age of the most recent (Brunhes-Matuyama) geomagnetic field reversal. Astronomical values for the forcing frequencies observed in the oxygen isotope record in Ocean Drilling Project site 677 suggest that the age of this last reversal is 780 ka (thousand years ago), whereas the potassium-argon-based estimate is 730 ka. Results from 4039; Ar incremental heating studies on a series of lavas from Maui that straddle the Brunhes-Matuyama reversal give an age of 783 + 11 ka, in agreement with the astronomically derived value. The astronomically based technique appears to be a viable tool for dating young sedimentary sequences. PMID:17743111

  13. Interior of black holes and information recovery

    Science.gov (United States)

    Kawai, Hikaru; Yokokura, Yuki

    2016-02-01

    We analyze time evolution of a spherically symmetric collapsing matter from a point of view that black holes evaporate by nature. We first consider a spherical thin shell that falls in the metric of an evaporating Schwarzschild black hole of which the radius a (t ) decreases in time. The important point is that the shell can never reach a (t ) but it approaches a (t )-a (t )d/a (t ) d t . This situation holds at any radius because the motion of a shell in a spherically symmetric system is not affected by the outside. In this way, we find that the collapsing matter evaporates without forming a horizon. Nevertheless, a Hawking-like radiation is created in the metric, and the object looks the same as a conventional black hole from the outside. We then discuss how the information of the matter is recovered. We also consider a black hole that is adiabatically grown in the heat bath and obtain the interior metric. We show that it is the self-consistent solution of Gμ ν=8 π G ⟨Tμ ν⟩ and that the four-dimensional Weyl anomaly induces the radiation and a strong angular pressure. Finally, we analyze the internal structures of the charged and the slowly rotating black holes.

  14. Magnetism and the interior of the moon

    Science.gov (United States)

    Dyal, P.; Parkin, C. W.; Daily, W. D.

    1974-01-01

    During the time period 1961-1972, 11 magnetometers were sent to the moon. The primary purpose of this paper is to review the results of lunar magnetometer data analysis, with emphasis on the lunar interior. Magnetic fields have been measured on the lunar surface at the Apollo 12, 14, 15, and 16 landing sites. The remanent field values at these sites are 38, 103 (maximum), 3, and 327 gammas (maximum), respectively. Simultaneous magnetic field and solar plasma pressure measurements show that the Apollo 12 and 16 remanent fields are compressed during times of high plasma dynamic pressure. Apollo 15 and 16 subsatellite magnetometers have mapped in detail the field above portions of the lunar surface and have placed an upper limit on the global permanent dipole moment. Satellite and surface measurements show strong evidence that the lunar crust is magnetized over much of the lunar globe. Magnetic fields are stronger in highland regions than in mare regions and stronger on the lunar far side than on the near side. The largest magnetic anomaly measured to date is between the craters Van de Graaff and Aitken on the lunar far side.

  15. Capillary Flow in an Interior Corner

    Science.gov (United States)

    Weislogel, Mark Milton

    1996-01-01

    The design of fluids management processes in the low-gravity environment of space requires an accurate model and description of capillarity-controlled flow in containers of irregular geometry. Here we consider the capillary rise of a fluid along an interior corner of a container following a rapid reduction in gravity. The analytical portion of the work presents an asymptotic formulation in the limit of a slender fluid column, slight surface curvature along the corner, small inertia, and low gravity. New similarity solutions are found and a list of closed form expressions is provided for flow rate and column length. In particular, it is found that the flow is proportional to t(exp 1/2) for a constant height boundary condition, t(exp 2/5) for a spreading drop, and t(exp 3/5) for constant flow. In the experimental portion of the work, measurements from a 2.2s drop tower are reported. An extensive data set, collected over a previously unexplored range of flow parameters, includes estimates of repeatability and accuracy, the role of inertia and column slenderness, and the effects of corner angle, container geometry, and fluid properties. Comprehensive comparisons are made which illustrate the applicability of the analytic results to low-g fluid systems design.

  16. Full Waveform Inversion of Solar Interior Flows

    CERN Document Server

    Hanasoge, Shravan M

    2014-01-01

    The inference of flows of material in the interior of the Sun is a subject of major interest in helioseismology. Here we apply techniques of Full Waveform Inversion (FWI) to synthetic data to test flow inversions. In this idealized setup, we do not model seismic realization noise, training the focus entirely on the problem of whether a chosen supergranulation flow model can be seismically recovered. We define the misfit functional as a sum of L_2 norm deviations in travel times between prediction and observation, as measured using short-distance f and p_1 filtered and large-distance unfiltered $p$ modes. FWI allows for the introduction of measurements of choice and iteratively improving the background model, while monitoring the evolution of the misfit in all desired categories. Although the misfit is seen to uniformly reduce in all categories, convergence to the true model is very slow, possibly because it is trapped in a local minimum. The primary source of error is inaccurate depth localization, which, owi...

  17. Volcanic history and 40Ar/39Ar and 14C geochronology of Terceira Island, Azores, Portugal

    Science.gov (United States)

    Calvert, A.T.; Moore, R.B.; McGeehin, J.P.; Rodrigues da Silva, A.M.

    2006-01-01

    Seven new 40Ar/39Ar and 23 new radiocarbon ages of eruptive units, in support of new geologic mapping, improve the known chronology of Middle to Late Pleistocene and Holocene volcanic activity on the island of Terceira, Azores and define an east-to-west progression in stratovolcano growth. The argon ages indicate that Cinco Picos Volcano, the oldest on Terceira, completed its main subaerial cone building activity by about 370-380??ka. Collapse of the upper part of the stratovolcanic edifice to form a 7 ?? 9??km caldera occurred some time after 370??ka. Postcaldera eruptions of basalt from cinder cones on and near the caldera floor and trachytic pyroclastic flow and pumice fall deposits from younger volcanoes west of Cinco Picos have refilled much of the caldera. The southern portion of Guilherme Moniz Volcano, in the central part of the island, began erupting prior to 270??ka and produced trachyte domes, flows, and minor pyroclastic deposits until at least 111??ka. The northern part of Guilherme Moniz Caldera is less well exposed than the southern part, but reflects a similar age range. The northwest portion of the caldera was formed sometime after 44??ka. Several well-studied ignimbrites that blanket much of the island likely erupted from Guilherme Moniz Volcano. The Pico Alto Volcanic Center, a tightly spaced cluster of trachyte domes and short flows, is a younger part of Guilherme Moniz Volcano. Stratigraphic studies and our new radiocarbon ages suggest that most of the Pico Alto eruptions occurred during the period from about 9000 to 1000??years BP. Santa Barbara Volcano is the youngest stratovolcano on Terceira, began erupting prior to 29??ka, and has been active historically. ?? 2006.

  18. Chronostratigraphy of Monte Vulture volcano (southern Italy): secondary mineral microtextures and 39Ar-40Ar systematics

    Science.gov (United States)

    Villa, Igor M.; Buettner, Annett

    2009-12-01

    The eruptive history of Monte Vulture has been the subject of several geochronological investigations during the past decades, which reliably dated only a small number of eruptions. Understanding the causes of sub-optimum data yield in the past requires an interdisciplinary approach. We re-analyzed samples from previous works and present new data on samples from the main volcano-stratigraphic units of Monte Vulture, so as to provide an improved, consistent chronostratigraphic database. Imaging of minerals by cathodoluminescence and backscattered electrons reveals that heterochemical, high-temperature deuteric reaction textures are ubiquitous. Such observations are common in metamorphic rocks but had not frequently been reported from volcanic rocks. In view of the mineralogical complexity, we base our chronological interpretation on isochemical steps, defined as steps for which the Cl/K and/or the Ca/K ratios are constant. Isochemical steps carry the isotopic signature of chemically homogeneous mineral phases and therefore allow a well-constrained age interpretation. Comparison of old and new 39Ar-40Ar data proves the reproducibility of age spectra and their shapes. This quantifies the analytical reliability of the irradiation and mass-spectrometric analyses. Anomalous age spectra are a reproducible property of some specific samples and correlate with mineralogical anomalies. The present data allow us to fine-tune the age of the volcanostratigraphic units of Monte Vulture during the known interval of main volcanic activity from ca. 740 to 610 ka. After a very long stasis, the volcanic activity in the Monte Vulture area resumed with diatremic eruptions, one of which (Lago Piccolo di Monticchio, the site of a palynological-paleoclimatological drilling) was dated at ca. 140 ka.

  19. 40Ar/39Ar age evidence for Altyn fault tectonic activities in western China

    Institute of Scientific and Technical Information of China (English)

    LIU Yongjiang; J. Genser; GE Xiaohong; F. Neubauer; G. Friedl; CHANG Lihua; REN Shoumai; R. Handler

    2003-01-01

    Four 40Ar/39Ar age groups of mica, hornblende and K-feldspar were obtained from Proterozoic and early Paleozoic metamorphic rocks in the Aksay-Dangjin Pass area, western China. The samples away from the middle shear zone of the Altyn fault belt yield two plateau age groups in the range of 461-445.2 Ma and 414.9-342.8 Ma, respectively. They represent the tectono-thermal events that had been recorded in the rocks that were displaced by the Altyn strike-slip fault in late Ordovician-early Silurian and Devonian, respectively. These two age groups should be related to the closures of Northern and Southern Qilian Oceans. The deformed granitic gneiss from the northern belt gives a plateau age group of 178.4-137.5 Ma, which is interpreted as the active age of the Altyn fault in the middle-late Jurassic- early Cretaceous and should be related to the accretion of Lhasa block to the north. The sample from the middle shear zone of the Altyn fault belt yields two plateau ages of 36.4 and 26.3 Ma, respectively, suggesting the strike-slip movement with strong metamorphism at greenschist facies along the Altyn fault in the late Eocene. This event occurred in the most areas of the northern Tibet Plateau and should be in response in the north to the collision between Indian and Eurasian continents. The present study demonstrates that the Altyn fault is characterized by multiple pulse-style activities under the tectonic setting of convergence between the Indian and Eurasian continents.

  20. Advanced Acoustic Blankets for Improved Aircraft Interior Noise Reduction Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In this project advanced acoustic blankets for improved low frequency interior noise control in aircraft will be developed and demonstrated. The improved...

  1. Combined U-Th/He and 40Ar/39Ar geochronology of post-shield lavas from the Mauna Kea and Kohala volcanoes, Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Aciego, S.M.; Jourdan, F.; DePaolo, D.J.; Kennedy, B.M.; Renne, P.R.; Sims, K.W.W.

    2009-10-01

    Late Quaternary, post-shield lavas from the Mauna Kea and Kohala volcanoes on the Big Island of Hawaii have been dated using the {sup 40}Ar/{sup 39}Ar and U-Th/He methods. The objective of the study is to compare the recently demonstrated U-Th/He age method, which uses basaltic olivine phenocrysts, with {sup 40}Ar/{sup 39}Ar ages measured on groundmass from the same samples. As a corollary, the age data also increase the precision of the chronology of volcanism on the Big Island. For the U-Th/He ages, U, Th and He concentrations and isotopes were measured to account for U-series disequilibrium and initial He. Single analyses U-Th/He ages for Hamakua lavas from Mauna Kea are 87 {+-} 40 ka to 119 {+-} 23 ka (2{sigma} uncertainties), which are in general equal to or younger than {sup 40}Ar/{sup 39}Ar ages. Basalt from the Polulu sequence on Kohala gives a U-Th/He age of 354 {+-} 54 ka and a {sup 40}Ar/{sup 39}Ar age of 450 {+-} 40 ka. All of the U-Th/He ages, and all but one spurious {sup 40}Ar/{sup 39}Ar ages conform to the previously proposed stratigraphy and published {sup 14}C and K-Ar ages. The ages also compare favorably to U-Th whole rock-olivine ages calculated from {sup 238}U - {sup 230}Th disequilibria. The U-Th/He and {sup 40}Ar/{sup 39}Ar results agree best where there is a relatively large amount of radiogenic {sup 40}Ar (>10%), and where the {sup 40}Ar/{sup 36}Ar intercept calculated from the Ar isochron diagram is close to the atmospheric value. In two cases, it is not clear why U-Th/He and {sup 40}Ar/{sup 39}Ar ages do not agree within uncertainty. U-Th/He and {sup 40}Ar/{sup 39}Ar results diverge the most on a low-K transitional tholeiitic basalt with abundant olivine. For the most alkalic basalts with negligible olivine phenocrysts, U-Th/He ages were unattainable while {sup 40}Ar/{sup 39}Ar results provide good precision even on ages as low as 19 {+-} 4 ka. Hence, the strengths and weaknesses of the U-Th/He and {sup 40}Ar/{sup 39}Ar methods are

  2. Transpressional tectonics and Carboniferous magmatism in the Limousin, Massif Central, France:structural and 40Ar/39Ar investigations.

    OpenAIRE

    Gébelin, Aude; Brunel, Maurice; Monié, Patrick; Faure, Michel; Arnaud, Nicolas

    2007-01-01

    New structural, microstructural, and 40Ar/39Ar data from the NW Massif Central (France) provide additional constraints on the timing and tectonic setting of late Variscan granite magmatism. Previous studies had emphasized the role of late orogenic extension in the emplacement of granite plutons in the Limousin region. In contrast, the new data set is consistent with syntectonic emplacement of magma in a dextral simple shear active from 350 to 300 Ma in a transpressional regime. As an alternat...

  3. Detailed Ar-40/Ar-39 dating of geologic events associated with the Mantos Blancos copper deposit, northern Chile

    OpenAIRE

    Oliveros, V.; Feraud, G.; L. Aguirre; Ramirez, L.; Fornari, Michel; Palacios, C.; Parada, M.

    2008-01-01

    The Ar-40/Ar-39 geochronological method was applied to date magmatic and hydrothermal alteration events in the Mantos Blancos mining district in the Coastal Cordillera of northern Chile, allowing the distinction of two separate mineralization events. The Late Jurassic Mantos Blancos orebody, hosted in Jurassic volcanic rocks, is a magmatic-hydrothermal breccia-style Cu deposit. Two superimposed mineralization events have been recently proposed. The first event is accompanied by a phyllic hydr...

  4. A Late Mesoproterozoic 40Ar/39Ar age for a melt breccia from the Keurusselkä impact structure, Finland

    Science.gov (United States)

    Schmieder, Martin; Jourdan, Fred; Moilanen, Jarmo; Buchner, Elmar; Öhman, Teemu

    2016-02-01

    Field investigations in the eroded central uplift of the ≤30 km Keurusselkä impact structure, Finland, revealed a thin, dark melt vein that intersects the autochthonous shatter cone-bearing target rocks near the homestead of Kirkkoranta, close to the center of the impact structure. The petrographic analysis of quartz in this melt breccia and the wall rock granite indicate weak shock metamorphic overprint not exceeding ~8-10 GPa. The mode of occurrence and composition of the melt breccia suggest its formation as some kind of pseudotachylitic breccia. 40Ar/39Ar dating of dark and clast-poor whole-rock chips yielded five concordant Late Mesoproterozoic miniplateau ages and one plateau age of 1151 ± 10 Ma [± 11 Ma] (2σ; MSWD = 0.11; P = 0.98), considered here as the statistically most robust age for the rock. The new 40Ar/39Ar age is incompatible with ~1.88 Ga Svecofennian tectonism and magmatism in south-central Finland and probably reflects the Keurusselkä impact, followed by impact-induced hydrothermal chloritization of the crater basement. In keeping with the crosscutting relationships in the outcrop and the possible influence of postimpact alteration, the Late Mesoproterozoic 40Ar/39Ar age of ~1150 Ma should be treated as a minimum age for the impact. The new 40Ar/39Ar results are consistent with paleomagnetic results that suggested a similar age for Keurusselkä, which is shown to be one of the oldest impact structures currently known in Europe and worldwide.

  5. 40Ar-39Ar age of a lava flow from the Bhimashankar Formation, Giravali Ghat, Deccan Traps

    Indian Academy of Sciences (India)

    Kanchan Pande; S K Pattanayak; K V Subbarao; P Navaneethakrishnan; T R Venkatesan

    2004-12-01

    We report here a 40Ar-39Ar age of 66.0 ± 0.9Ma (2 ) for a reversely magnetised tholeiitic lava flow from the Bhimashankar Formation (Fm.), Giravali Ghat, western Deccan province, India. This age is consistent with the view that the 1.8–2km thick bottom part of the exposed basalt flow sequence in the Western Ghats was extruded very close to 67.4 Ma.

  6. Exhumation history of the NW Indian Himalaya revealed by fission track and 40Ar/39Ar ages

    Science.gov (United States)

    Schlup, Micha; Steck, Albrecht; Carter, Andrew; Cosca, Michael; Epard, Jean-Luc; Hunziker, Johannes

    2011-01-01

    New fission track and Ar/Ar geochronological data provide time constraints on the exhumation history of the Himalayan nappes in the Mandi (Beas valley) — Tso Morari transect of the NW Indian Himalaya. Results from this and previous studies suggest that the SW-directed North Himalayan nappes were emplaced by detachment from the underthrusted upper Indian crust by 55 Ma and metamorphosed by ca. 48–40 Ma. The nappe stack was subsequently exhumed to shallow upper crustal depths (

  7. Dicty_cDB: FC-AR20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR20 (Link to dictyBase) - G03232 DDB0186972 Contig-U15983-1 FC-AR...20P (Link to Original site) FC-AR20F 321 FC-AR20Z 550 FC-AR20P 871 - - Show FC-AR20 Library FC (Link to librar....0 %: cytoplasmic 24.0 %: nuclear 8.0 %: vesicles of secretory system 4.0 %: cytoskeletal 4.0 %: mitochondri...ontig Contig-U15983-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...20Q.Seq.d/ Representative seq. ID FC-AR20P (Link to Original site) Representative DNA sequence >FC-AR20 (FC-AR

  8. The mass of sup 3 sup 2 Ar and sup 3 sup 3 Ar for fundamental tests

    CERN Document Server

    Blaum, K; Beck, D; Bollen, G; Herfurth, F; Kellerbauer, A G; Kluge, H J; Sauvan, E; Schwarz, S

    2003-01-01

    Masses of the short-lived radionuclides sup 3 sup 2 Ar (T sub 1 sub / sub 2 = 98 ms) sup 3 sup 3 Ar (T sub 1 sub / sub 2 = 173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10 sup - sup 8 (delta m = 1.8 keV) and 1.4 x 10 sup - sup 8 (delta m = 0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaricmultiplet mass equation IMME. Furthermore, the improved accuracy for the mass of sup 3 sup 2 Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for sup 4 sup 4 Ar and sup 4 sup 5 Ar, and a 20 sigma deviation for sup 4 sup 4 Ar from the literature value was found and interpreted.

  9. 40Ar/39Ar dating of alkaline and tholeiitic magmatism of Saudi Arabia related to the early Red Sea Rifting

    International Nuclear Information System (INIS)

    40Ar/39Ar plateau-ages at 27-28 Ma obtained on feeder dykes and one lava flow of the alkaline massif of Harrat Hadan are in agreement with the assumed age partly deduced from the conventional K/Ar data of the early activity of other alkaline volcanic massifs from Saudi Arabia. This magmatic activity is spatially distributed over a large area, along the western edge of the Arabian plate, and their N-S to NW-SE volcano-tectonic directions are similar to those of the future Red Sea Rift. Preliminary results obtained on tholeiitic lava flows, dykes and plutons gave 17 plateau-ages which, combined with 6 ages deduced from more disturbed age-spectra, display a main histogram peak from 24 to 21 Ma, much narrower than that obtained with conventional K/Ar ages on the same formations. Therefore, a strong tholeiitic activity affected a narrow linear area following the actual eastern Red Sea coast, over nearly 1700 km, during a brief period of time, and without showing any apparent migration. The main volcano-tectonic features of the future Red Sea are strongly outlined during this event. Such brief magmatic episodes related to continental rifts have also been documented by precise 40Ar/39Ar analyses on the British Tertiary Igneous Province, the Deccan traps and the eastern Central Atlantic. (orig.)

  10. New methodologies at PF AR-NW12A: the implementation of high-pressure macromolecular crystallography

    Energy Technology Data Exchange (ETDEWEB)

    Chavas, Leonard Michel Gabriel, E-mail: leonard.chavas@kek.jp [PF/IMSS/KEK, 1-1 Oho, Tsukuba, Ibaraki 300-0801 (Japan); Nagae, Tadayuki [Nagoya University, Nagoya, Aichi 464-8603 (Japan); Nagoya University, Nagoya, Aichi 464-8603 (Japan); Yamada, Hiroyuki [Nagoya University, Nagoya, Aichi 464-8603 (Japan); Watanabe, Nobuhisa [Nagoya University, Nagoya, Aichi 464-8603 (Japan); Nagoya University, Furo-cho Chikusa-ku, Nagoya, Aichi 464-8603 (Japan); Yamada, Yusuke; Hiraki, Masahiko; Matsugaki, Naohiro [PF/IMSS/KEK, 1-1 Oho, Tsukuba, Ibaraki 300-0801 (Japan)

    2013-11-01

    The evolution of AR-NW12A into a multi-purpose end-station with optional high-pressure crystallography is described. The macromolecular crystallography (MX) beamline AR-NW12A is evolving from its original design of high-throughput crystallography to a multi-purpose end-station. Among the various options to be implemented, great efforts were made in making available high-pressure MX (HPMX) at the beamline. High-pressure molecular biophysics is a developing field that attracts the interest of a constantly growing scientific community. A plethora of activities can benefit from high pressure, and investigations have been performed on its applicability to study multimeric complex assemblies, compressibility of proteins and their crystals, macromolecules originating from extremophiles, or even the trapping of higher-energy conformers for molecules of biological interest. Recent studies using HPMX showed structural hydrostatic-pressure-induced changes in proteins. The conformational modifications could explain the enzymatic mechanism differences between proteins of the same family, living at different environmental pressures, as well as the initial steps in the pressure-denaturation process that have been attributed to water penetration into the protein interior. To facilitate further HPMX, while allowing access to various individualized set-ups and experiments, the AR-NW12A sample environment has been revisited. Altogether, the newly added implementations will bring a fresh breath of life to AR-NW12A and allow the MX community to experiment in a larger set of fields related to structural biology.

  11. Evaluation of the Immunity Activity of Glycyrrhizin in AR Mice

    Directory of Open Access Journals (Sweden)

    Ai-Guo Zhou

    2012-01-01

    Full Text Available In this study, we evaluated effect of glycyrrhizin on immunity function in allergic rhinitis (AR mice. The AR mice model were induced by dripping ovalbumin in physiological saline (2 mg mL−1, 10 μL into the bilateral nasal cavities using a micropipette. After the AR model was induced, mice were randomly divided into six groups: the normal control, model, lycopene 20 mg kg−1 (as positive control drug group, and glycyrrhizin 10, 20, 30 mg kg−1 groups. After the sensitization day 14, lycopene (20 mg/kg BW and glycyrrhizin (10, 20 and 30 mg/kg BW were given orally for 20 days once a day. Mice in the normal control and model groups were given saline orally once a day for 20 days. Results showed that glycyrrhizin treatment could dose-dependently significantly reduce blood immunoglobulin E (IgE, interleukin-4 (IL-4, interleukin-5 (IL-5, interleukin-6 (IL-6, nitrous oxide (NO, tumor necrosis factor-alpha (TNF-α levels and nitrous oxide synthase (NOS activity and enhance blood immunoglobulin A (IgA, immunoglobulin G (IgG, immunoglobulin M (IgM, interleukin-2 (IL-2 and interleukin-12 (IL-12 levels in AR mice. Furthermore, glycyrrhizin treatment could dose-dependently significantly enhance acetylcholinesterase (AchE activity and reduce substance P (SP level in peripheral blood and nasal mucosa of AR mice. We conclude that glycyrrhizin can improve immunity function in AR mice, suggesting a potential drug for the prevention and therapy of AR.

  12. Optical Emission Spectroscopic Studies of ICP Ar Plasma

    Institute of Scientific and Technical Information of China (English)

    QI Xuelian; REN Chunsheng; ZHANG Jian; MA Tengcai

    2007-01-01

    The ion line of 434.8 nm and atom line of 419.8 nm of Ar plasma produced by an inductively coupled plasma (ICP) were measured by optical emission spectroscopy and the influences from the working gas pressure, radio-frequency (RF) power and different positions in the discharge chamber on the line intensities were investigated in this study. It was found that the intensity of Ar atom line increased firstly and then saturated with the increase of the pressure. The line intensity of Ar+, on the other hand, reached a maximum value and then decreased along with the pressure. The intensity of the line in an RF discharge also demonstrated a jumping mode and a hysteresis phenomenon with the RF power. When the RF power increased to 400 W, the discharge jumped from the E-mode to the H-mode where the line intensity of Ar atom demonstrated a sudden increase, while the intensity of Ar+ ion only changed slightly. If the RF power decreased from a high value, e.g., 1000 W, the discharge would jump from the H-mode back to the E-mode at a power of 300 W. At this time the intensities of Ar and Ar+ lines would also decrease sharply. It was also noticed in this paper that the intensity of the ion line depended on the detective location in the chamber, namely at the bottom of the chamber the line was more intense than that in the middle of the chamber, but less intense than at the top, which is considered to be related to the capacitance coupling ability of the ICP plasma in different discharge areas.

  13. Acoustic Resonance Spectroscopy (ARS) Munition Classification System enhancements. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Vela, O.A.; Huggard, J.C.

    1997-09-18

    Acoustic Resonance Spectroscopy (ARS) is a non-destructive evaluation technology developed at the Los Alamos National Laboratory (LANL). This technology has resulted in three generations of instrumentation, funded by the Defense Special Weapons Agency (DSWA), specifically designed for field identification of chemical weapon (CW) munitions. Each generation of ARS instrumentation was developed with a specific user in mind. The ARS1OO was built for use by the U.N. Inspection Teams going into Iraq immediately after the Persian Gulf War. The ARS200 was built for use in the US-Russia Bilateral Chemical Weapons Treaty (the primary users for this system are the US Onsite Inspection Agency (OSIA) and their Russian counterparts). The ARS300 was built with the requirements of the Organization for the Prohibition of Chemical Weapons (OPCW) in mind. Each successive system is an improved version of the previous system based on learning the weaknesses of each and, coincidentally, on the fact that more time was available to do a requirements analysis and the necessary engineering development. The ARS300 is at a level of development that warrants transferring the technology to a commercial vendor. Since LANL will supply the computer software to the selected vendor, it is possible for LANL to continue to improve the decision algorithms, add features where necessary, and adjust the user interface before the final transfer occurs. This paper describes the current system, ARS system enhancements, and software enhancements. Appendices contain the Operations Manual (software Version 3.01), and two earlier reports on enhancements.

  14. Visualizing interior and exterior jet aircraft noise

    Science.gov (United States)

    Moondra, Manmohan S.

    In today's competitive aerospace industry, the quest for quiet has drawn significant attention to both the interior and exterior design of an airplane. Understanding the noise generation mechanisms of a jet aircraft is a crucial first step toward developing the most cost-effective noise and vibrations abatement methods. In this investigation, the Helmholtz Equation Least Squares (HELS) based nearfield acoustic holography will be used to understand noise transmission caused by jet engine and turbulence into the fuselage of a jet aircraft cruising at 30,000 ft. Modern propulsive jet engines produce exterior noise sources with a high amplitude noise field and complicated characteristics, which makes them very difficult to characterize. In particular, there are turbulent eddies that are moving through the jet at high speeds along the jet boundary. These turbulent eddies in the shear layer produce a directional and frequency dependent noise. The original HELS approach assumes a spherical source at the origin and computes the acoustic field based on spherical emission from this source. This assumption of one source at the origin is not sufficient to characterize a complex source like a jet. As such, a modified HELS approach is introduced that will help improve the source characterization as it is not dependent on a single source at the origin but a number of virtual sources throughout the space. Custom microphones are created to take acoustic pressure measurements around the jet engine. These measured acoustic pressures are then taken as input to the modified HELS algorithm to visualize the noise pattern of a subsonic jet engine.

  15. The challenge to explore the Brazilian interior basins; O desafio da exploracao das bacias interiores brasileiras

    Energy Technology Data Exchange (ETDEWEB)

    Bacoccoli, Giuseppe [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia; Guimaraes, Paulo Buarque [Organizacao da Industria do Petroleo (ONIP), Rio de Janeiro, RJ (Brazil)

    2004-07-01

    Due to the development of the fields, already discovered in the deep waters of the Southeastern Atlantic Margin, the Brazilian domestic production will shortly be equivalent to the consumption. Despite reaching this goal, the exploration of large interior basins is still considered a challenge. Surprisingly, after the discoveries in the Solimoes Basin, as well after the opening of the Brazilian Petroleum Sector in 1997, the present level of the exploration activities in these basins is far below the previous historical averages. The available data are still now considered too scarce, to perform a proper evaluation. Apparently, a vicious circle has been established: due to the a priori low attractiveness new data are not acquired and because the lack of new data the attractiveness cannot be modified nor improved. The Parnaiba Basin is usually mentioned as an example of this poor amount of data. A modest coverage of ancient 2D seismic lines, and obsolete aero magnetic survey and thirty one exploratory wells, mostly located without geophysical support, represents all the available data in this vast basin with an area over 600,000 sq km. Recent regional geologic interpretations in such interior basins, as in Solimoes, Parana and also Parnaiba, are pointing out the presence of remarkable intraplate tectonic events, successively reactivated along the geologic time. It is now intended that these events can play an important role in the control of the petroleum system and in focalizing the new exploration activities. However, efforts should be applied in the revision of some regulatory rules, in Brazil, in order to better stimulate the onshore exploration and particularly the exploration of the interior basins. As recommended by the new Brazilian Petroleum Law, part of the government takes shall be effectively applied to acquire more geologic and geophysical data in the onshore areas (author)

  16. Mood perception of interior colors in a gym

    Science.gov (United States)

    Ohno, Haruyo; Koizumi, Naoko

    2002-06-01

    When people enter a gym, they feel more like exercising in some cases than other cases. The interior color of the space may be a contributing factor. This paper discusses how the interior color of a gym affects female subjects in their twenties and forties to fifties both physiologically and psychologically.

  17. A CLASS OF STRONGLY NONLINEAR SINGULARLY PERTURBED INTERIOR LAYER PROBLEMS

    Institute of Scientific and Technical Information of China (English)

    唐荣荣

    2004-01-01

    In this paper, a class of strongly nonlinear singularly perturbed interior layer problems are considered by the theory of differential inequalities and the corrective theory of interior layer. The existence of solution is proved and the asymptotic behavior of solution for the boundary value problems are studied. And the satisfying result is obtained.

  18. 14 CFR 91.613 - Materials for compartment interiors.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Materials for compartment interiors. 91.613 Section 91.613 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... compartment interiors. (a) No person may operate an airplane that conforms to an amended or supplemental...

  19. Virtual Interior Design Based On VRML AND JAVA

    Science.gov (United States)

    Qi, Shaoliang

    Virtual reality has been involved in a wide range of academic and commercial applications. It can give users a natural feeling of the environment by creating realistic virtual worlds. In this paper, we use vrml and java to discuss the virtual interior design. EAI and JASI are used to realize the interaction between user and virtual interior scene.

  20. Field Dependence and Vocational Choice of Interior Design Students.

    Science.gov (United States)

    Davis, Diane M.; And Others

    One hundred ninety-three interior design college students were administered the Group Embedded Figures Test, a measure of field dependence, in order to evaluate two of Witkin's hypotheses regarding career choice. The career-differentiation hypothesis predicted that students electing to major in interior design would be field independent because…

  1. Interior Design Education within a Human Ecological Framework

    Science.gov (United States)

    Kaup, Migette L.; Anderson, Barbara G.; Honey, Peggy

    2007-01-01

    An education based in human ecology can greatly benefit interior designers as they work to understand and improve the human condition. Design programs housed in colleges focusing on human ecology can improve the interior design profession by taking advantage of their home base and emphasizing the human ecological framework in the design curricula.…

  2. Interior Design Standards in the Secondary FCS Curriculum

    Science.gov (United States)

    Katz, Shana H.; Smith, Bettye P.

    2006-01-01

    This article deals with a study on interior design standards in the secondary FCS curriculum. This study assessed the importance FCS teachers placed on content standards in the interior design curriculum to help determine the amount of time and emphasis to place on the units within the courses. A cover letter and questionnaire were sent…

  3. Design for subjective well-being in interior architecture

    NARCIS (Netherlands)

    Petermans, A.; Pohlmeyer, A.E.

    2014-01-01

    Can interior environments engage people in pleasurable and meaningful experiences and thereby have a positive influence on their happiness? This paper discusses why and how interior architects might want to consider implementing ideas in relation to ‘design for subjective well-being’. Despite of pe

  4. Interior Design Supports Art Education: A Case Study

    Science.gov (United States)

    Clemons, Stephanie A.

    2006-01-01

    Interior design, as a field of study, is a rapidly growing area of interest--particularly for teenagers in the United States. Part of this interest stems from the proliferation of design-related reality shows available through television media. Some art educators and curriculum specialists in the nation perceive the study of interior spaces as a…

  5. Active Noise Control of the Heavy Truck Interior Cab

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    In order to control the noise of the heavy truck interior cab effectively, the active noise control methods are employed. First, an interior noise field test for the heavy truck is performed, and frequencies of interior noise of this vehicle are analyzed. According to the spectrum analysis of acquired noise signal, it is found out that the main frequencies of interior noise are less than 800Hz. Then the least squares lattice (LSL) algorithm is used as signal processing algorithm of the controller and a closed-loop control DSP system, based on TMS 320VC5416, is developed. The residual signal at driver's ear is used as feedback signal. Lastly, the developed ANC system is loaded into the heavy truck cab, and controlling the noise at driver's ear for that truck at different driving speeds is attempted. The noise control test results indicate that the cab interior noise is reduced averagely by 0.9 dBA at different driving speeds.

  6. Capillary flow in an interior corner

    Science.gov (United States)

    Weislogel, Mark M.; Lichter, Seth

    1998-10-01

    The design of fluids management processes in the low-gravity environment of space requires an accurate description of capillarity-controlled flow in containers. Here we consider the spontaneous redistribution of fluid along an interior corner of a container due to capillary forces. The analytical portion of the work presents an asymptotic formulation in the limit of a slender fluid column, slight surface curvature along the flow direction z, small inertia, and low gravity. The scaling introduced explicitly accounts for much of the variation of flow resistance due to geometry and so the effects of corner geometry can be distinguished from those of surface curvature. For the special cases of a constant height boundary condition and a constant flow condition, the similarity solutions yield that the length of the fluid column increases as t1/2 and t3/5, respectively. In the experimental portion of the work, measurements from a 2.2 s drop tower are reported. An extensive data set, collected over a previously unexplored range of flow parameters, includes estimates of repeatability and accuracy, the role of inertia and column slenderness, and the effects of corner angle, container geometry, and fluid properties. At short times, the fluid is governed by inertia (t[less, similar]tLc). Afterwards, an intermediate regime (tLc[less, similar]t[less, similar] tH) can be shown to be modelled by a constant-flow-like similarity solution. For t[gt-or-equal, slanted]tH it is found that there exists a location zH at which the interface height remains constant at a value h(zH, t)=H which can be shown to be well predicted. Comprehensive comparison is made between the analysis and measurements using the constant height boundary condition. As time increases, it is found that the constant height similarity solution describes the flow over a lengthening interval which extends from the origin to the invariant tip solution. For t[dbl greater-than sign]tH, the constant height solution

  7. Heterogeneous lithospheric mantle metasomatism in the eastern North China Craton: He-Ar isotopes in peridotite xenoliths from Cenozoic basalts

    Science.gov (United States)

    Tang, Huayun; Matsumoto, Takuya; Zheng, Jianping; Czuppon, György; Yu, Chunmei; Miyakawa, Chie; Ping, Xianquan

    2014-02-01

    The abundances and isotopic compositions of Helium and Argon have been analyzed in a suite of fresh spinel peridotite xenoliths in Cenozoic basalts from the eastern North China Craton (NCC) by step-wise heating experiments, to investigate the nature of noble gas reservoirs in the subcontinental lithospheric mantle beneath this region. The xenoliths include one harzburgite collected from Hebi in the interior of the NCC, two lherzolites from Hannuoba at the northern margin of the craton, and three lherzolites from Shanwang and Nushan on the eastern margin. 3He/4He ratios in most of the xenoliths are similar to those of mid-ocean ridge basalts (MORB) or slightly lower (2-10.5 Ra, where Ra is the 3He/4He ratio of the atmosphere), suggesting mixing of MORB-like and radiogenic components. One olivine separate from Nushan has a helium value of 25.3 Ra, probably suggesting cosmogenic 3He addition. The 40Ar/36Ar ratios vary from atmospheric value (296) to 1625, significantly lower than the MORB value. Available data of the peridotite xenoliths indicate the He and Ar isotopic systematics of the mantle reservoirs beneath the NCC can be interpreted as mixtures of at least three end-members including MORB-like, radiogenic and atmospheric components. We suggest that the MORB-like noble gases were derived from the underlying asthenosphere during mantle upwelling, whereas the radiogenic and recycled components probably were incorporated into the lithospheric mantle during circum-craton subduction of oceanic crust. Available data suggest that the MORB-like fluids are better preserved in the interior of the NCC, whereas the radiogenic ones are more prevalent at the margins. The Paleo-Asian ocean subduction system probably was responsible for the enriched and recycled noble gas signatures on the northern margin of the craton, while the Pacific subduction system could account for the observed He-Ar isotopic signatures beneath the eastern part. Therefore, integration of helium and

  8. Modelling Ar II spectral emission from the ASTRAL helicon plasma

    Science.gov (United States)

    Munoz Burgos, Jorge; Boivin, Robert; Loch, Stuart; Kamar, Ola; Ballance, Connor; Pindzola, Mitch

    2008-11-01

    We describe our spectral modeling of ArII emission from the ASTRAL helicon plasma at Auburn University. Collisional-radiative theory is used to model the emitted spectrum, with account being taken for the density and temperature variation along the line of sight. This study has two main aims. Firstly to test the atomic data used in the model and secondly to identify spectral line ratios in the 200 nm - 1000 nm range that could be used as temperature diagnostics. Using the temperature at which Ar II emission starts to be seen we have been able to test recent ionization and recombination data. Using selected spectral lines we were then able to test the importance of the continuum-coupling effects included in the most recent Ar+ electron impact excitation data. Selected spectral line ratios have been identified that show a strong temperature variation and have potential as a temperature diagnostic.

  9. Factor Structure of CIWA-Ar in Alcohol Withdrawal.

    Science.gov (United States)

    Bakhla, Ajay Kumar; Khess, Christoday R J; Verma, Vijay; Hembram, Mahesh; Praharaj, Samir Kumar; Soren, Subhas

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance), and the third had two items (10.04% variance). Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors. PMID:24826372

  10. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    Directory of Open Access Journals (Sweden)

    Ajay Kumar Bakhla

    2014-01-01

    Full Text Available Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance, second factor also had four items (24.25% variance, and the third had two items (10.04% variance. Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors.

  11. 40Ar-39Ar age of the Shergotty achondrite and implications for its post-shock thermal history

    International Nuclear Information System (INIS)

    Analyses of 40Ar-39Ar have been made on a whole rock sample and a maskelynite (feldspar) separate of the shocked Shergotty achondrite. The maskelynite gave a plateau age of 254 +- 10 Myr. The whole rock sample gave a complex release with apparent ages between 240 and 640 Myr. The slightly younger Rb-Sr isochron age of 165 Myr for Shergotty suggests that the maskelynite as well as the whole rock was incompletely degassed. Reasonable Ar diffusion characteristics for Shergotty for shock heating temperatures of 0C indicate D/a2 of 10-11 to 10-13sec-1. The time required to lose 95% of the 40Ar from the plagioclase would be approximately 103 to 104 yr. When this gas diffusion time is introduced into a thermal model of a cooling ejecta blanket of variable thickness, a post-shock cooling time of >= 103 yr and a burial depth of >= 300 m are indicated for Shergotty. These conclusions are not seriously affected by uncertainties in the thermal model. Most likely the shock event occurred approximately 165 Myr ago, but no earlier than 250 Myr ago, when the Shergotty parent object experienced a collision in the asteroid belt. As a result of that collision, feldspar was converted to maskelynite, the K-Ar and Rb-Sr ages were completely or nearly completely reset, and the Shergotty meteorite was heated to 0C and left to cool slowly inside the parent body. (author)

  12. 40Ar/39Ar laser probe evidence concerning the age and associated hazards of the Lake Nyos Maar, Cameroon

    Science.gov (United States)

    Dalrymple, G.B.; Lockwood, J.P.

    1990-01-01

    The waters of Lake Nyos are impounded by a fragile natural dam composed of pyroclastic rocks ejected during the formation of the lake crater (maar). Lateral erosion of this dam has reduced its width from over 500 m to only 45 m. Published whole-rock K-Ar ages of about 100 ka on juvenile basalt from the dam suggests that erosion has been slow and that the dam poses no imminent threat. New apparent 40Ar/39Ar ages of 1.4 to 232 Ma on xenocrystic K-feldspar contained in the basalt show that the xenocrysts, whose source is the 528-Ma crystalline basement, are carriers of inherited radiogenic 40Ar and would cause the whole-rock K-Ar ages to be too old. The best estimate for the age of the maar is provided by a 14C age of 400 ?? 100 yr BP on charcoal from the base of the dam. This young age indicates that the dam is eroding at a relatively rapid rate; its failure, perhaps within a few decades, would result in a major flood and imperil thousands of people living downstream in Cameroon and eastern Nigeria. ?? 1990 Kluwer Academic Publishers.

  13. Etching characteristics and mechanisms of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas

    Science.gov (United States)

    Lim, Nomin; Efremov, Alexander; Yeom, Geun Young; Choi, Bok-Gil; Kwon, Kwang-Ho

    2014-11-01

    The etching characteristics and mechanism of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas under the same operating conditions (pressure, 6 mTorr; input power, 700 W; bias power, 200 W) were investigated. For both gas mixtures, an increase in the Ar fraction or gas pressure at a fixed gas mixing ratio was found to cause a non-monotonic change in the Mo etching rates. The X-ray photoelectron spectroscopy (XPS) diagnostics indicated contamination of the etched surfaces by reaction products. The Cl2/Ar and CF4/Ar plasma parameters were also investigated using a combination of a zero-dimensional plasma model and plasma diagnostics using Langmuir probes. An analysis of the etching kinetics with the model-predicted fluxes of the plasma active species suggests that: 1) the Mo etching process occurs in the transitional regime of the ion-assisted chemical reaction, and 2) the non-monotonic Mo etching rate is probably associated with opposing changes in the fluxes of the reactive neutral species and ion energy.

  14. A DNA polymerase mutation that suppresses the segregation bias of an ARS plasmid in Saccharomyces cerevisiae.

    OpenAIRE

    Houtteman, S W; Elder, R T

    1993-01-01

    Yeast autonomously replicating sequence (ARS) plasmids exhibit an unusual segregation pattern during mitosis. While the nucleus divides equally into mother and daughter cells, all copies of the ARS plasmid will often remain in the mother cell. A screen was designed to isolate mutations that suppress this segregation bias. A plasmid with a weak ARS (wARS) that displayed an extremely high segregation bias was constructed. When cells were grown under selection for the wARS plasmid, the resulting...

  15. Efeito dos incêndios florestais na qualidade do ar

    OpenAIRE

    Miranda, Ana Isabel

    1998-01-01

    Os incêndios florestais podem ser considerados como um processo de combustão natural em grande escala, que consome diversas espécies vegetais numa área geográfica específica Consequentemente, consistem numa fonte potencial de elevadas quantidades de poluentes para a atmosfera, sendo indispensável conhecer o seu impacto na qualidade do ar. O objectivo principal deste trabalho consiste no estudo do efeito das emissões dos incêndios florestais na qualidade do ar. Para tal, foram d...

  16. Interatomic scattering in energy dependent photoelectron spectra of Ar clusters

    Energy Technology Data Exchange (ETDEWEB)

    Patanen, M.; Benkoula, S.; Nicolas, C.; Goel, A. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Antonsson, E. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Physikalische und Theoretische Chemie Institut für Chemie und Biochemie, Fachbereich Biologie, Chemie, Pharmazie, Freie Universität Berlin, Takustrasse 3, 14195 Berlin (Germany); Neville, J. J. [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Department of Chemistry, University of New Brunswick, Fredericton, New Brunswick E3B 6E2 (Canada); Miron, C., E-mail: Catalin.Miron@synchrotron-soleil.fr [Synchrotron SOLEIL, L’Orme des Merisiers, Saint-Aubin, BP 48, 91192 Gif-sur-Yvette Cedex (France); Extreme Light Infrastructure - Nuclear Physics (ELI-NP), ‘Horia Hulubei’ National Institute for Physics and Nuclear Engineering, 30 Reactorului Street, RO-077125 Măgurele, Jud. Ilfov (Romania)

    2015-09-28

    Soft X-ray photoelectron spectra of Ar 2p levels of atomic argon and argon clusters are recorded over an extended range of photon energies. The Ar 2p intensity ratios between atomic argon and clusters’ surface and bulk components reveal oscillations similar to photoelectron extended X-ray absorption fine structure signal (PEXAFS). We demonstrate here that this technique allows us to analyze separately the PEXAFS signals from surface and bulk sites of free-standing, neutral clusters, revealing a bond contraction at the surface.

  17. Web authentic and similar texts detection using AR digital signature

    OpenAIRE

    Πούλος, Μάριος; Σκιαδόπουλος, Σπύρος; Μπώκος, Γιώργος Δ.

    2010-01-01

    In this paper, we propose a new identification technique based on an AR model with a complexity of size O(n) times in web form, with the aim of creating a unique serial number for texts and to detect authentic or similar texts. For the implementation of this purpose, we used an Autoregressive Model (AR) 15 th order, and for the identification procedure, we employed the cross-correlation algorithm. Empirical investigation showed that the proposed method may be used as an accurate method for id...

  18. Development of a low-level Ar-37 calibration standard

    CERN Document Server

    Williams, R M; Bowyer, T W; Day, A R; Fuller, E S; Haas, D A; Hayes, J C; Hoppe, E W; Humble, P H; Keillor, M E; LaFerriere, B D; Mace, E K; McIntyre, J I; Miley, H S; Myers, A W; Orrell, J L; Overman, C T; Panisko, M E; Seifert, A

    2016-01-01

    Argon-37 is an environmental signature of an underground nuclear explosion. Producing and quantifying low-level Ar-37 standards is an important step in the development of sensitive field measurement instruments. This paper describes progress at Pacific Northwest National Laboratory in developing a process to generate and quantify low-level Ar-37 standards, which can be used to calibrate sensitive field systems at activities consistent with soil background levels. This paper presents a discussion of the measurement analysis, along with assumptions and uncertainty estimates.

  19. Multiphoton Double Ionization of Ar and Ne Close to Threshold

    International Nuclear Information System (INIS)

    In kinematically complete studies we explore double ionization (DI) of Ne and Ar in the threshold regime (I>3x1013 W/cm2) for 800 nm, 45 fs pulses. The basic differences are found in the two-electron momentum distributions - 'correlation' (CO) for Ne and 'anticorrelation' (ACO) for Ar - that can be partially explained theoretically within a 3D classical model including tunneling. Transverse electron momentum spectra provide insight into 'Coulomb focusing' and point to correlated nonclassical dynamics. Finally, DI threshold intensities, CO as well as ACO regimes are predicted for both targets.

  20. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    OpenAIRE

    Ajay Kumar Bakhla; Khess, Christoday R.J.; Vijay Verma; Mahesh Hembram; Samir Kumar Praharaj; Subhas Soren

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance...

  1. Medidas da umidade relativa do ar em um ambiente fechado

    OpenAIRE

    Costa Eden V.

    2003-01-01

    Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de p...

  2. Axenfeld-Rieger syndrome (ARS): A review and case report.

    LENUS (Irish Health Repository)

    Waldron, Jennie M

    2011-08-29

    Axenfeld-Rieger syndrome (ARS) is a rare, autosomal dominant condition characterized by ocular, craniofacial, dental, and periumbilical abnormalities. Relatively little information exists on this syndrome within the dental literature despite the fact that midface hypoplasia and maxillary hypodontia are classical presenting features of this syndrome. This is a case report of a 7-year-old Caucasian female with ARS who presented with significant ocular and dental anomalies. She was also found to have osteopenia. Her dental condition is described, her immediate treatment is shown, and her long-term treatment needs are discussed.

  3. Enceladus' Interior: A Liquid Circulation Model

    Science.gov (United States)

    Matson, Dennis L.; Johnson, Torrence; Lunine, Jonathan; Castillo-Rogez, Julie

    We are studying a model for Enceladus' interior in which the water, gas, dust and heat are supplied to the plumes by a relatively deeply circulating brine solution. Data indicates such a source for the erupting material. On the basis of ammonia in the plume gas Waite et al. [1] suggested that the jets might originate from a liquid water region under Enceladus' icy surface. Postberg et al. [2] noted that the presence of ". . . grains that are rich in sodium salts (0.5-2 percent by mass). . . can arise only if the plumes originate from liquid water." Waite et al. [1] also regard the some of the plume chemicals as evidence for interactions with an ice layer presumably overlying the liquid water reservoir. They suggest that this could be in the form of dissociation of clathrate hydrates [3]. Additionally, there is a large heat flow of more than 15 GW [4, 5] coming out of Enceladus' south polar region. We consider a model that brings heat and chemical species up to the surface from a reservoir or "ocean" located below the ice crust that may be many tens of kilometers thick. Water transits to the surface via vertical conduits. The Cassini INMS data suggest that the water has a relatively large gas content of order a few percent. As the water travels upward and the pressure is released, exolving gases form bubbles. Since the bubbly liquid is less dense than the ice, it moves upward. (This part of the model is a variant of the "Perrier Ocean" Europa model of Crawford and Stevenson [6]. A similar model was studied for Ganymede by Murchie and Head [7].) Postberg et al. [2] model the plume eruptions that result from the water, gases, salts, and other chemicals that our circulation model provides. In the near-surface reservoir feeding the plumes, bubbles reaching the surface of the water pop and throw a very fine spray. Some of these very small droplets of brine exit with the plume gas and provide the observed salt-rich dust particles [2]. Much of the water-borne heat is

  4. Interior's Climate Science Centers: Focus or Fail

    Science.gov (United States)

    Udall, B.

    2012-12-01

    After a whirlwind two years of impressive and critical infrastructure building, the Department of Interior's Climate Science Centers are now in a position to either succeed or fail. The CSCs have a number of difficult structural problems including too many constituencies relative to the available resources, an uneasy relationship among many of the constituencies including the DOI agencies themselves, a need to do science in a new, difficult and non-traditional way, and a short timeframe to produce useful products. The CSCs have built a broad and impressive network of scientists and stakeholders. These entities include science providers of the universities and the USGS, and decision makers from the states, tribes, DOI land managers and other federal agencies and NGOs. Rather than try to support all of these constituencies the CSCs would be better served by refocusing on a core mission of supporting DOI climate related decision making. The CSCs were designed to service the climate science needs of DOI agencies, many of which lost their scientific capabilities in the 1990s due to a well-intentioned but ultimately harmful re-organization at DOI involving the now defunct National Biological Survey. Many of these agencies would like to have their own scientists, have an uneasy relationship with the nominal DOI science provider, the USGS, and don't communicate effectively among themselves. The CSCs must not succumb to pursuing science in either the traditional mode of the USGS or in the traditional mode of the universities, or worse, both of them. These scientific partners will need to be flexible, learn how to collaborate and should expect to see fewer resources. Useful CSC processes and outputs should start with the recommendations of the 2009 NRC Report Informing Decisions in a Changing Climate: (1) begin with users' needs; (2) give priority to process over products; (3) link information producers and users; (4) build connections across disciplines and organizations

  5. Ecohydrology of Interior Alaska boreal forest systems

    Science.gov (United States)

    Cable, J.; Bolton, W. R.

    2012-12-01

    The ecohydrology of boreal forest ecosystems of Interior Alaska is not well understood largely because of challenges posed by the presence of discontinuous permafrost. Near-surface permafrost results in storage-dominated systems with cold, poorly drained soils, and slow growing, low statured coniferous trees (Picea mariana) or CDE's. The transition to permafrost-free areas can occur over a few meters and is accompanied by a vegetation community dominated by large deciduous trees (Populus sp. and Betula sp.) or DDE's. Typically, areas with permafrost are on north facing slopes and valley bottoms, and areas without permafrost are south facing. In Alaska's boreal forest, the permafrost is very warm and vulnerable to the effects of climate change. Once permafrost begins to thaw, the vegetation community shifts from coniferous to deciduous dominated. Streamflow in watersheds with a larger permafrost distribution tends to be higher and more responsive to precipitation events than in watersheds with low permafrost distribution. In fact, precipitation events in the low permafrost areas do not infiltrate past the rooting zone of the deciduous trees (~5-40 cm). This suggests that the deciduous trees may remove water from the system via uptake and transpiration. We focus on how vegetation water use affects boreal forest hydrology in areas of discontinuous permafrost. Specifically, we ask: what are the patterns of vegetation water use in areas with and without permafrost? This study focuses on the CDE and DDE systems. Our research sites are established on low and high locations on each aspect (south facing DDE, north facing CDE) to capture the variability associated with the different hillside drainage properties. At each of the four sites during the growing season, we measured various aspects of plant water use dynamics, including water flux, water content, water sources, depth of water uptake in the soil, and water stress. We use a Bayesian framework to analyze the data. We

  6. Thermal plasma properties for Ar-Al, Ar-Fe and Ar-Cu mixtures used in welding plasmas processes: I. Net emission coefficients at atmospheric pressure

    Science.gov (United States)

    Cressault, Y.; Gleizes, A.

    2013-10-01

    This article is devoted to the calculation of the net emission coefficient (NEC) of Ar-Al, Ar-Fe and Ar-Cu mixtures at atmospheric pressure for arc welding processes. The results are given in data tables for temperatures between 3 kK and 30 kK, for five plasma thicknesses (0, 0.5, 1, 2, 5 mm) and ten concentrations of metallic vapours (pure gas, 0.01%, 0.1%, 1%, 5%, 10%, 25%, 50%, 75% and pure metal vapours in mass proportions). The results are in good agreement with most of the works published on the subject for such mixtures. They highlight the influence of three parameters on the radiation of the plasma: the NEC is directly related to temperature and inversely related to plasma radius and is highly sensitive to the presence of metal vapours. Finally, numerical data are supplied in tables in order to develop accurate computational modelling of welding arc and to estimate both qualitatively and quantitatively the influence of each metallic vapour on the size and on the shape of the weld pool.

  7. Lunar Crater Interiors with High Circular Polarization Signatures

    Science.gov (United States)

    Weitz, C. M.; Campbell, B. A.; Morgan, G.

    2015-12-01

    We analyzed 12.6-cm Earth-based radar images of the Moon to search for older craters (pre-Copernican) that display high values of the circular polarization ratio (CPR) on their interior walls. These craters have highly eroded rims and ejecta, indicating that there must be a source exposed within the crater interior that is continuously creating a rougher surface. Of particular interest are craters between 10-25 km in diameter that occur in smooth plains in the highlands, where competent layers are not expected as they are for the mare. After identifying these high-CPR interiors in pre-Copernican craters, we studied LROC NAC and Kaguya TC images to search for possible albedo and layering on crater interior walls that might signal the presence of anomalous material. Our results indicate that high-CPR craters generally have boulder fields clustered around their upper interior walls. We divide the high-CPR craters into three types: (1) craters on the layered mare lava flows; (2) craters in the highlands that correlate to mapped locations of smooth plains; and (3) craters on the highlands that are not associated with smooth plains. Most of the high-CPR craters in the highlands are associated with Eratosthenian-period craters, and most of these are also on smooth plains, indicating that impact melt sheets are a likely source for the boulders exposed on their interior walls. Statistical analyses will be performed after incorporating multiple lunar datasets into GIS to quantify these preliminary interpretations. Figure 1. Example of high-CPR crater Zagut A located on smooth plains in the highlands. LROC images showing boulders on (a) northern crater interior wall and (b) southern crater interior wall. (c) Stronlgy enhanced values of CPR are observed for the interior of Zagut A.

  8. 40Ar/39Ar geochronology at the Instituto de Geociências, USP: instrumentation, analytical procedures, and calibration

    Directory of Open Access Journals (Sweden)

    PAULO M. VASCONCELOS

    2002-06-01

    Full Text Available Laser heating 40Ar/39Ar geochronology provides high analytical precision and accuracy, mum-scale spatial resolution, and statistically significant data sets for the study of geological and planetary processes. A newly commissioned 40Ar/39Ar laboratory at CPGeo/USP, São Paulo, Brazil, equips the Brazilian scientific community with a new powerful tool applicable to the study of geological and cosmochemical processes. Detailed information about laboratory layout, environmental conditions, and instrumentation provides the necessary parameters for the evaluation of the CPGeo/USP 40Ar/39Ar suitability to a diverse range of applications. Details about analytical procedures, including mineral separation, irradiation at the IPEN/CNEN reactor at USP, and mass spectrometric analysis enable potential researchers to design the necessary sampling and sample preparation program suitable to the objectives of their study. Finally, the results of calibration tests using Ca and K salts and glasses, international mineral standards, and in-house mineral standards show that the accuracy and precision obtained at the 40Ar/39Ar laboratory at CPGeo/USP are comparable to results obtained in the most respected laboratories internationally. The extensive calibration and standardization procedures undertaken ensure that the results of analytical studies carried out in our laboratories will gain immediate international credibility, enabling Brazilian students and scientists to conduct forefront research in earth and planetary sciences.A geocronologia de 40Ar/39Ar por aquecimento a laser permite alta precisão e acurácia analítica, tem resolução espacial em escala micrométrica, e fornece um número de dados estatisticamente significantes para o estudo de processos geológicos e planetários. Um recém construído laboratório de 40Ar/39Ar no CPGeo/USP, São Paulo, Brazil, mune a sociedade científica brasileira com uma técnica eficaz aplicável aos estudos geol

  9. Petrografía y edad 40Ar/39Ar de leucogranitos peraluminosos al oeste de Valcheta: Macizo Nordpatagónico (Río Negro

    Directory of Open Access Journals (Sweden)

    Martín R. Gozalvez

    2009-04-01

    Full Text Available Entre la localidad rionegrina de Valcheta y la Estación Muster del ex ferrocarril Gral. Roca se localizan numerosos afloramientos de leucogranitos que en conjunto forman un cuerpo plutónico de bordes rectos y geometría elipsoidal, aquí denominado plutón Valcheta. El intrusivo mencionado forma parte del basamento ígneo-metamórfico del sector oriental del macizo nordpatagónico. El plutón Valcheta es un cuerpo leucogranítico, peraluminoso (A/CNK >1,1, de grano medio, levemente deformado en los bordes, compuesto por una facies leucogranítica con muscovita-biotita-granate y otra con muscovita-biotita. Las zonas de contacto con los esquistos de la Formación Nahuel Niyeu están cubiertas y en su interior presenta xenolitos de gneises y anfibolitas inyectados por material leucocrático. El estudio radimétrico 40Ar/39Ar en muscovita del plutón Valcheta resultó en una edad de 470 ± 1,8 Ma. Estos datos permiten descartar la correlación de rocas leucogranitcas aflorantes al noroeste de Valcheta con el Granito Flores de edad jurásica. El plutón Valcheta presenta diferencias macroscópicas, petrográficas, microestructurales y composicionales con los intrusivos ordovícicos del Complejo Plutónico Punta Sierra, aflorante sobre la costa atlántica rionegrina. En consecuencia, la extensión del magmatismo ordovícico del este del Macizo Nordpatagónico hasta las inmediaciones de Valcheta debe ser revisada. La morfología, mineralogía, rasgos microestructurales y geoquímica del plutón Valcheta se comparan favorablemente con los leucogranitos del Complejo Mina Gonzalito que forman los plutones Tapera y María Teresa. El pico metamórfico de dicho complejo, según dataciones U-Pb en circones, es del Ordovícico medio (472 ± 5 Ma. El plutón Valcheta es composicionalmente semejante a leucogranitos post-colisionales tipo S formados en una corteza engrosada.

  10. Characterization of the ars Gene Cluster from Extremely Arsenic-Resistant Microbacterium sp. Strain A33▿ †

    Science.gov (United States)

    Achour-Rokbani, Asma; Cordi, Audrey; Poupin, Pascal; Bauda, Pascale; Billard, Patrick

    2010-01-01

    The arsenic resistance gene cluster of Microbacterium sp. A33 contains a novel pair of genes (arsTX) encoding a thioredoxin system that are cotranscribed with an unusual arsRC2 fusion gene, ACR3, and arsC1 in an operon divergent from arsC3. The whole ars gene cluster is required to complement an Escherichia coli ars mutant. ArsRC2 negatively regulates the expression of the pentacistronic operon. ArsC1 and ArsC3 are related to thioredoxin-dependent arsenate reductases; however, ArsC3 lacks the two distal catalytic cysteine residues of this class of enzymes. PMID:19966021

  11. Penalized interior point approach for constrained nonlinear programming

    Institute of Scientific and Technical Information of China (English)

    LU Wen-ting; YAO Yi-rong; ZHANG Lian-sheng

    2009-01-01

    A penalized interior point approach for constrained nonlinear programming is examined in this work. To overcome the difficulty of initialization for the interior point method, a problem equivalent to the primal problem via incorporating an auxiliary variable is constructed. A combined approach of logarithm barrier and quadratic penalty function is proposed to solve the problem. Based on Newton's method, the global convergence of interior point and line search algorithm is proven.Only a finite number of iterations is required to reach an approximate optimal solution. Numerical tests are given to show the effectiveness of the method.

  12. Algoritmo del elipsoide interior para programación lineal

    OpenAIRE

    Salamanca Fernández, Ángel; Juan Ruiz, Jesús

    1991-01-01

    En este artículo se desarrolla un algoritmo de puntos interiores para programación lineal a partir de consideraciones geométricas. En cada iteración del método se dispone de un punto interior al politopo. Con centro en dicho punto se obtiene un elipsoide interior a dicho politopo. La optimización de la función objetivo lineal sobre el elipsoide se obtiene mediante la solución de un problema de mínimos cuadrados. El punto resultante se adopta para la siguiente iteración. Se proponen dos método...

  13. Smoothed Analysis of Interior-Point Algorithms: Termination

    OpenAIRE

    Spielman, Daniel A.; Teng, Shang-Hua

    2003-01-01

    We perform a smoothed analysis of the termination phase of an interior-point method. By combining this analysis with the smoothed analysis of Renegar's interior-point algorithm by Dunagan, Spielman and Teng, we show that the smoothed complexity of an interior-point algorithm for linear programming is $O (m^{3} \\log (m/\\sigma))$. In contrast, the best known bound on the worst-case complexity of linear programming is $O (m^{3} L)$, where $L$ could be as large as $m$. We include an introduction ...

  14. Thermal History of the Felsite Unit, Geysers Geothermal Field, From Thermal Modeling of 40Ar/39Ar Incremental Heating Data

    Energy Technology Data Exchange (ETDEWEB)

    T. M. Harrison (U of California); G. B. Dalrymple (Oregon State U); J. B. Hulen (U of Utah); M. A. Lanphere; M. Grove; O. M. Lovera

    1999-08-19

    An Ar-40/Ar-39 and U-Pb study was performed of the Geysers plutonic complex of the Geysers Geothermal Field in California. Sixty-nine ion microprobe spot analyses of zircons from four granite samples from the plutonic complex that underlies the Geysers geothermal field yielded Pb-207/Pb-206 vs. U-238/Pb-206 concordia ages ranging from 1.13 {+-} 0.04 Ma to 1.25 {+-} 0.04 Ma. The U-Pb ages coincide closely with Ar-40/Ar-39 age spectrum plateau and ''terminal'' ages from coexisting K-feldspars and with the eruption ages of overlying volcanic rocks. The data indicate that the granite crystallized at 1.18 Ma and had cooled below 350 C by {approximately}0.9-1.0 Ma. Interpretation of the feldspar Ar-40/Ar-39 age data using multi-diffusion domain theory indicates that post-emplacement rapid cooling was succeeded either by slower cooling from 350-300 C between 1.0 and 0.4 Ma or transitory reheating to 300-350 C at about 0.4-0.6 Ma. Heat flow calculations constrained with K-feldspar thermal histories and the pre sent elevated regional heal flow anomaly demonstrate that appreciable heat input from sources external to the known Geysers plutonic complex is required to maintain the geothermal system. This requirement is satisfied by either a large, underlying, convecting magma chamber (now solidified) emplaced at 1.2 Ma or episodic intrusion of smaller bodies from 1.2-0.6 Ma.

  15. ^(40)Ar/^(39)Ar constraints on the age and thermal history of the Urucum Neoproterozoic banded iron-formation, Brazil

    OpenAIRE

    Piacentini, Thiago; Vasconcelos, Paulo M.; Farley, Kenneth A.

    2013-01-01

    Urucum is one of the youngest banded iron-formations (BIFs) yet its exact age remains uncertain. ^(40)Ar/^(39)Ar geochronology on late-diagenetic to early metamorphic cryptomelane from the Urucum sequence reveals a minimum depositional age of 587 ± 7 Ma. Metamorphic braunite age spectra yield flat segments defining apparent ages of 547 ± 3 Ma to 513 ± 4 Ma, interpreted as recrystallization or cooling ages. Metamorphic muscovite grains from a meta-arkose interbedded with the BIF yield reproduc...

  16. Vector Magnetic Field Measurement of NOAA AR 10197

    Institute of Scientific and Technical Information of China (English)

    Hong-Fei Liang; Hai-Juan Zhao; Fu-Yuan Xiang

    2006-01-01

    A set of two-dimensional Stokes spectral data of NOAA AR 10197 obtained by the Solar Stokes Spectral Telescope (S3T) at the Yunnan Observatory are qualitatively analyzed.The three components of the vector magnetic field, the strength H, inclination γ and azimuth x, are derived. Based on the three components, we contour the distributions of the longitudinal magnetic field and transverse magnetic field. The active region (AR) has two different magnetic polarities apparent in the longitudinal magnetic map due to projection effect. There is a basic agreement on the longitudinal magnetic fields between the S3T and SOHO/MDI magnetograms, with a correlation coefficient ρBl = 0.911. The transverse magnetic field of the AR has a radial distribution from a center located in the southwest of the AR. It is also found that the transverse magnetic fields obtained by Huairou Solar Observing Station (HRSOS) have a similar radial distribution. The distributions of transverse magnetic field obtained by S3T and HRSOS have correlation coefficients, ρAzimu = 0.86 and ρBt = 0.883,in regard to the azimuthal angle and intensity.

  17. He-, Ne-, and Ar-phosgene intermolecular potential energy surfaces

    DEFF Research Database (Denmark)

    Munteanu, Cristian R.; Henriksen, Christian; Felker, Peter M.;

    2013-01-01

    Using the CCSD(T) model, we evaluated the intermolecular potential energy surfaces of the He-, Ne-, and Ar-phosgene complexes. We considered a representative number of intermolecular geometries for which we calculated the corresponding interaction energies with the augmented (He complex) and doub...

  18. Tensor Effect on Proton Bubble Structure of ~(46)Ar

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    We have calculated the proton density distribution of 46Ar for different pairing interactions with the Skyrme interactions SLy5 and SLy5+Tw (Tw is the tensor force, which was obtained by the G-matrix calculations and added perturbatively into the SLy5 interaction

  19. Big data computing: Building a vision for ARS information management

    Science.gov (United States)

    Improvements are needed within the ARS to increase scientific capacity and keep pace with new developments in computer technologies that support data acquisition and analysis. Enhancements in computing power and IT infrastructure are needed to provide scientists better access to high performance com...

  20. Expansion of the USDA ARS Aerial Application spray atomization models

    Science.gov (United States)

    An effort is underway to update the USDA ARS aerial spray nozzle models using new droplet sizing instrumen-tation and measurement techniques. As part of this effort, the applicable maximum airspeed is being increased from 72 to 80 m/s to provide guidance to applicators when using new high speed air...

  1. Interacting with Visual Poems through AR-Based Digital Artwork

    Science.gov (United States)

    Lin, Hao-Chiang Koong; Hsieh, Min-Chai; Liu, Eric Zhi-Feng; Chuang, Tsung-Yen

    2012-01-01

    In this study, an AR-based digital artwork called "Mind Log" was designed and evaluated. The augmented reality technique was employed to create digital artwork that would present interactive poems. A digital poem was generated via the interplay between a video film and a text-based poem. This artwork was created following a rigorous design flow,…

  2. Spectroscopy Study of Ar + CO2 Plasmas in ASTRAL.

    Science.gov (United States)

    Munoz, Jorge; Boivin, Robert; Kamar, Ola; Loch, Stuart; Ballance, Connor

    2006-10-01

    A spectroscopy study of the ASTRAL (Auburn Steady sTate Research fAciLity) helicon plasma source running Ar + CO2 gas mix is presented. ASTRAL produces Ar plasmas: ne = 10^10 to 10^13 cm-3, Te = 2 to 10 eV and Ti = 0.03 to 0.5 eV. A series of 7 large coils produce an axial magnetic field up to 1.3 kGauss. A fractional helix antenna is used to introduce rf power up to 2 kWatt. A spectrometer which features a 0.33 m Criss-Cross monochromator and a CCD camera is used for this study. Very different plasmas are produced following the relative importance of CO2 in the gas mixture. At low CO2 concentration, the plasmas are similar to those obtained with pure Ar with weak CO2, CO2^+, CO and CO^+ bands. The usual blue plasma core associated with intense Ar II transitions is observed with however a significant white glow coming from the outer plasma regions. At higher CO2 concentration, the plasma becomes essentially molecular and can be described as an intense white plasma column. Molecular dissociative processes associated with the production of strong C and O atomic lines are observed under specific plasma conditions. The atomic spectral lines are compared with ADAS modeling results. This study indicates the possible advantages of using a helicon source to control the CO2 plasma chemistry for industrial applications.

  3. 75 FR 12163 - Class E Airspace; Mountain View, AR

    Science.gov (United States)

    2010-03-15

    ...; (2) is not a ``significant rule'' under DOT Regulatory Policies and Procedures (44 FR 11034; February...: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963 Comp., p. 389... Federal Aviation Administration 14 CFR Part 71 Class E Airspace; Mountain View, AR AGENCY:...

  4. CANONICAL COMPUTATIONAL FORMS FOR AR 2-D SYSTEMS

    NARCIS (Netherlands)

    ROCHA, P; WILLEMS, JC

    1990-01-01

    A canonical form for AR 2-D systems representations is introduced. This yields a method for computing the system trajectories by means of a line-by-line recursion, and displays some relevant information about the system structure such as the choice of inputs and initial conditions.

  5. Atom trap trace analysis of {sup 39}Ar

    Energy Technology Data Exchange (ETDEWEB)

    Welte, Joachim

    2011-12-14

    Detection of {sup 39}Ar in natural water samples can be employed for radiometric dating on a timescale of 50 to 1000 years before present. This experimental work comprises the setup of an atomic beam and trap apparatus that captures and detects {sup 39}Ar atoms by the laser-cooling technique ''Atom Trap Trace Analysis''. With this approach, the limitations of low-level counting, regarding sample size and measurement time, could be overcome. In the course of this work, the hyperfine structure spectrum of the cooling transition 1s{sub 5}-2p{sub 9} has been experimentally determined. A high intensity, optically collimated beam of slow metastable argon atoms has been set up and fluorescence detection of individual {sup 39}Ar atoms in a magneto-optical trap is realized. {sup 39}Ar count rates of 1 atom in about 4 hours have been achieved for atmospheric argon. Recent improvements further suggest that even higher count rates of 1 atom/hour are within reach.

  6. Important authorship clarification for arXiv:1010.2709

    OpenAIRE

    Yaffe, Yoav

    2010-01-01

    Version 1 of this paper (arXiv:1010.2709v1) was submitted exclusively by Noa Lavi, without prior knowledge, let alone consent, by Yoav Yaffe. Yoav Yaffe is {\\em not} an author of any version of this paper, with the exception of the present clarification.

  7. Global properties of the white dwarf pulsar AR Scorpii

    CERN Document Server

    Franzon, B

    2016-01-01

    In view of the new recent observation and measurement of the fast-rotating and highly-magnetized white dwarf AR Sco \\cite{Marsh:2016uhc}, we determine bounds for its radius, magnetic fields, moment of inertia and gravitational wave (GW) emission by using observations of the luminosity, as well the rotation frequency $\

  8. Immune epitope database analysis resource (IEDB-AR)

    DEFF Research Database (Denmark)

    Zhang, Qing; Wang, Peng; Kim, Yohan;

    2008-01-01

    We present a new release of the immune epitope database analysis resource (IEDB-AR, http://tools.immuneepitope.org), a repository of web-based tools for the prediction and analysis of immune epitopes. New functionalities have been added to most of the previously implemented tools, and a total...

  9. USDA-ARS and EMBRAPA Scientists Build Bridges With Strawberries

    Science.gov (United States)

    At the '3rd Simposio Nacional do Morango'and '2nd Encontro de Pequenas Frutas e Frutas Nativas do Mercosul' at Pelotas, Rio Grande Do Sul, Brazil, held 7 - 10 November 2006, I was invited to describe strawberry breeding in the United States and also my own USDA-ARS strawberry breeding program at Bel...

  10. Ars Fennica - isikliku ja poliitilise vahel / Janar Ala

    Index Scriptorium Estoniae

    Ala, Janar, 1979-

    2009-01-01

    2008. aasta Ars Fennica kunstiauhinna kandidaatide tööde näitus Kumu Kunstimuuseumis kuni 26. aprillini. Läti kunstniku Katrina Neiburga, soomlaste Seppo Renvalli, Maria Dunckeri ja Tea Mäkipää ning Mark Raidpere näitusel eksponeeritud töödest

  11. Mälestusi "Ars Fennica'st" / Eha Komissarov

    Index Scriptorium Estoniae

    Komissarov, Eha, 1947-

    2009-01-01

    Ars Fennica 2008. aasta nominentide Tea Mäkipää, Seppo Renvalli, Maria Dunckeri, Katrīna Neiburga (Läti) ja Mark Raidpere näitus Kumu Kunstimuuseumis 26. aprillini. Preemiaga pärjati Mark Raidpere ekspositsioon

  12. Strong-field nonsequential double ionization of Ar and Ne

    International Nuclear Information System (INIS)

    We investigate the nonsequential double ionization (NSDI) of Ar and Ne based on quantitative rescattering theory (QRS). According to QRS theory, each elementary NSDI process can be calculated by multiplying the returning electron wave packet with appropriate differential electron-ion scattering cross sections. We include (e, 2e) and electron-impact excitation cross sections of Ar+ to obtain the correlated electron momentum spectra for the NSDI of Ar by few-cycle pulses to check the dependence of NSDI on the carrier-envelope phase. The results are compared to the ion momentum spectra from the recent experiment of Johnson et al. [Phys. Rev. A 83, 013412 (2011)]. Calculations have also been performed for Ar at another intensity to illustrate the intensity dependence of NSDI and to compare with the earlier data of Feuerstein et al. [Phys. Rev. Lett. 87, 043003 (2001)] and for Ne to illustrate the target dependence. We also address the presence of resonant capture processes in electron-ion collisions in the NSDI spectra.

  13. Behaviour of AR glass fibre for building structural applications

    Directory of Open Access Journals (Sweden)

    Miravete, A.

    2005-12-01

    Full Text Available The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be used as reinforcement of organic matrix composite materials, broadening the range of structural applications. The mechanical properties of AR glass fibre and organic matrix composite materials will be studied in this paper. First, the behaviour of this material under stress corrosion will be analysed. Their mass loss will be compared to E, C, and boron free glass fibres. Second, an experimental study dealing with 3P test bending and short beam ofAR glass fibre/polyester will de described with the goal of obtaining their Young modulus and tensile and interlaminar shear strengths. Finally, these experimental results will be compared to E glass fibre/polyester and several conclusions about their structural applications will be drawn.

    El vidrio AR y su presentación en forma de fibras de refuerzo, fue diseñado para ser inerte a los álcalis de los cementos. Por este motivo se viene utilizando desde hace varias décadas como refuerzo de morteros y hormigones en forma de fibra corta. El ensimaje que estas fibras de vidrio de refuerzo A R presentaba en su origen no era compatible con resinas de tipo sintéticas, por lo que el refuerzo era exclusivo para cementos y hormigones fuera cual fuera la aplicación, formato o proceso productivo. Recientemente, gracias al desarrollo específico de ensimajes especiales acordes a las fibras de vidrio AR ha aparecido la misma tipología de vidrio AR como refuerzo en forma de fibra continua compatible con resinas sint

  14. Vehicle Interior Noise Prediction Using Energy Finite Element Analysis Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Prediction and enhancement of vehicle interior noise due to high frequency excitation, based on computer simulation, allows the application of the technology at the...

  15. Hybrid Prediction Method for Aircraft Interior Noise Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This proposal discusses the development and application of new methods of structural-acoustic analysis in order to address existing problems in aircraft interior...

  16. Pengenalan Teori Servicescape dan Penerapannya dalam Desain Interior

    Directory of Open Access Journals (Sweden)

    Ulli Aulia Ruki

    2011-09-01

    Full Text Available The reason of constructing the building facility is to facilitate users activity and service. The article purpose is to introduce servicescape concept as a part of route that could be used to measure users satisfaction level towards interior facility by giving additional value in selling goods and services in the building. Servicescape theory is one physical prove that could influence somebodys point of view about physical environment in a commercial facility. Some points discussed in servicescape are style, design, sign, space layout, function, and ambient condition. Method used is literature study from some books along with illustration analysis related to commercial facility interior. The expected result is to give point of view from servicescape theory that could be applied by an interior design in defining design concept especially related to commercial facility. The conclusion showed some points in servicescape theory that could be used to direct and deliver the designer to design concept decision that would satisfy facility interior users.

  17. Connecting horizon pixels and interior voxels of a black hole

    CERN Document Server

    Nicolini, Piero

    2014-01-01

    In this paper we discuss to what extent one can infer details of the interior structure of a black hole based on its horizon. Recalling that black hole thermal properties are connected to the non-classical nature of gravity, we circumvent the restrictions of the no hair theorem by postulating that the black hole interior is singularity free due to violations of the usual energy conditions. Further these conditions allow one to establish a one-to-one, holographic projection between Planckian areal "bits" on the horizon and "voxels", representing the gravitational degrees of freedom in the black hole interior. We illustrate the repercussions of this idea by discussing an example of the black hole interior consisting of a de Sitter core postulated to arise from the local graviton quantum vacuum energy. It is shown that the black hole entropy can emerge as the statistical entropy of a gas of voxels.

  18. Amount of Future Forest Interior at a 2 Hectare Scale

    Data.gov (United States)

    U.S. Environmental Protection Agency — Forests provide economic and ecological value. High amounts of forest interior indicates a highly connected forest, which generally enhances those economic and...

  19. Connecting horizon pixels and interior voxels of a black hole

    International Nuclear Information System (INIS)

    In this paper we discuss to what extent one can infer details of the interior structure of a black hole based on its horizon. Recalling that black hole thermal properties are connected to the non-classical nature of gravity, we circumvent the restrictions of the no-hair theorem by postulating that the black hole interior is singularity free due to violations of the usual energy conditions. Further these conditions allow one to establish a one-to-one, holographic projection between Planckian areal “bits” on the horizon and “voxels”, representing the gravitational degrees of freedom in the black hole interior. We illustrate the repercussions of this idea by discussing an example of the black hole interior consisting of a de Sitter core postulated to arise from the local graviton quantum vacuum energy. It is shown that the black hole entropy can emerge as the statistical entropy of a gas of voxels

  20. Morphology and Disease Information from Waterfowl, Interior Alaska, 2010

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This data set includes data from five waterfowl species (northern pintail, American wigeon, lesser scaup, green-winged teal and mallard) that were captured in...

  1. Vehicle Interior Noise Prediction Using Energy Finite Element Analysis Project

    Data.gov (United States)

    National Aeronautics and Space Administration — It is proposed to develop and implement a computational technique based on Energy Finite Element Analysis (EFEA) for interior noise prediction of advanced aerospace...

  2. Precision angle-resolved autoionization resonances in Ar and Ne

    Energy Technology Data Exchange (ETDEWEB)

    Berrah, N.; Langer, B.; Gorczyca, T.W. [Western Michigan Univ., Kalamazoo, MI (United States)] [and others

    1997-04-01

    Theoretical work has shown that the electron angular distribution and the shape of the autoionization resonances are crucial to the understanding of certain types of electron-electron correlation. Autoionization resonances in Ne (Ar) result from the decay of the excited discrete state Ne{sup *} 2s2p{sup 6} np (Ar{sup *} 3s3p{sup 6} np) into the continuum state Ne{sup +} 2s{sup 2}2p{sup 5} + e{sup {minus}} (ks,kd) (Ar{sup +} 3s{sup 2}3p{sup 5} + e{sup {minus}} (ks,kd)). Since the continuum can also be reached by direct photoionization, both paths add coherently, giving rise to interferences that produce the characteristic Beutler-Fano line shape. In this work, the authors report on quantitative angle-resolved electron spectrometry studies of (a) the Ne 2s{sup 2}2p{sup 6} {r_arrow} 2s2p{sup 6} np (n=3-5) autoionizing resonances and the 2s{sup 2}2p{sup 6} {r_arrow} 2p{sup 4}3s3p doubly excited resonance, (b) the Ar 3s{sup 2}3p{sup 6} {r_arrow} 3s3p{sup 6} np (n=4-9) autoionization resonances and extended R-matrix calculations of the angular-distribution parameters for both Ne and Ar measurements. Their results are compared with previous theoretical work by Taylor.

  3. Cytocompatibility of Ar{sup +} plasma treated and Au nanoparticle-grafted PE

    Energy Technology Data Exchange (ETDEWEB)

    Svorcik, V. [Department of Solid State Engineering, Institute of Chemical Technology, 166 28 Prague (Czech Republic)], E-mail: vaclav.svorcik@vscht.cz; Kasalkova, N.; Slepicka, P. [Department of Solid State Engineering, Institute of Chemical Technology, 166 28 Prague (Czech Republic); Zaruba, K.; Kral, V. [Department of Analytical Chemistry, Institute of Chemical Technology, 166 28 Prague (Czech Republic); Bacakova, L.; Parizek, M.; Lisa, V. [Institute of Physiology, Academy of Sciences of the Czech Republic 142 20 Prague (Czech Republic); Ruml, T.; Gbelcova, H.; Rimpelova, S. [Department of Biochemistry and Microbiology, Institute of Chemical Technology, 166 28 Prague (Czech Republic); Mackova, A. [Nuclear Physics Institute, Academy of Sciences of the Czech Republic, 250 68 Rez (Czech Republic); Department of Physics, J.E. Purkinje University, 400 96 Usti nad Labem (Czech Republic)

    2009-06-01

    Polyethylene (PE) was irradiated with inert Ar plasma, and the chemically active PE surface was grafted with Au nanoparticles. The composition and the structure of the modified PE surface were studied using X-ray photoelectron spectroscopy (XPS) and Rutherford backscattering spectroscopy (RBS). Changes in the surface wettability were determined from the contact angle measured in a reflection goniometer. The changes in the surface roughness and morphology were followed by atomic force microscopy (AFM). The modified PE samples were seeded with rat vascular smooth muscle cells (VSMC) or mouse NIH 3T3 fibroblasts, and their adhesion and proliferation were studied. We found that plasma discharge and Au grafting lead to dramatic changes in the surface morphology and roughness of PE. The Au nanoparticles were found not only on the sample surface, but also in the sample interior up to the depth of about 100 nm. In addition, plasma modification of the PE surface, followed with grafting Au-nanoparticles, significantly increased the attractiveness of the PE surface for the adhesion and growth of VSMC, and particularly for mouse embryonic 3T3 fibroblasts.

  4. Cytocompatibility of Ar + plasma treated and Au nanoparticle-grafted PE

    Science.gov (United States)

    Švorčík, V.; Kasálková, N.; Slepička, P.; Záruba, K.; Král, V.; Bačáková, L.; Pařízek, M.; Lisá, V.; Ruml, T.; Gbelcová, H.; Rimpelová, S.; Macková, A.

    2009-06-01

    Polyethylene (PE) was irradiated with inert Ar plasma, and the chemically active PE surface was grafted with Au nanoparticles. The composition and the structure of the modified PE surface were studied using X-ray photoelectron spectroscopy (XPS) and Rutherford backscattering spectroscopy (RBS). Changes in the surface wettability were determined from the contact angle measured in a reflection goniometer. The changes in the surface roughness and morphology were followed by atomic force microscopy (AFM). The modified PE samples were seeded with rat vascular smooth muscle cells (VSMC) or mouse NIH 3T3 fibroblasts, and their adhesion and proliferation were studied. We found that plasma discharge and Au grafting lead to dramatic changes in the surface morphology and roughness of PE. The Au nanoparticles were found not only on the sample surface, but also in the sample interior up to the depth of about 100 nm. In addition, plasma modification of the PE surface, followed with grafting Au-nanoparticles, significantly increased the attractiveness of the PE surface for the adhesion and growth of VSMC, and particularly for mouse embryonic 3T3 fibroblasts.

  5. Near-IR Polarized Scattered Light Imagery of the DoAr 28 Transitional Disk

    CERN Document Server

    Rich, Evan A; Mayama, Satoshi; Brandt, Timothy D; Hashimoto, Jun; Kudo, Tomoyuki; Kusakabe, Nobuhiko; Espaillat, Catherine; Abe, Lyu; Akiyama, Eiji; Brandner, Wolfgang; Carson, Joseph C; Currie, Thayne; Egner, Sebastian; Feldt, Markus; Follette, Kate; Goto, Miwa; Grady, Carol A; Guyon, Olivier; Hayano, Yutaka; Hayashi, Masahiko; Hayashi, Saeko S; Henning, Thomas; Hodapp, Klaus W; Ishii, Miki; Iye, Masanori; Janson, Markus; Kandori, Ryo; Knapp, Gillian R; Kuzuhara, Masayuki; Kwon, Jungmi; Matsuo, Taro; McElwain, Michael W; Miyama, Shoken; Morino, Jun-Ichi; Moro-Martin, Amaya; Nishimura, Tetsuo; Pyo, Tae-Soo; Qi, Chunhua; Serabyn, Eugene; Suenaga, Takuya; Suto, Hiroshi; Suzuki, Ryuji; Takahashi, Yasuhiro H; Takami, Michihiro; Takato, Naruhisa; Terada, Hiroshi; Thalmann, Christian; Tomono, Daigo; Turner, Edwin L; Watanabe, Makoto; Yamada, Toru; Takami, Hideki; Usuda, Tomonori; Tamura, Motohide

    2015-01-01

    We present the first spatially resolved polarized scattered light H-band detection of the DoAr 28 transitional disk. Our two epochs of imagery detect the scattered light disk from our effective inner working angle of 0.10" (13 AU) out to 0.50" (65 AU). This inner working angle is interior to the location of the system's gap inferred by previous studies using SED modeling (15 AU). We detected a candidate point source companion 1.08" northwest of the system; however, our second epoch of imagery strongly suggests that this object is a background star. We constructed a grid of Monte Carlo Radiative Transfer models of the system, and our best fit models utilize a modestly inclined (50 deg), 0.01 Msun disk that has a partially depleted inner gap from the dust sublimation radius out to ~8 AU. Subtracting this best fit, axi-symmetric model from our polarized intensity data reveals evidence for two small asymmetries in the disk, which could be attributable to variety of mechanisms.

  6. Scout-view assisted interior micro-CT

    Science.gov (United States)

    Sharma, Kriti Sen; Holzner, Christian; Vasilescu, Dragoş M.; Jin, Xin; Narayanan, Shree; Agah, Masoud; Hoffman, Eric A.; Yu, Hengyong; Wang, Ge

    2013-06-01

    Micro computed tomography (micro-CT) is a widely-used imaging technique. A challenge of micro-CT is to quantitatively reconstruct a sample larger than the field-of-view (FOV) of the detector. This scenario is characterized by truncated projections and associated image artifacts. However, for such truncated scans, a low resolution scout scan with an increased FOV is frequently acquired so as to position the sample properly. This study shows that the otherwise discarded scout scans can provide sufficient additional information to uniquely and stably reconstruct the interior region of interest. Two interior reconstruction methods are designed to utilize the multi-resolution data without significant computational overhead. While most previous studies used numerically truncated global projections as interior data, this study uses truly hybrid scans where global and interior scans were carried out at different resolutions. Additionally, owing to the lack of standard interior micro-CT phantoms, we designed and fabricated novel interior micro-CT phantoms for this study to provide means of validation for our algorithms. Finally, two characteristic samples from separate studies were scanned to show the effect of our reconstructions. The presented methods show significant improvements over existing reconstruction algorithms.

  7. Interior microelectrolysis oxidation of polyester wastewater and its treatment technology

    International Nuclear Information System (INIS)

    This paper has investigated the effects of interior microelectrolysis pretreatment on polyester wastewater treatment and analyzed its mechanism on COD and surfactant removal. The efficiency of interior microelectrolysis is mainly influenced by solution pH, aeration and reaction time. Contaminants can be removed not only by redox reaction and flocculation in the result of ferrous and ferric hydroxides but also by electrophoresis under electric fields created by electron flow. pH confirms the chemical states of surfactants, Fe(II)/Fe(III) ratio and the redox potential, and thus influences the effects of electrophoresis, flocculation and redox action on contaminant removal. Anaerobic and aerobic batch tests were performed to study the degradation of polyester wastewater. The results imply that interior microelectrolysis and anaerobic pretreatment are lacking of effectiveness if applied individually in treating polyester wastewater in spite of their individual advantages. The interior microelectrolysis-anaerobic-aerobic process was investigated to treat polyester wastewater with comparison with interior microelectrolysis-aerobic process and anaerobic-aerobic process. High COD removal efficiencies have been gotten by the combination of interior microelectrolysis with anaerobic technology and aerobic technology. The results also imply that only biological treatment was less effective in polyester wastewater treatment.

  8. Geochemistry and 40Ar/39Ar age of Early Carboniferous dolerite sills in the southern Baltic Sea

    Directory of Open Access Journals (Sweden)

    Gediminas Motuza

    2015-08-01

    Full Text Available The Early Carboniferous magmatic event in the southern Baltic Sea is manifested by dolerite intrusions. The presumable area in which the dolerite intrusions occur ranges from 30 to 60 km in east–west direction, and is about 100 km in north–south direction. The dolerites were sampled in well D1-1 and investigated by applying chemical analysis and 40Ar/39Ar step-heating dating. Dolerites are classified as alkali and sodic, characterized by high TiO2 (3.92, 3.99 wt% and P2O5 (1.67, 1.77 wt% and low MgO (4.89, 4.91 wt% concentrations, enriched in light rare earth elements, originated from an enriched mantle magma source and emplaced in a continental rift tectonic setting. The 351 ± 11 Ma 40Ar/39Ar plateau age for groundmass plagioclase indicates a considerable age gap with the 310–250 Ma magmatism in southern Scandinavia and northern Germany. The magmatic rocks in the Baltic Sedimentary Basin are coeval with alkaline intrusions of NE Poland. Both magmatic provinces lie in the northwestward prolongation of the Pripyat–Dnieper–Donetsk Rift (370–359 Ma and may constitute a later phase of magmatic activity of this propagating rift system.

  9. ISEA reversed event in the Cretaceous Normal Superchron (CNS):40Ar/39Ar dating and paleomagnetic results

    Institute of Scientific and Technical Information of China (English)

    SHI Ruiping; HE Huaiyu; ZHU Rixiang; PAN Yongxin

    2004-01-01

    In order to provide the age for the ISEA (one reversed event in the CNS) a combined rock magnetic, paleomagnetic and geochronologic study has been conducted on two Cretaceous andesitic basalt lava flows from Sanbaoying, Liaoning Province of northeastern China. Rock magnetic investigations show that pseudo-single domain (PSD) titanomagnetite with poor-Ti content is the dominant magnetic mineral in Sanbaoying lava flows. Detailed systematic thermal demagnetization allowed us to isolate two remanence components after removing a low temperature component at 100℃/150℃; an intermediate temperature component with normal polarity at 150℃/200℃-380℃/400℃ and the characteristic remanence component (ChRM) with reversed polarity above 400℃/450℃. 40Ar/39Ar dating results show that Sanbaoying rocks were erupted at 116.0±0.3 Ma. Combination of paleomagnetic results and 40Ar/39Ar dating indicates that the reversed event recorded in Sanbaoying lavas corresponds to the ISEA event in the CNS. Our age determination for ISEA reversed event provides chronological evidence to study the relevance between global geological events that occurred in the CNS and geodynamo processes.

  10. 40Ar/39Ar dated climatic and hydrological variability between MIS20 and MIS18 at Sulmona Basin (central Italy)

    Science.gov (United States)

    Zanchetta, Giovanni; Giaccio, Biagio; Eleonora, Reagattieri; Nomade, Sebastien; Renne, Paul R.; Sprain, Courtney J.; Drysdale, Russell N.; Tzedakis, Polychronis C.; Messina, Paolo; Scardia, Giancarlo; Sposato, Andrea

    2015-04-01

    Understanding spatial-temporal variability, magnitude and different expressions of Quaternary millennial-scale palaeoclimatic changes is one of the frontier challenges of modern palaeoclimatology. Addressing this issue requires the acquisition of regionally representative, and ideally independently-dated, records of climatic variability. Multiproxy record (stable isotopes, XRF, MS, %CaCO3) from lacustrine succession of Sulmona basin (central Italy), highlights climatic and hydrological variability at orbital to millennial scales between MIS20 and MIS18. The record highlights the presence of interesting millennial scale variability within MIS19, considered to be the best orbital analogue of the current interglacial. The presence of several tephra layers precisely dated by 40Ar/39Ar technique, allow placement of the record within a robust time frame. Assembling a high-resolution paleoclimatic record for MIS19 anchored to a high-precision 40Ar/39Ar chronology, it is possible to show that the MIS 19c interglacial started shortly before the boreal summer insolation and obliquity maximum/precession minimum at 790-788 ka, and ended 11.6 ± 2.3 kyr later, when orbital parameters assumed a configuration similar to the present one.

  11. Ar-Ar geochronology of Late Mesozoic volcanic rocks from the Yanji area,NE China and tectonic implications

    Institute of Scientific and Technical Information of China (English)

    LI ChaoWen; GUO Feng; FAN WeiMing; GAO XiaoFeng

    2007-01-01

    Ar-Ar dating results of late Mesozoic-Cenozoic volcanic rocks from the Yanji area, NE China provide a new volcano-sedimentary stratigraphic framework. The previously defined "Triassic-Jurassic" volcanic rocks(including those from Sanxianling, Tuntianying, Tianqiaoling and Jingouling Fms.)were erupted during 118-106Ma,corresponding to Early Cretaceous. The new eruption age span is slightly younger than the main stage(130-120 Ma)of the extensive magmatism in the eastern Central Asian Orogenic Belt and its adjacent regions. Subduction-related adakites occurring in the previously defined Quanshuicun Fm. Were extruded at ca.55 Ma. Based on these new Ar-Ar ages, the late Mesozoic to Palaeocene volcano-sedimentary sequences is rebuilt as:Tuopangou Fm., Sanxianling/Tuntianying Fm.(118-115 Ma),Malugou/Tianqiaoling Fm.(K1),Huoshanyan/Jingouling Fm.(108-106 Ma),Changcai Fm.(K2),Quanshuicun Fm.(~55 Ma)and Dalazi Fm. Our results suggest that subduction of the Palaeo-Pacific Ocean beneath the East Asian continental margin occurred during 106to 55 Ma. Consistent with the paleomagnetic observations and magmatic records which indicated that the Izanagi-Farallon ridge subduction beneath the southwestern Japan took place during 95-65 Ma.

  12. Ar-Ar geochronology of Late Mesozoic volcanic rocks from the Yanji area, NE China and tectonic implications

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Ar-Ar dating results of late Mesozoic-Cenozoic volcanic rocks from the Yanji area, NE China provide a new volcano-sedimentary stratigraphic framework. The previously defined “Triassic-Jurassic” volcanic rocks (including those from Sanxianling, Tuntianying, Tianqiaoling and Jingouling Fms.) were erupted during 118―106 Ma, corresponding to Early Cretaceous. The new eruption age span is slightly younger than the main stage (130―120 Ma) of the extensive magmatism in the eastern Central Asian Orogenic Belt and its adjacent regions. Subduction-related adakites occurring in the previously defined Quanshuicun Fm. were extruded at ca. 55 Ma. Based on these new Ar-Ar ages, the late Mesozoic to Palaeocene volcano-sedimentary sequences is rebuilt as: Tuopangou Fm., Sanxianling/Tuntianying Fm. (118―115 Ma), Malugou/Tianqiaoling Fm. (K1), Huoshanyan/Jingouling Fm. (108―106 Ma), Changcai Fm. (K2), Quanshuicun Fm. (~55 Ma) and Dalazi Fm. Our results suggest that subduction of the Pa- laeo-Pacific Ocean beneath the East Asian continental margin occurred during 106 to 55 Ma, consistent with the paleomagnetic observations and magmatic records which indicated that the Izanagi-Farallon ridge subduction beneath the southwestern Japan took place during 95―65 Ma.

  13. Combined oxygen, hydrogen, /sup 40/Ar//sup 39/Ar isotopic evaluation of molybdenite mineralization, east Pioneer Mountains, Montana

    Energy Technology Data Exchange (ETDEWEB)

    Chesley, J.T.; Snee, L.W.; O' Neil, J.R.

    1985-01-01

    The Pear Lake molybdenite (moly) prospect is in the Eastern Pioneer Wilderness Area, 30 km south of the Cannivan Gulch moly deposit. It lies on a NW-SE trend with other prospects that are contemporaneous. Mineralized veins outcrop sporadically over a 4 square mile area, with a major concentration in the center of the study area. Previous studies have suggested potential moly-mineralization at depth. /sup 40/Ar//sup 39/Ar age-spectra on hornblend (hb) from the granodiorite host rock indicate emplacement at 75.0 +/- 1 Ma, with biotite closure at 69.0 +/- .3 Ma, in the vicinity of Pear Lake. Hydrothermal muscovites from the moly-bearing veins have ages of 68.0 +/- .5 Ma. partial resetting of biotite cooling dates in the vicinity of mineralization are observed, but biotites on the outer portion of the mineralizing system are undisturbed. These relations suggest that mineralization occurred after the host pluton had cooled to below 280/sup 0/C. Quartz-magnetite isotopic temperatures are 380 to 420/sup 0/C for moly-veins. These data suggest that magmatic hydrothermal fluids operated in the upper portion of this molysystem. These isotopic data, combined with geologic mapping, suggest that the Pear Lake moly prospect resulted from a weak, short-lived magmatic hydrothermal event at depth, and is unlikely to contain economic levels of molybdenum. The combined /sup 40/Ar//sup 39/Ar-stable isotope approach should prove useful in evaluating other hydrothermal systems.

  14. Infrared spectroscopy of ArOH: A direct probe of the Ar+OH X2Π potential energy surface

    International Nuclear Information System (INIS)

    An infrared-ultraviolet (IR-UV) double-resonance technique has been implemented to obtain the infrared spectrum of ArOH in the vicinity of the fundamental OH stretch at 2.8 μm. A rotationally resolved spectrum of the fundamental OH stretching band of ArOH is observed at 3567.85(1) cm-1 (origin). A combination band, involving both OH stretch and intermolecular bending excitation, is identified at 3577.00(1) cm-1 (origin). The intermolecular energy of the excited bending state provides a direct measure of the anisotropy of the Ar+OH X2Π interaction potential. The rotational structure of the combination band reveals a large splitting between parity components with the same total angular momentum in the excited bending state [0.69(1) cm-1 for J=(3/2)]. The experimentally derived parity splitting is compared with previous experimental and theoretical determinations of this parameter. The parity splitting associated with the excited bending state reflects the change in the intermolecular potential when the pπ orbital containing the unpaired electron of OH lies in or out of the ArOH plane. (c) 2000 American Institute of Physics

  15. Mineralogy and Ar-39 - Ar-40 of an old pristine basalt: Thermal history of the HED parent body

    Science.gov (United States)

    Takeda, Hiroshi; Mori, Hiroshi; Bogard, Donald D.

    1994-01-01

    Previous investigations of mineral chemistry and Rb-Sr and Sm-Nd ages indicated that clast,84 from eucrite Yamato 75011 had preserved the pristine nature of its initial crystallization during an early stage of the HED parent body. Microscale mineralogy and Ar-39-Ar-40 ages of this clast, however, revealed local disturbance of microtextures and partially reset ages. This evidence suggests that, in addition to initial crystallization and rapid cooling, the Y75011,84 clast experienced shock deformation, reheating of short duration at higher temperature, and brecciation. These characteristics suggest two or more impact events. Fe-rich olivine filling fractures in pyroxene may have been introduced during the accompanying shock fracturing. The inferred Ar-39-Ar-40 degassing ages for Y75011 matrix and clast, 84 are 3.94 +/- 0.04 Ga and 3.98 +/- 0.03 Ga, respectively. The suggested degassing age for a clast from Y790020, believed to be paired with Y75011, is approximately 4.03 Ga, but could be younger. We consider it likely that all three samples experienced a common degassing event 3.95 +/- 0.05 Ga ago, but we cannot rule out two or more events spaced over a approximately 0.1 Ga interval. Higher temperature extractions of the two clast samples show significantly older apparent ages up to approximately 4.5 Ga and suggest that the time/temperature regime of this event was not sufficient to degas Ar totally. Most likely, the K-Ar ages were reset by thermal metamorphism associated with one or more impact events associated with shock fracturing, formation of Fe-rich olivine veins, and/or meteorite brecciation. The pyroxene annealing that commonly occurs in many eucrites is likely to be a much earlier process than the impact-produced textural changes and reset K-Ar ages observed in these meteorites. The existence of mineralogical and chronological evidence for metamorphism in an otherwise pristine eucrite suggests that the HED parent body experienced an extensive degree of

  16. I-Xe and 40Ar-39Ar dating of silicate from Weekeroo Station and Netschaevo IIE iron meteorites

    International Nuclear Information System (INIS)

    Silicate inclusions from two IIE iron meteorites were dated by the I-Xe and 40Ar-39Ar techniques. Weekeroo Station, a 'normal' IIE iron, shows no loss of radiogenic 40Ar at low temperature, and the well defined 40Ar-39Ar plateau yields an age of 4.54 +- 0.03 Byr. The xenon data define a good I-Xe correlation with an age of + 10.9 +- 0.5 Myr relative to Bjurbole. Despite its relatively young age, Weekeroo Station's (129Xe/132Xe)sub(trapped) ratio (= 0.84 +- 0.05) lies significantly below the solar value. Netschaevo silicate has a chondritic composition, unlike 'normal' IIE silicate which is more differentiated. Nevertheless Netschaevo gives a 40Ar-39Ar plateau-age of only 3.79 +- 0.03 Byr, with the xenon data failing to define an I-Xe isochron. Only irons from the IAB and IIE groups contain silicate inclusions, but these two groups differ in many other respects, mostly suggesting that IAB meteorites are more primitive. The I-Xe chronology supports this suggestion inasmuch as Weekeroo Station formed well after IAB silicates. The four silicate-bearing IIE irons which have now been dated can be subdivided into distinct pairs: Weekeroo Station and Colomera formed near the beginning of the solar system, while Netschaevo and Kodaikanal both formed only 3.8 Byr ago. A review of other properties of these meteorites generally supports this subdivision. This work underscores the complexity of the history of IIE meteorites; in particular, an adequate model must account for the formation of two IIE irons at 3.8 Byr without disturbing rare gases in Weekeroo Station. All formation models are quite speculative, but the one which seems best to fit the available evidence postulates two parent bodies: the 3.8 Byr old silicate formed on one parent body, all other IIE material resided in a separate body, and subsequent collision(s) mixed the young silicate with IIE metal. (author)

  17. 40Ar/39Ar impact ages and time-temperature argon diffusion history of the Bunburra Rockhole anomalous basaltic achondrite

    Science.gov (United States)

    Jourdan, Fred; Benedix, Gretchen; Eroglu, Ela.; Bland, Phil. A.; Bouvier, Audrey.

    2014-09-01

    The Bunburra Rockhole meteorite is a brecciated anomalous basaltic achondrite containing coarse-, medium- and fine-grained lithologies. Petrographic observations constrain the limited shock pressure to between ca. 10 GPa and 20 GPa. In this study, we carried out nine 40Ar/39Ar step-heating experiments on distinct single-grain fragments extracted from the coarse and fine lithologies. We obtained six plateau ages and three mini-plateau ages. These ages fall into two internally concordant populations with mean ages of 3640 ± 21 Ma (n = 7; P = 0.53) and 3544 ± 26 Ma (n = 2; P = 0.54), respectively. Based on these results, additional 40Ar/39Ar data of fusion crust fragments, argon diffusion modelling, and petrographic observations, we conclude that the principal components of the Bunburra Rockhole basaltic achondrite are from a melt rock formed at ∼3.64 Ga by a medium to large impact event. The data imply that this impact generated high enough energy to completely melt the basaltic target rock and reset the Ar systematics, but only partially reset the Pb-Pb age. We also conclude that a complete 40Ar∗ resetting of pyroxene and plagioclase at this time could not have been achieved at solid-state conditions. Comparison with a terrestrial analog (Lonar crater) shows that the time-temperature conditions required to melt basaltic target rocks upon impact are relatively easy to achieve. Ar data also suggest that a second medium-size impact event occurred on a neighbouring part of the same target rock at ∼3.54 Ga. Concordant low-temperature step ages of the nine aliquots suggest that, at ∼3.42 Ga, a third smaller impact excavated parts of the ∼3.64 Ga and ∼3.54 Ga melt rocks and brought the fragments together. The lack of significant impact activity after 3.5 Ga, as recorded by the Bunburra Rockhole suggests that (1) either the meteorite was ejected in a small secondary parent body where it resided untouched by large impacts, or (2) it was covered by a porous heat

  18. 40Ar/39Ar geochronology, paleomagnetism, and evolution of the Boring volcanic field, Oregon and Washington, USA

    Science.gov (United States)

    Fleck, Robert J.; Hagstrum, Jonathan T.; Calvert, Andrew T.; Evarts, Russell C.; Conrey, Richard M.

    2014-01-01

    The 40Ar/39Ar investigations of a large suite of fine-grained basaltic rocks of the Boring volcanic field (BVF), Oregon and Washington (USA), yielded two primary results. (1) Using age control from paleomagnetic polarity, stratigraphy, and available plateau ages, 40Ar/39Ar recoil model ages are defined that provide reliable age results in the absence of an age plateau, even in cases of significant Ar redistribution. (2) Grouping of eruptive ages either by period of activity or by composition defines a broadly northward progression of BVF volcanism during latest Pliocene and Pleistocene time that reflects rates consistent with regional plate movements. Based on the frequency distribution of measured ages, periods of greatest volcanic activity within the BVF occurred 2.7–2.2 Ma, 1.7–0.5 Ma, and 350–50 ka. Grouped by eruptive episode, geographic distributions of samples define a series of northeast-southwest–trending strips whose centers migrate from south-southeast to north-northwest at an average rate of 9.3 ± 1.6 mm/yr. Volcanic activity in the western part of the BVF migrated more rapidly than that to the east, causing trends of eruptive episodes to progress in an irregular, clockwise sense. The K2O and CaO values of dated samples exhibit well-defined temporal trends, decreasing and increasing, respectively, with age of eruption. Divided into two groups by K2O, the centers of these two distributions define a northward migration rate similar to that determined from eruptive age groups. This age and compositional migration rate of Boring volcanism is similar to the clockwise rotation rate of the Oregon Coast Range with respect to North America, and might reflect localized extension on the trailing edge of that rotating crustal block.

  19. AR-39Ar-40 dating of basalts and rock breccias from Apollo 17 and the malvern achondrite

    Science.gov (United States)

    Kirsten, T.; Horn, P.

    1977-01-01

    The principles and the potential of the Ar-39/Ar-40 dating technique are illustrated by means of results obtained for 12 Apollo 17 rocks. Emphasis is given to methodical problems and the geological interpretation of lunar rock ages. Often it is ambigious to associate a given lunar breccia with a certain formation, or a formation with a basin. In addition, large-scale events on the Moon have not necessarily reset radiometric clocks completely. One rock fragment has a well-defined plateau age of 4.28 b.y., but the ages of two Apollo 17 breccias define an upper limit for the formation age of the Serenitatis basin at 4.05 b.y. Ages derived from five mare basalts indicate cessation of mare volcanism at Taurus-Littrow approximately 3.78 b.y. ago. Ca/Ar-37 exposure ages show that Camelot Crater was formed by an impact approximately 95 m.y. ago. After a short summary of the lunar timetable as it stands at the end of the Apollo program, we report about Ar-39/Ar-40 and rare gas studies on the Malvern meteorite. This achondrite resembles lunar highland breccias in texture as well as in rare-gas patterns. It was strongly annealed at some time between 3.4 and 3.8 b.y. ago. The results indicate that very similar processes have occurred on the Moon and on achondritic parent bodies at comparable times, leading to impact breccias with strikingly similar features, including the retention of rare-gas isotopes from various sources.

  20. Development of a Low-Level Ar-37 Calibration Standard

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Richard M.; Aalseth, Craig E.; Bowyer, Ted W.; Day, Anthony R.; Fuller, Erin S.; Haas, Derek A.; Hayes, James C.; Hoppe, Eric W.; Humble, Paul H.; Keillor, Martin E.; LaFerriere, Brian D.; Mace, Emily K.; McIntyre, Justin I.; Miley, Harry S.; Myers, Allan W.; Orrell, John L.; Overman, Cory T.; Panisko, Mark E.; Seifert, Allen

    2016-03-07

    Argon-37 is an important environmental signature of an underground nuclear explosion. Producing and quantifying low-level 37Ar standards is an important step in the development of sensitive field measurement instruments for use during an On-Site Inspection, a key provision of the Comprehensive Nuclear-Test-Ban Treaty. This paper describes progress at Pacific Northwest National Laboratory (PNNL) in the development of a process to generate and quantify low-level 37Ar standard material, which can then be used to calibrate sensitive field systems at activities consistent with soil background levels. The 37Ar used for our work was generated using a laboratory-scale, high-energy neutron source to irradiate powdered samples of calcium carbonate. Small aliquots of 37Ar were then extracted from the head space of the irradiated samples. The specific activity of the head space samples, mixed with P10 (90% stable argon:10% methane by mole fraction) count gas, is then derived using the accepted Length-Compensated Internal-Source Proportional Counting method. Due to the low activity of the samples, a set of three Ultra-Low Background Proportional-Counters designed and fabricated at PNNL from radio-pure electroformed copper was used to make the measurements in PNNL’s shallow underground counting laboratory. Very low background levels (<10 counts/day) have been observed in the spectral region near the 37Ar emission feature at 2.8 keV. Two separate samples from the same irradiation were measured. The first sample was counted for 12 days beginning 28 days after irradiation, the second sample was counted for 24 days beginning 70 days after irradiation (the half-life of 37Ar is 35.0 days). Both sets of measurements were analyzed and yielded very similar results for the starting activity (~0.1 Bq) and activity concentration (0.15 mBq/ccSTP argon) after P10 count gas was added. A detailed uncertainty model was developed based on the ISO Guide to the Expression of Uncertainty in

  1. Renal coccidiosis in interior Canada geese, Branta canadensis interior Todd, of the Mississippi Valley population

    Science.gov (United States)

    Tuggle, Benjamin N.; Crites, John L.

    1984-01-01

    Kidneys from 309 Interior Canada geese from three locations in the Mississippi Flyway were examined for renal coccidia. Oocysts and/or young zygotes of Eimeria sp. were found in 6.8% of goose kidneys sampled. Only one type of renal coccidian oocyst was observed. Significantly more immature geese were infected than adults; however, there was no significant difference observed between the prevalences of infection in male and female birds. A host cellular response to zygotes and oocysts was noted in the majority of infected adult geese. Heavily infected kidneys were hypertrophic with minute foci on the surface of the organ. Histological examinations showed large numbers of unsporulated oocysts accumulated in distended collecting tubules, resulting in pressure necrosis to adjacent tissue and urate retention. Zygotes were observed in the cytoplasm of tubule cells and extracellularly in interstitial tissue. Infected tubule cells were characterized by the peripheral location of the nuclei, cytoplasmic basophilia, and cellular hypertrophy. This is the first report of an Eimeria sp. in the kidneys of Canada geese of the Mississippi Valley population.

  2. Compressões medicares provocadas por mielomas vertebrais

    Directory of Open Access Journals (Sweden)

    Adherbal Tolosa

    1956-06-01

    Full Text Available Os autores apresentam 4 casos de mieloma vertebral, com invasão do espaço epidural, provocando compressão medular ou radículo-medular. Em um caso havia lesões em vários ossos; noutro foi verificada apenas osteólise costal, além da lesão vertebral; nos demais tratava-se, provavelmente, de formas solitárias. A lesão se localizou entre C7 e T9, nos 4 casos. Em nenhum deles se verificou invasão do espaço subdural. Em 3 casos a sintomatologia era representada por paraplegia crural sensitivo-motora; em 1 caso prevaleciam sintomas radiculálgicos. Dos exames complementares destacam-se: presença de proteinuria de Bence-Jones e anormalidade do mielograma só verificadas no caso de mielo-matose generalizada; neste caso foi observada também redução da colesterolemia, hiperuricemia e positividade de algumas provas de função hepática; a eletroforese das proteínas plasmáticas, efetuada no caso 4, revelou diminuição da albumina e discreto aumento das taxas de globulina α1 e α2; o exame do liqüido cefalorraqueano, por punção lombar, revelou sempre a síndrome de compressão medular; o bloqueio do canal raqueano e seu nível foram comprovados por perimielografia, que confirmou os elementos clínicos de localização, sendo, entretanto, sugestiva de tumor intramedular em um caso. O tratamento consistiu em laminectomia, com extirpação do tecido tumoral peridural, seguida de radioterapia em altas doses. Os resultados obtidos foram altamente satisfatórios em 3 casos, porém o paciente com mielo-matose múltipla não se beneficiou, vindo a falecer um ano após a operação.

  3. Dermatoses provocadas por plantas (fitodermatoses Dermatosis due to plants (phytodermatosis

    Directory of Open Access Journals (Sweden)

    Vitor Manoel Silva dos Reis

    2010-08-01

    Full Text Available As dermatoses causadas por plantas são relativamente comuns no nosso meio e podem ocorrer por diversos mecanismos patogênicos. São descritas dermatoses por trauma físico, por ação farmacológica, mediadas por IgE, por irritação, por ação conjunta da luz e por sensibilização. Também são descritas na introdução desta revisão as pseudofitodermatoses causadas por elementos veiculados pelas plantas e, por isso, aparentemente causadas pelas plantas.Dermatosis caused by plants is relatively common and may occur by various pathogenic mechanisms. Dermatitis due to physical trauma, pharmacological action, irritation, sensitization, mediated by IgE and induced by light are described. Pseudophytodermatosis caused by plant-delivered elements is also described in the introduction to this work.

  4. Ulcera cutanea provocada por hongos del genero Fusarium

    Directory of Open Access Journals (Sweden)

    Negroni Ricardo

    1997-01-01

    Full Text Available Se presenta el caso de un paciente oriundo y procedente del Paraguay, de 40 años de edad, portador de una ulceración crónica en cara externa del pie izquierdo, de 2 meses de evolución, debida a una hialohifomicosis por Fusarium oxysporum. Se destacan las características clínicas, métodos de diagnóstico y terapeútica de esta micosis, además de las diferentes etiologías a considerar en el diagnóstico diferencial de una úlcera en personas procedentes del área tropical o subtropical.

  5. Ryoji Ikeda, Data Artist - Prix Ars Electronica Collide@CERN

    CERN Document Server

    CERN. Geneva; Koek, Ariane; Heuer, Rolf; Ikeda, Ryoji; Mr. Horst, Hoertner

    2014-01-01

    at the CERN Globe of Science and Innovation, CERN. You are very warmly invited to the opening presentation of Data Artist, Ryoji Ikeda’s residency at CERN. Ryoji Ikeda, one of the world’s leading electronic composers and visual artists, is the new Prix Ars Electronica Collide@CERN award winner. Ryoji Ikeda and his science inspiration partner, Theoretical Physicist, Dr. Tom Melia will talk about their work in arts and science. They are at the beginning of their creative journey together at CERN. A little about Ryoji Ikeda – the new Prix Ars Electronica Collide@CERN artist in residence. Ryoji Ikeda focuses on the essential characteristics of sound itself and that of visuals as light by means of both mathematical precision and mathematical aesthetics. Ikeda has gained a reputation as one of the few international artists working convincingly across both visual ...

  6. Progreso y retos de la geocronología 40Ar/39Ar en Costa Rica y Nicaragua Progress and Challenges Using 40Ar/39Ar Geochronology in Costa Rica and Nicaragua

    Directory of Open Access Journals (Sweden)

    Ian Saginor¹

    2011-12-01

    Full Text Available Con el principal objetivo de realizar mejores cálculos de la producción volcánica, en el Arco Volcánico de América Central, realizamos 61 dataciones 40Ar/39Ar en tefras y lavas en localidades de frente volcánico de Costa Rica y Nicaragua por medio de varias campañas de campo y análisis de laboratorio (preparación de muestras, envió al reactor nuclear, espectroscopía de masas de las muestras radiactivas, al laboratorio de gases nobles del Departamento de Ciencias de la Tierra y Planetarias de la Universidad Rutgers del 2002-2008. En este artículo presentamos diferentes observaciones que resultaron de este estudio donde se describe la precisión, exactitud y la confiabilidad de las edades 40Ar/39Ar. El primer resultado muestra las limitaciones de esta técnica en muestras baja en K2O con edades To better estimate the extrusive flux of the Central American Arc, from 2002-2008, we obtained sixty one high precision 40Ar/39Ar ages on geographically well-situated lavas and tephra from Costa Rica and Nicaragua. Here, we describe a number of observations encountered during this study using four examples that well document the precision, accuracy and general reliability of the 40Ar/39Ar ages. First, low K2O values, particularly in samples from Nicaragua, is a major limitation in or attempts to obtain reliable dates on samples under 1 My. Second, extensive weathering of samples due to the tropical climate of Central America has resulted in various levels of argon loss even when the hand sample appeared unaltered. Third, our field and geochronological data lead us to conclude that eruptive rates have not been constant over the past 15 to 20 My, but rather appears punctuated by gaps of up to several million years. We attempted to address the temporal gaps in several ways. First, geochemical analyses were used to identify samples that may have erupted during time periods without known volcanism. For example, U/Th values in the active Central

  7. Medidas da umidade relativa do ar em um ambiente fechado

    Directory of Open Access Journals (Sweden)

    Costa Eden V.

    2003-01-01

    Full Text Available Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de preencher a lacuna dos livros de texto de física, que, em geral, negligenciam este tópico.

  8. Simulation of Carbon Nanotube Welding through Ar bombardment

    CERN Document Server

    Kucukkal, Mustafa U

    2014-01-01

    Single-walled carbon nanotubes show promise as nanoscale transistors, for nanocomputing applications. This use will require appropriate methods for creating electrical connections between distinct nanotubes, analogous to welding of metallic wires at larger length scales, but methods for performing nanoscale chemical welding are not yet sufficiently understood. This study examined the effect of Ar bombardment on the junction of two crossed single-walled carbon nanotubes, to understand the value and limitations of this method for generating connections between nanotubes. A geometric criterion was used to assess the quality of the junctions formed, with the goal of identifying the most productive conditions for experimental ion bombardment. In particular, the effects of nanotube chirality, Ar impact kinetic energy, impact particle flux and fluence, and annealing temperature were considered. The most productive bombardment conditions, leading to the most crosslinking of the tubes with the smallest loss of graphit...

  9. Constraining the alteration history of a Late Cretaceous Patagonian volcaniclastic bentonite-ash-mudstone sequence using K-Ar and 40Ar/39Ar isotopes

    Science.gov (United States)

    Warr, L. N.; Hofmann, H.; van der Pluijm, B. A.

    2016-03-01

    Smectite is typically considered unsuitable for radiometric dating, as argon (40Ar) produced from decay of exchangeable potassium (40K) located in the interlayer sites can be lost during fluid-rock interaction and/or during wet sample preparation in the laboratory. However, age analysis of Late Cretaceous Argentinian bentonites and associated volcaniclastic rocks from Lago Pellegrini, Northern Patagonia, indicates that, in the case of these very low-permeability rocks, the radioactive 40Ar was retained and thus can provide information on smectite age and the timing of rock alteration. This study presents isotopic results that indicate the ash-to-bentonite conversion and alteration of the overlying tuffaceous mudstones in Northern Patagonia was complete ~13-17 my after middle Campanian sedimentation when the system isotopically closed. The general absence of illite in these smectite-rich lithologies reflects the low activity of K and the low temperature (<60 °C) of the formation waters that altered the parent ash.

  10. arXiv in the classical Russian literature

    CERN Document Server

    Silagadze, Z K

    2012-01-01

    The creation of arXiv, a highly democratic open access repository of research papers in high-energy physics more than twenty years ago was undoubtedly the most spectacular and landmark event for the high-energy physics community. However, we report a curious observation which indicates that the general cultural significance of this event extends far beyond the boundaries assumed at the beginning.

  11. BUSINESS ETHICS: THE CASE OF AR CONSULTORIA LTD A

    Directory of Open Access Journals (Sweden)

    Fernando Fantoni Bencke

    2014-03-01

    business: the significant taxes, lack of incentives and credit available and the opportunity to “make a little extra” through informal sales. AR Consultoria’s entry to the market was marked by these and other difficulties. This case aims at presenting a real situation that can be found in some organizational sectors areas, which demands readers to take a decision and an ethical stance when faced with moral challenges.

  12. AR-based Method for ECG Classification and Patient Recognition

    OpenAIRE

    Branislav Vuksanovic; Mustafa Alhamdi

    2013-01-01

    The electrocardiogram (ECG) is the recording of heart activity obtained by measuring the signals from electrical contacts placed on the skin of the patient. By analyzing ECG, it is possible to detect the rate and consistency of heartbeats and identify possible irregularities in heart operation. This paper describes a set of techniques employed to pre-process the ECG signals and extract a set of features – autoregressive (AR) signal parameters used to characterise ECG signal. Extracted paramet...

  13. AR-based Method for ECG Classification and Patient Recognition

    Directory of Open Access Journals (Sweden)

    Branislav Vuksanovic

    2013-09-01

    Full Text Available The electrocardiogram (ECG is the recording of heart activity obtained by measuring the signals from electrical contacts placed on the skin of the patient. By analyzing ECG, it is possible to detect the rate and consistency of heartbeats and identify possible irregularities in heart operation. This paper describes a set of techniques employed to pre-process the ECG signals and extract a set of features – autoregressive (AR signal parameters used to characterise ECG signal. Extracted parameters are in this work used to accomplish two tasks. Firstly, AR features belonging to each ECG signal are classified in groups corresponding to three different heart conditions – normal, arrhythmia and ventricular arrhythmia. Obtained classification results indicate accurate, zero-error classification of patients according to their heart condition using the proposed method. Sets of extracted AR coefficients are then extended by adding an additional parameter – power of AR modelling error and a suitability of developed technique for individual patient identification is investigated. Individual feature sets for each group of detected QRS sections are classified in p clusters where p represents the number of patients in each group. Developed system has been tested using ECG signals available in MIT/BIH and Politecnico of Milano VCG/ECG database. Achieved recognition rates indicate that patient identification using ECG signals could be considered as a possible approach in some applications using the system developed in this work. Pre-processing stages, applied parameter extraction techniques and some intermediate and final classification results are described and presented in this paper.

  14. Improvement of Interior Ballistic Performance Utilizing Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    Hazem El Sadek

    2014-01-01

    Full Text Available This paper investigates the interior ballistic propelling charge design using the optimization methods to select the optimum charge design and to improve the interior ballistic performance. The propelling charge consists of a mixture propellant of seven-perforated granular propellant and one-hole tubular propellant. The genetic algorithms and some other evolutionary algorithms have complex evolution operators such as crossover, mutation, encoding, and decoding. These evolution operators have a bad performance represented in convergence speed and accuracy of the solution. Hence, the particle swarm optimization technique is developed. It is carried out in conjunction with interior ballistic lumped-parameter model with the mixture propellant. This technique is applied to both single-objective and multiobjective problems. In the single-objective problem, the optimization results are compared with genetic algorithm and the experimental results. The particle swarm optimization introduces a better performance of solution quality and convergence speed. In the multiobjective problem, the feasible region provides a set of available choices to the charge’s designer. Hence, a linear analysis method is adopted to give an appropriate set of the weight coefficients for the objective functions. The results of particle swarm optimization improved the interior ballistic performance and provided a modern direction for interior ballistic propelling charge design of guided projectile.

  15. Emotion and interior space design: an ergonomic perspective.

    Science.gov (United States)

    Reddy, Swathi Matta; Chakrabarti, Debkumar; Karmakar, Sougata

    2012-01-01

    Interaction between the users and their environment is spontaneous and unavoidable. This interaction can be positive or negative. A good interior space is about considering all the physical, environmental and cognitive elements and harmonizing them to make it a space that feels right, functionally and emotionally. The important element that has to be considered the most in an interior space is the "user". Balancing all these elements is a challenging job and results in a perfect interior space design. This paper intends to bring to light the necessity of designing an optimum interior space, which is a balance of the user's choice and the mandatory standards that ought to be followed for user safety and convenience. There has to be an intervening domain of ergonomics which will guide to bring out a balance between the personal choice of the user and the usual standards followed. It should also provide a step-by-step information, guidance and direction to act to the specifications and standards systematically to adapt an integrated approach of handling all the elements holistically which will indeed result in a good interior space.

  16. Transfer ionization of the isocharge sequence ion and Ar collisions

    Institute of Scientific and Technical Information of China (English)

    Cai Xiao-Hong; Yu De-Yang; Cao Zhu-Rong; Lu Rong-Chun; Yang Wei; Shao Cao-Jie; Chen Xi-Meng

    2004-01-01

    The ratios of transfer ionization to single capture for isocharge Cq+, Nq+, Oq+, Neq+ ions on Ar atoms are measured by using position-sensitive and time-of-flight techniques. It is found that the ratio R1 increases with nuclear charge Z in a q=4 sequence, and the ratio R1 sequences have the minimum values at Z=7 and Z=8 in q=5 and q=6 sequences, respectively, and the ratio R1 decreases with the increase in the nuclear charge Z in a q=7 sequence. The results may be explained within the frame of the statistical model. It may be concluded that the transfer ionization depends remarkably upon the electronic structure of the projectile. The projectiles used in this study have the same charge state and velocity, but different electronic structures. The dependence of the ratio R1 on q is studied for Neq+-Ar collisions. The ratio R1 is found to increase as q increases for Neq+-Ar collisions. The measured dependence of the ratio R1 on q is compared with the calculation using the molecular Coulomb over-barrier model.

  17. Electrical properties and dielectric spectroscopy of Ar+ implanted polycarbonate

    Science.gov (United States)

    Chawla, Mahak; Shekhawat, Nidhi; Aggarwal, Sanjeev; Sharma, Annu; Nair, K. G. M.

    2015-05-01

    The aim of the present paper is to study the effect of argon ion implantation on electrical and dielectric properties of polycarbonate. Specimens were implanted with 130 keV Ar+ ions in the fluence ranging from 1×1014 to 1×1016 ions cm-2. The beam current used was ˜0.40 µA cm-2. The electrical conduction behaviour of virgin and Ar+ implanted polycarbonate specimens have been studied through current-voltage (I-V characteristic) measurements. It has been observed that after implantation conductivity increases with increasing ion fluence. The dielectric spectroscopy of these specimens has been done in the frequency range of 100 kHz-100 MHz. Relaxation processes were studied by Cole-Cole plot of complex permittivity (real part of complex permittivity, ɛ' vs. imaginary part of complex permittivity, ɛ″). The Cole-Cole plots have also been used to determine static dielectric constant (ɛs), optical dielectric constant (ɛ∞), spreading factor (α), average relaxation time (τ0) and molecular relaxation time (τ). The dielectric behaviour has been found to be significantly affected due to Ar+ implantation. The possible correlation between this behaviour and the changes induced by the implantation has been discussed.

  18. Atomic data and spectral line intensities for Ar XIII

    International Nuclear Information System (INIS)

    The energy levels, oscillator strengths, spontaneous radiative decay rates, and electron impact collision strengths are calculated for Ar XIII using the recently developed Flexible Atomic Code (FAC). These data pertain to the 224 levels belonging to the following configurations: 2s22p2, 2s2p3, 2p4, 2s22p3l, 2s2p23l, 2s22p4l (l = s, p, d, f), 2s22p5s, 2s22p5p, and 2s22p5d. Effective collision strengths are obtained at five electron temperatures: log Te (K) = 5.0, 5.5, 6.0, 6.5, and 7.0 by integrating the collision strengths over a Maxwellian electron distribution. These atomic data are generated to support the interpretation of astrophysical objects as well as fusion plasmas, which frequently contain emission lines from Ar XIII. This work supplements previous work published by Bhatia by extending the calculation of effective collision strengths and radiative decay rates to n = 5 configurations. Level populations and spectral line intensities are obtained by solving the rate equations of the 224 energy levels at densities of 108, 109, 1010, 1011, and 1012 cm-3 and a temperature of 2.51 x 106 K. This temperature is typical for Ar XIII when formed at equilibrium by collisional ionization and recombination

  19. Drosophila ARSs contain the yeast ARS consensus sequence and a replication enhancer.

    OpenAIRE

    Mills, J S; Kingsman, A J; Kingsman, S M

    1986-01-01

    A number of restriction fragments that function as autonomously replicating sequences (ARSs) in yeast have been isolated from Drosophila melanogaster DNA. The behaviour in yeast of plasmids containing Drosophila ARS elements was studied and compared to that exhibited by the archetypal yeast ARS-1 plasmid. ARS functions were localised by subcloning and BAL-31 deletion analysis. These studies demonstrated the structural and functional complexity of Drosophila ARSs. Each Drosophila ARS element h...

  20. A comparative study of CF4/O2/Ar and C4F8/O2/Ar plasmas for dry etching applications

    International Nuclear Information System (INIS)

    The effect of the O2/Ar mixing ratio in CF4/O2/Ar and C4F8/O2/Ar inductively coupled plasmas with a 50% fluorocarbon gas content on plasma parameters and active species densities, which influence dry etching mechanisms, was analyzed. The investigation combined plasma diagnostics using Langmuir probes and zero-dimensional plasma modeling. It was found that, in both gas systems, the substitution of Ar for O2 results in a similar change in the ion energy flux but causes the opposite behavior for the F atom flux. The mechanisms of these phenomena are discussed with regards to plasma chemistry. - Highlights: • The goal was to conduct a comparative study of CF4/O2/Ar and C4F8/O2/Ar plasmas. • The focus was on the parameters directly influencing dry etching mechanisms. • Model-based analysis for neutral species was used in this paper

  1. Chromosomal context and replication properties of ARS plasmids in Schizosaccharomyces pombe

    Indian Academy of Sciences (India)

    Aditya S Pratihar; Vishnu P Tripathi; Mukesh P Yadav; Dharani D Dubey

    2015-12-01

    Short, specific DNA sequences called as Autonomously Replicating Sequence (ARS) elements function as plasmid as well as chromosomal replication origins in yeasts. As compared to ARSs, different chromosomal origins vary greatly in their efficiency and timing of replication probably due to their wider chromosomal context. The two Schizosaccharomyces pombe ARS elements, ars727 and ars2OO4, represent two extremities in their chromosomal origin activity - ars727 is inactive and late replicating, while ars2OO4 is a highly active, early-firing origin. To determine the effect of chromosomal context on the activity of these ARS elements, we have cloned them with their extended chromosomal context as well as in the context of each other in both orientations and analysed their replication efficiency by ARS and plasmid stability assays. We found that these ARS elements retain their origin activity in their extended/altered context. However, deletion of a 133-bp region of the previously reported ars727-associated late replication enforcing element (LRE) caused advancement in replication timing of the resulting plasmid. These results confirm the role of LRE in directing plasmid replication timing and suggest that the plasmid origin efficiency of ars2OO4 or ars727 remains unaltered by the extended chromosomal context.

  2. Bartlett correction in the stable AR(1) model with intercept and trend

    NARCIS (Netherlands)

    N.P.A. van Giersbergen

    2009-01-01

    Bartlett corrections are derived for testing hypotheses about the autoregressive parameter ρ in the stable (a) AR(1) model, (b) AR(1) model with intercept, (c) AR(1) model with intercept and linear trend. The correction is found explicitly as a function of ρ. In the models with deterministic terms,

  3. File list: Oth.ALL.20.AR.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.AR.AllCell hg19 TFs and others AR All cell types SRX595676,SRX595671,SRX...736053,SRX502068,SRX092448,SRX092447,SRX861678,SRX147604,SRX1033268 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.ALL.20.AR.AllCell.bed ...

  4. File list: Oth.Brs.05.AR.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.Brs.05.AR.AllCell hg19 TFs and others AR Breast SRX1339020,SRX1339018,SRX250092...,SRX1339019,SRX1339016,SRX1339017,SRX1339015 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.Brs.05.AR.AllCell.bed ...

  5. Repression of Runx2 by Androgen Receptor (AR) in Osteoblasts and Prostate Cancer Cells: AR Binds Runx2 and Abrogates Its Recruitment to DNA

    OpenAIRE

    Baniwal, Sanjeev K.; Khalid, Omar; Sir, Donna; Buchanan, Grant; Coetzee, Gerhard A.; Frenkel, Baruch

    2009-01-01

    Runx2 and androgen receptor (AR) are master transcription factors with pivotal roles in bone metabolism and prostate cancer (PCa). We dissected AR-mediated repression of Runx2 in dihydrotestosterone (DHT)-treated osteoblastic and PCa cells using reporter assays and endogenous Runx2 target genes. Repression required DHT, but not AR’s transactivation function, and was associated with nuclear colocalization of the two proteins. Runx2 and AR coimmunoprecipitated and interacted directly in glutath...

  6. Model Based Control of Moisture Sorption in a Historical Interior

    Directory of Open Access Journals (Sweden)

    P. Zítek

    2005-01-01

    Full Text Available This paper deals with a novel scheme for microclimate control in historical exhibition rooms, inhibiting moisture sorption phenomena that are inadmissible from the preventive conservation point of view. The impact of air humidity is the most significant harmful exposure for a great deal of the cultural heritage deposited in remote historical buildings. Leaving the interior temperature to run almost its spontaneous yearly cycle, the proposed non-linear model-based control protects exhibits from harmful variations in moisture content by compensating the temperature drifts with an adequate adjustment of the air humidity. Already implemented in a medieval interior since 1999, the proposed microclimate control has proved capable of permanently maintaining constant a desirable moisture content in organic or porous materials in the interior of a building. 

  7. Structure and physical properties of the Earth's interior

    Institute of Scientific and Technical Information of China (English)

    臧绍先; 周蕙兰; 魏荣强; 周元泽

    2003-01-01

    The studies on the structure and physical properties of the Earth's interior done by Chinese geophysicists from 1999 to 2002 were reviewed in this paper. It includes several research areas: the structure of the Earth's interiors using seismic tomography, anisotropy of the upper mantle in China and its adjacent areas, quality factor Qβ for S waves, subduction zone, mantle discontinuities, physical properties of Earth's materials and others. The review concerns mainly the contents, the methods and the results of the studies. It can be seen that new progress in the study on the structure and physical properties of the Earth's interior has been made in the last 4 years in China. It is shown on three aspects: advancement made on some preexistent areas; pioneering on some new fields and new methods adopted.

  8. Atmosphere-interior exchange on hot rocky exoplanets

    CERN Document Server

    Kite, Edwin S; Schaefer, Laura; Gaidos, Eric

    2016-01-01

    We provide estimates of atmospheric pressure and surface composition on short-period rocky exoplanets with dayside magma pools and silicate vapor atmospheres. Atmospheric pressure tends toward vapor-pressure equilibrium with surface magma, and magma-surface composition is set by the competing effects of fractional vaporization and surface-interior exchange. We use basic models to show how surface-interior exchange is controlled by the planet's temperature, mass, and initial composition. We assume that mantle rock undergoes bulk melting to form the magma pool, and that winds flow radially away from the substellar point. With these assumptions, we find that: (1) atmosphere-interior exchange is fast when the planet's bulk-silicate FeO concentration is low, and slow when FeO concentration is high; (2) magma pools are compositionally well-mixed for substellar temperatures $\\lesssim$ 2400 K, but compositionally variegated and rapidly variable for substellar temperatures $\\gtrsim$ 2400 K; (3) currents within the mag...

  9. On ethics and the earthquake resistant interior design of buildings.

    Science.gov (United States)

    Hurol, Yonca

    2014-03-01

    The most common tectonic quality of modern structures, such as frame systems, is their flexibility; they are open for change. Although this characteristic is a big advantage in comparison to the inflexible masonry structures of the past, it might also create some serious problems, such as e.g. the lack of safety in the event of an earthquake, if the flexibility is not used consciously by architects and interior designers. This article attempts to define and establish some rules for the interior design of buildings with reinforced concrete frame systems. The rules for making subtractions from these structures and extending them by making additions to them are contained within this article. The main objective of this article is to derive some ethical values from these rules. Thus, the conclusion of the article focuses on the derivation of some ethical values for achieving earthquake resistant interior design of buildings with reinforced concrete frame systems.

  10. SYSTEMS OF INTERIOR STYLING AND TRAINING OF SPECIALISTS

    Directory of Open Access Journals (Sweden)

    samatdinov Marat Orynbaevich

    2016-09-01

    Full Text Available Increasing the quality of construction works and heat insulation efficiency of building envelope as well as providing additional fire proof and acoustic comfort suppose the use of special construction systems provided with the whole complex of components — composite construction systems. Composite interior systems include structural solutions of dividing walls, floors, suspended ceilings, inner facing of walls and fireproof facing, as well as assembling technology of these constructions. The main components of interior composite systems are gypsum board and gypsum-fiber sheets, gypsum-containing dry mortars. Less often gypsum partition blocks or panels based on Portland cement are used (cement fibrolite plates, aquapanels, etc.. The companies producing these materials are usually the movers of the creation of complex systems of interior facing. The systems are developed by leading Russian design organizations or engineering services of companies-the movers.

  11. Time Evolution of Entanglement Entropy from Black Hole Interiors

    CERN Document Server

    Hartman, Thomas

    2013-01-01

    We compute the time-dependent entanglement entropy of a CFT which starts in relatively simple initial states. The initial states are the thermofield double for thermal states, dual to eternal black holes, and a particular pure state, dual to a black hole formed by gravitational collapse. The entanglement entropy grows linearly in time. This linear growth is directly related to the growth of the black hole interior measured along "nice" spatial slices. These nice slices probe the spacelike direction in the interior, at a fixed special value of the interior time. In the case of a two-dimensional CFT, we match the bulk and boundary computations of the entanglement entropy. We briefly discuss the long time behavior of various correlators, computed via classical geodesics or surfaces, and point out that their exponential decay comes about for similar reasons. We also present the time evolution of the wavefunction in the tensor network description.

  12. Time evolution of entanglement entropy from black hole interiors

    Science.gov (United States)

    Hartman, Thomas; Maldacena, Juan

    2013-05-01

    We compute the time-dependent entanglement entropy of a CFT which starts in relatively simple initial states. The initial states are the thermofield double for thermal states, dual to eternal black holes, and a particular pure state, dual to a black hole formed by gravitational collapse. The entanglement entropy grows linearly in time. This linear growth is directly related to the growth of the black hole interior measured along "nice" spatial slices. These nice slices probe the spacelike direction in the interior, at a fixed special value of the interior time. In the case of a two-dimensional CFT, we match the bulk and boundary computations of the entanglement entropy. We briefly discuss the long time behavior of various correlators, computed via classical geodesics or surfaces, and point out that their exponential decay comes about for similar reasons. We also present the time evolution of the wavefunction in the tensor network description.

  13. Timing of gold mineralisation in the Ballarat goldfields, central Victoria: constraints from 40Ar/39Ar results

    International Nuclear Information System (INIS)

    40Ar/39Ar data for muscovite separates and hydrothermally altered whole-rock samples from the Ballarat West and the Ballarat East goldfields indicate that mesothermal gold mineralisation at Ballarat occurred during several episodic pulses, ranging in age from the Late Ordovician to the Early Devonian, initial formation of auriferous structures in the Ballarat goldfields coincided with folding and thrusting associated with the development of the western Lachlan Fold Belt between 460 and 440 Ma. Subsequent fault reactivation and magmatism resulted in remobilisation and additional mineralisation between 410 and 380 Ma, and around 370 Ma. The results presented herein are in agreement with findings for other major gold deposits in central Victoria and further constrain the history of deformation, metamorphism and mineralisation in the western subprovince of the Lachlan Fold Belt. Copyright (1999) Geological Society of Australia

  14. Emplacement of Amba Dongar Carbonatite-alkaline Complex at Cretaceous/Tertiary Boundary: Evidence from 40Ar-39Ar Chronology

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande; T R Venkatesan

    2000-03-01

    40Ar-39Ar analyses of three fresh alkaline rock samples and a phlogopite separate from a carbonatite from Amba Dongar carbonatite-alkaline complex of the Deccan Flood Basalt Province, India, yield indistinguishable precise plateau ages of 64.8 ± 0.6, 64.7 ± 0.5, 65.5 ± 0.8 and 65.3 ± 0.6 Ma, giving a mean plateau age of 65.0 ± 0.3 Ma, which is the age of emplacement of this complex. This age implies contemporaneity of Amba Dongar with several other carbonatite-alkaline activities of Chhota Udaipur subprovince and is consistent with their Reunion-Deccan plume origin hypothesis. The emplacement of these complexes at 65 Ma makes them very significant in the ongoing debate on the K/T extinctions owing to their capacity to rapidly inject a substantial amount of CO2 and SO2 into the atmosphere.

  15. 40Ar/39Ar Dating of Zn-Pb-Ag Mineralization in the Northern Brooks Range, Alaska

    Science.gov (United States)

    Werdon, Melanie B.; Layer, Paul W.; Newberry, Rainer J.

    2004-01-01

    The 40Ar/39Ar laser step-heating method potentially can be used to provide absolute ages for a number of formerly undatable, low-temperature ore deposits. This study demonstrates the use of this method by determining absolute ages for Zn-Pb-Ag sediment-hosted massive sulfide deposits and vein-breccia occurrences found throughout a 300-km-long, east-west-trending belt in the northern Brooks Range, Alaska. Massive sulfide deposits are hosted by Mississippian to Pennsylvanian(?) black carbonaceous shale, siliceous mudstone, and lesser chert and carbonate turbidites of the Kuna Formation (e.g., Red Dog, Anarraaq, Lik (Su), and Drenchwater). The vein-breccia occurrences (e.g., Husky, Story Creek, West Kivliktort Mountain, Vidlee, and Kady) are hosted by a deformed but only weakly metamorphosed package of Upper Devonian to Lower Mississippian mixed continental and marine clastic rocks (the Endicott Group) that stratigraphically underlie the Kuna Formation. The vein-breccias are mineralogically similar to, but not spatially associated with, known massive sulfide deposits. The region's largest shale-hosted massive sulfide deposit is Red Dog; it has reserves of 148 Mt grading 16.6 percent zinc, 4.5 percent lead, and 77 g of silver per tonne. Hydrothermally produced white mica in a whole-rock sample from a sulfide-bearing igneous sill within the Red Dog deposit yielded a plateau age of 314.5 Ma. The plateau age of this whole-rock sample records the time at which temperatures cooled below the argon closure temperature of the white mica and is interpreted to represent the minimum age limit for massive sulfide-related hydrothermal activity in the Red Dog deposit. Sulfide-bearing quartz veins at Drenchwater crosscut a hypabyssal intrusion with a maximum biotite age of 337.0 Ma. Despite relatively low sulfide deposition temperatures in the vein-breccia occurrences (162°-251°C), detrital white mica in sandstone immediately adjacent to large vein-breccia zones was partially to

  16. Charge-exchange, ionization and excitation in low-energy Li$^{+}-$ Ar, K$^{+}-$ Ar, and Na$^{+}-$He collisions

    CERN Document Server

    Lomsadze, Ramaz A; Kezerashvili, RomanYa; Schulz, Michael

    2016-01-01

    Absolute cross sections are measured for charge-exchange, ionization, and excitation within the same experimental setup for the Li$^{+}-$Ar, K$^{+}-$ Ar, and Na$^{+}-$ He collisions in the ion energy range $0.5-10$ keV. Results of our measurements along with existing experimental data and the schematic correlation diagrams are used to analyze and determine the mechanisms for these processes. The experimental results show that the charge-exchange processes are realized with high probabilities and electrons are predominately captured in ground states. The cross section ratio for charge exchange, ionization and excitation processes roughly attains the value $10:2:1$, respectively. The contributions of various partial inelastic channels to the total ionization cross sections are estimated and a primary mechanism for the process is defined. The energy-loss spectrum, in addition, is applied to estimate the relative contribution of different inelastic channels and to determine the mechanisms for the ionization and f...

  17. A feature refinement approach for statistical interior CT reconstruction

    Science.gov (United States)

    Hu, Zhanli; Zhang, Yunwan; Liu, Jianbo; Ma, Jianhua; Zheng, Hairong; Liang, Dong

    2016-07-01

    Interior tomography is clinically desired to reduce the radiation dose rendered to patients. In this work, a new statistical interior tomography approach for computed tomography is proposed. The developed design focuses on taking into account the statistical nature of local projection data and recovering fine structures which are lost in the conventional total-variation (TV)—minimization reconstruction. The proposed method falls within the compressed sensing framework of TV minimization, which only assumes that the interior ROI is piecewise constant or polynomial and does not need any additional prior knowledge. To integrate the statistical distribution property of projection data, the objective function is built under the criteria of penalized weighed least-square (PWLS-TV). In the implementation of the proposed method, the interior projection extrapolation based FBP reconstruction is first used as the initial guess to mitigate truncation artifacts and also provide an extended field-of-view. Moreover, an interior feature refinement step, as an important processing operation is performed after each iteration of PWLS-TV to recover the desired structure information which is lost during the TV minimization. Here, a feature descriptor is specifically designed and employed to distinguish structure from noise and noise-like artifacts. A modified steepest descent algorithm is adopted to minimize the associated objective function. The proposed method is applied to both digital phantom and in vivo Micro-CT datasets, and compared to FBP, ART-TV and PWLS-TV. The reconstruction results demonstrate that the proposed method performs better than other conventional methods in suppressing noise, reducing truncated and streak artifacts, and preserving features. The proposed approach demonstrates its potential usefulness for feature preservation of interior tomography under truncated projection measurements.

  18. A feature refinement approach for statistical interior CT reconstruction.

    Science.gov (United States)

    Hu, Zhanli; Zhang, Yunwan; Liu, Jianbo; Ma, Jianhua; Zheng, Hairong; Liang, Dong

    2016-07-21

    Interior tomography is clinically desired to reduce the radiation dose rendered to patients. In this work, a new statistical interior tomography approach for computed tomography is proposed. The developed design focuses on taking into account the statistical nature of local projection data and recovering fine structures which are lost in the conventional total-variation (TV)-minimization reconstruction. The proposed method falls within the compressed sensing framework of TV minimization, which only assumes that the interior ROI is piecewise constant or polynomial and does not need any additional prior knowledge. To integrate the statistical distribution property of projection data, the objective function is built under the criteria of penalized weighed least-square (PWLS-TV). In the implementation of the proposed method, the interior projection extrapolation based FBP reconstruction is first used as the initial guess to mitigate truncation artifacts and also provide an extended field-of-view. Moreover, an interior feature refinement step, as an important processing operation is performed after each iteration of PWLS-TV to recover the desired structure information which is lost during the TV minimization. Here, a feature descriptor is specifically designed and employed to distinguish structure from noise and noise-like artifacts. A modified steepest descent algorithm is adopted to minimize the associated objective function. The proposed method is applied to both digital phantom and in vivo Micro-CT datasets, and compared to FBP, ART-TV and PWLS-TV. The reconstruction results demonstrate that the proposed method performs better than other conventional methods in suppressing noise, reducing truncated and streak artifacts, and preserving features. The proposed approach demonstrates its potential usefulness for feature preservation of interior tomography under truncated projection measurements. PMID:27362527

  19. Análise da qualidade do ar interior sob a abordagem da manutenção preditiva e da inovação

    Directory of Open Access Journals (Sweden)

    André Marques Cavalcanti

    2015-01-01

    Full Text Available The quality of indoor air has a direct influence on the welfare of persons occupying or moving through these spaces. The use of indoor climate control systems arises from the need to provide comfortable conditions for the occupants, as well as providing systems that protect them from impurities in the air. In some environments with climate control, occupants can develop diseases, such as fatigue, infections, irritation of the eyes and mucous membranes, nausea, dizziness, etc. According to the WHO, these symptoms are characteristic of “Sick Building Syndrome”. This article, through a descriptive and exploratory methodology, deals with the assessment of the quality of indoor air, pointing to predictive maintenance and its innovative aspects as factors that minimize the causative agents of diseases that may arise in these environments. For this, we analyzed ten clients of a company specializing in climate-control systems. The results revealed noncompliance in some aspects that were analyzed, enabling the preparation of an action plan for compliance with all legal standards.

  20. Empirical Likelihood Inference for AR(p) Model%AR(p)模型的经验似然推断

    Institute of Scientific and Technical Information of China (English)

    陈燕红; 赵世舜; 宋立新

    2008-01-01

    In this article we study the empirical likelihood inference for AR(p) model.We propose the moment restrictions, by which we get the empirical likelihood estimator of the model parametric, and we also propose an empirical log-likelihood ratio base on this estimator.Our result shows that the EL estimator is asymptotically normal, and the empirical log-likelihood ratio is proved to be asymptotically standard chi-squared.

  1. Geochemical and 40Ar/39Ar constraints on the evolution of volcanism in the Woodlark Rift, Papua New Guinea

    Science.gov (United States)

    Catalano, Joseph P.

    The tectonic mechanisms producing Pliocene to active volcanism in eastern Papua New Guinea (PNG) have been debated for decades. In order to assess mechanisms that produce volcanism in the Woodlark Rift, we evaluate the evolution of volcanism in eastern PNG using 40Ar/39Ar thermochronology and whole rock geochemistry. Active volcanism in southeastern Papua New Guinea occurs on the Papuan Peninsula (Mt. Lamington, Mt. Victory and Waiwa), in the Woodlark Rift (Dobu Island, SE Goodenough Island, and Western Fergusson Island), and in the Woodlark Basin. In the Woodlark Basin, seafloor spreading is active and decompression melting of the upper mantle is producing basaltic magmatism. However, the cause of Pliocene and younger volcanism in the Woodlark Rift is controversial. Two hypotheses for the tectonic setting have been proposed to explain Pliocene and younger volcanism in the Woodlark Rift: (1) southward subduction of Solomon Sea lithosphere beneath eastern PNG at the Trobriand Tough and (2) decompression melting of mantle, previously modified by subduction, as the lithosphere undergoes extension associated with the opening of the Woodlark Basin. A comparison of 40Ar/39Ar ages with high field strength element (HFSE) concentrations in primary magmas indicates that HFSE concentrations correlate with age in the Woodlark rift. These data support the hypothesis that Pliocene to active volcanism in the Woodlark Rise and D'Entrecasteaux Islands results from decompression melting of a relict mantle wedge. The subduction zone geochemical signatures (negative HFSE anomalies) in Woodlark Rift lavas younger than 4 m.y. are a relict from older subduction beneath eastern Papua, likely in the middle Miocene. As the lithosphere is extended ahead of the tip of the westward propagating seafloor spreading center in the Woodlark Basin, the composition of volcanism is inherited from prior arc magmatism (via flux melting) and through time evolves toward magmatism associated with a rifting

  2. Paleozoic accretionary orogenesis in the eastern Beishan orogen: constraints from zircon U-Pb and 40Ar/39Ar geochronology

    Science.gov (United States)

    Ao, Songjian; Xiao, Wenjiao; Windley, Brian; Mao, Qigui

    2016-04-01

    The continental growth mechanism of the Altaids in Central Asia is still in controversy between models of continuous subduction-accretion versus punctuated accretion by closure of multiple oceanic basins. The Beishan orogenic belt, located in the southern Altaids, is a natural laboratory to address this controversy. Key questions that are heavily debated are: the closure time and subduction polarity of former oceans, the emplacement time of ophiolites, and the styles of accretion and collision. This paper reports new structural data, zircon ages and Ar-Ar dates from the eastern Beishan Orogen that provide information on the accretion process and tectonic affiliation of various terranes. Our geochronological and structural results show that the younging direction of accretion was northwards and the subduction zone dipped southwards under the northern margin of the Shuangyingshan micro-continent. This long-lived and continuous accretion process formed the Hanshan accretionary prism. Our field investigations show that the emplacement of the Xiaohuangshan ophiolite was controlled by oceanic crust subduction beneath the forearc accretionary prism of the Shuangyingshan-Mazongshan composite arc to the south. Moreover, we address the age and terrane affiliation of lithologies in the eastern Beishan orogen through detrital zircon geochronology of meta-sedimentary rocks. We provide new information on the ages, subduction polarities, and affiliation of constituent structural units, as well as a new model of tectonic evolution of the eastern Beishan orogen. The accretionary processes and crustal growth of Central Asia were the result of multiple sequences of accretion and collision of manifold terranes. Reference: Ao, S.J., Xiao, W., Windley, B.F., Mao, Q., Han, C., Zhang, J.e., Yang, L., Geng, J., Paleozoic accretionary orogenesis in the eastern Beishan orogen: Constraints from zircon U-Pb and 40Ar/39Ar geochronology. Gondwana Research, doi: http://dx.doi.org/10.1016/j

  3. Mineralogy and Ar-Ar Age of the Tarahumara IIE Iron, with Reference to the Origin of Alkali-Rich Materials

    Science.gov (United States)

    Takeda, Hiroshi; Bogard, Donald D.; Otsuki, Mayumi; Ishii, Teruaki

    2003-01-01

    Silicate inclusions in nine known IIE irons show diversity in mineralogy, and Colomera, Kodaikanal, Elga and Miles contain alkali-rich silicate inclusions. Bogard et al. showed evidence of a complex parent body evolution for IIE irons based on Ar-39-Ar-40 ages. Colomera contained a sanidine-rich surface inclusion and the K-enrichment trends in the Na-rich inclusions are different from those of other IIEs. To elucidate the origin of K-rich materials, we studied the mineralogy and Ar-Ar age of silicate inclusions from the Tarahumara IIE iron meteorite.

  4. 40Ar/39Ar dating of Quaternary volcanic ashes by multi-collection noble gas mass spectrometry: protocols, precision and intercalibration

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie;

    for single crystal 40Ar/39Ar dating of Quaternary samples because of: (i) improved source sensitivity; (ii) ion-counting electron multipliers, which have low signal to noise ratios enabling precise measurement of very small 36Ar signals - resulting in accurate correction for atmospheric-derived 40Ar; (iii......) higher mass resolution allows hydrocarbon interferences to be pseudo resolved for the different argon isotopes; and (iv) multi-collection, allowing more data to be gathered in a fixed time in comparison with single-collector peak-switching measurements. We evaluate (i) protocols for detector inter...

  5. The effect of interior aircraft noise on pilot performance.

    Science.gov (United States)

    Lindvall, Johan; Västfjall, Daniel

    2013-04-01

    This study examined the effect of the interior sounds of an aircraft cockpit on ratings of affect and expected performance decrement. While exposed to 12 interior aircraft sounds, of which half were modified to correspond to what is experienced with an active noise reduction (ANR) headset, 23 participants rated their affective reactions and how they believed their performance on various tasks would be affected. The results suggest that implementation of ANR-technique has a positive effect on ratings of expected performance. In addition, affective reactions to the noise are related to ratings of expected performance. The implications of these findings for both research and pilot performance are discussed. PMID:24032324

  6. Conference on Boundary and Interior Layers : Computational and Asymptotic Methods

    CERN Document Server

    2015-01-01

    This volume offers contributions reflecting a selection of the lectures presented at the international conference BAIL 2014, which was held from 15th to 19th September 2014 at the Charles University in Prague, Czech Republic. These are devoted to the theoretical and/or numerical analysis of problems involving boundary and interior layers and methods for solving these problems numerically. The authors are both mathematicians (pure and applied) and engineers, and bring together a large number of interesting ideas. The wide variety of topics treated in the contributions provides an excellent overview of current research into the theory and numerical solution of problems involving boundary and interior layers.  .

  7. A Comparison of the Interiors of Jupiter and Saturn

    CERN Document Server

    Guillot, T

    1999-01-01

    Interior models of Jupiter and Saturn are calculated and compared in the framework of the three-layer assumption, which rely on the perception that both planets consist of three globally homogeneous regions: a dense core, a metallic hydrogen envelope, and a molecular hydrogen envelope. Within this framework, constraints on the core mass and abundance of heavy elements (i.e. elements other than hydrogen and helium) are given by accounting for uncertainties on the measured gravitational moments, surface temperature, surface helium abundance, and on the inferred protosolar helium abundance, equations of state, temperature profile and solid/differential interior rotation.

  8. Extreme Water: Characterizing Exoplanets with Excess Bulk Water Interiors

    Science.gov (United States)

    Sasselov, Dimitar

    2015-12-01

    A number of planets with radii of 1 - 2.5 Earth radius have measured mean densities that allow more than 20% of their bulk interior to be composed of water. How do planets with solid-state water mantles modulate the fluxes of gases reaching the surface? What should we expect about the composition of their evolved atmospheres? I review theoretical models of the interiors and near-surface layers that constrain the fluxes of major gases (in and out) and resulting atmospheric compositions. The results have implications for observational characterization of rocky versus water planets, when the density alone is not enough, as well as the search for biosignatures and habitability.

  9. Evaluation of physical protection elements for interior applications

    International Nuclear Information System (INIS)

    Considerable emphasis has been given in recent years to the threat of sabotage or theft by an insider at nuclear facilities, a threat inherently different from that by outsiders. Special safeguards compatible with facility operations, safety, and maintenance programs are needed to counter the insider's unique knowledge and access to vital material and equipment. To help identify elements that meet these needs, field evaluations were performed on an interior access control system, piping sensors, interior video motion detectors, and valve monitoring devices. Both technical and operational evaluation data were obtained from tests in a realistic operating environment. Safeguards elements and operational test results and evaluations are described

  10. Sistema de guía por voz en interiores

    OpenAIRE

    Martín-Calderín de la Villa, Mariana

    2013-01-01

    En los últimos años se ha producido un incremento del interés académico e industrial en los sistemas de localización para personas y objetos. Este crecimiento queda reflejado en la creación de aplicaciones comerciales, donde se ha recogido un aumento de la demanda en los sistemas de posicionamiento en interiores para las personas. En particular, dichos sistemas de localización en interiores, están teniendo una repercusión muy importante en fábricas, hospitales, grandes almacenes, entornos muy...

  11. Seismic Study of Magnetic Field in the Solar Interior

    Indian Academy of Sciences (India)

    H. M. Antia

    2008-03-01

    Magnetic field in the solar interior contributes to the even order splitting coefficients, but it is not possible to separate the effect of magnetic field from those due to other deviations from spherical symmetry. Results obtained using GONG and MDI data are discussed. Limits on possible magnetic field in the solar core and in the tachocline region are obtained. There is some signal from possible magnetic field in the convection zone, but evidence of possible temporal variation in the solar interior is only marginal.

  12. Effects of Ar or O2 Gas Bubbling for Shape, Size, and Composition Changes in Silver-Gold Alloy Nanoparticles Prepared from Galvanic Replacement Reaction

    Directory of Open Access Journals (Sweden)

    Md. Jahangir Alam

    2013-01-01

    Full Text Available The galvanic replacement reaction between silver nanostructures and AuCl4- solution has recently been demonstrated as a versatile method for generating metal nanostructures with hollow interiors. Here we describe the results of a systematic study detailing the morphological, structural, compositional, and spectral changes involved in such a heterogeneous reaction on the nanoscale. Effects of Ar or O2 gas bubbling for the formation of Ag-Au alloy nanoparticles by the galvanic replacement between spherical Ag nanoparticles and AuCl4- especially were studied in ethylene glycol (EG at 150°C. The shape, size, and composition changes occur rapidly under O2 bubbling in comparison with those under Ar bubbling. The major product after 60 min heating under Ar gas bubbling was perforated Ag-Au alloy particles formed by the replacement reaction and the minor product was ribbon-type particles produced from splitting off some perforated particles. On the other hand, the major product after 60 min heating under O2 gas bubbling was ribbon-type particles. In addition, small spherical Ag particles are produced. They are formed through rereduction of Ag+ ions released from the replacement reaction and oxidative etching of Ag nanoparticles by O2/Cl− in EG.

  13. Audit, Control and Monitoring Design Patterns (ACMDP for Autonomous Robust Systems (ARS

    Directory of Open Access Journals (Sweden)

    C. Trad

    2008-11-01

    Full Text Available This paper proposes the Audit, Control and Monitoring Design Patterns (ACMDP for building Autonomous and Robust Systems (ARS such as Mobile Robot Systems (MRS. These patterns are also applicable to other Mission Critical and Complex Systems (MCCS. This paper presents a proposal which will help ARS project managers and engineers design, build and estimate the probability that an ARS will succeed or fail. Furthermore, this proposal offers the possibility to ARS problems with the help of audit, monitoring and controlling components, adjust the project management pathways, and define the problem sources as well as their possible solutions, in order to deliver an ARS or an MRS.

  14. High-Energy Ions Emitted from Ar Clusters Irradiated by Intense Femtosecond Laser Pulses

    Institute of Scientific and Technical Information of China (English)

    LI Zhong; LEI An-Le; NI Guo-Quan; XU Zhi-Zhan

    2000-01-01

    We have experimentally studied the energy spectra of Ar ions emitted from Ar clusters irradiated by intense femtosecond laser pulses. The Ar clusters were produced in the adiabatic expansion of Ar gas into vacuum at high backing pressures. The laser peak intensity was about 2×106 W/cm2 with a pulse duration of 45 fs. The maximum and the average energies of Ar ions are 0.2 MeV and 15kev at a backing pressure of 2. S MPa, respectively. They are almost independent of the backing pressures in the range of 0.6 to 4.5 MPa.

  15. Measure Guideline: Summary of Interior Ducts in New Construction, Including an Efficient, Affordable Method to Install Fur-Down Interior Ducts

    Energy Technology Data Exchange (ETDEWEB)

    Beal, D. [BA-PIRC, Cocoa, FL (United States); McIlvaine, J. [BA-PIRC, Cocoa, FL (United States); Fonorow, K. [BA-PIRC, Cocoa, FL (United States); Martin, E. [BA-PIRC, Cocoa, FL (United States)

    2011-11-01

    This document illustrates guidelines for the efficient installation of interior duct systems in new housing, including the fur-up chase method, the fur-down chase method, and interior ducts positioned in sealed attics or sealed crawl spaces.

  16. Isolated neutron stars and studies of their interiors

    CERN Document Server

    Popov, S B

    2011-01-01

    In these lectures presented at Baikal summer school on physics of elementary particles and astrophysics 2011, I present a wide view of neutron star astrophysics with special attention paid to young isolated compact objects and studies of the properties of neutron star interiors using astronomical methods.

  17. THE INTERIOR LAYER SOLUTION TO NONLOCAL REACTION DIFFUSION EQUATIONS

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    An initial boundary value problem of semilinear nonlocal reaction diffusion equations is considered.Under some suitable conditions,using the asymptotic theory,the existence and asymptotic behavior of the interior layer solution to the initial boundary value problem are studied.

  18. Penerapan Tipografi dalam Sistem Signage pada Interior Ruang Publik

    OpenAIRE

    Ulli Aulia Ruki; Amarena Nediari

    2014-01-01

    Sistem signage diaplikasikan pada sebuah interior ruang publik dengan memerhatikan dasar tipografi. Manfaat signage adalah memberikan kemudahan para pengguna ruang publik dalam mencapai tujuan saat mereka berada di dalam sebuah bangunan. Hal mendasar yang perlu diperhatikan dalam merencanakan sistem signage adalah kejelasan bentuk huruf serta kemudahan untuk dibaca. Masih banyak desainer yang kurang memerhatikan desain signage, sehingga terkadang desainnya memberikan kesan hanya s...

  19. Research on the Interior Sound Quality in Hybrid Electric Vehicle

    Directory of Open Access Journals (Sweden)

    Liao Lian Ying

    2016-01-01

    Full Text Available Even the overall level of vehicle interior noise of hybrid electric vehicle (HEV reduced to a certain degree, the vibration and noise generated by the engine, motor, generator and power split have made greater effect on the vehicle interior sound quality in HEV. In order to research the feature of vehicle interior sound quality in HEV, the HEV is used to be the research object, the binaural noise sample of the driver when playing different kinds of music in the vehicle with the speed of sixty kilometers per hour is collected. ArtemiS is used to conduct frequency division processing, so as to obtain the relative weight of each frequency band and the overall noise. The tone, roughness and sharpness of sound quality subjective evaluation parameters are quantified, the SPSS is used to establish the linear regression model of the sample, and the best masking music tracks are found out. Then, the sound samples that contains the best music tracks and the simple vehicle interior noise are re-collected, the regression model and ArtemiS are used to predict the subjective evaluation value. The research results show that when adding the music, the tone degree rises and the lowering degree decreases, thus the disturbing degree reduces, which significantly improves the sound quality in the HEV.

  20. Hygrothermal Performance Study of an Innovative Interior Thermal Insulation System

    OpenAIRE

    Pavlík, Zbyšek; Černý, Robert

    2010-01-01

    Hygrothermal Performance Study of an Innovative Interior Thermal Insulation System correspondance: Corresponding author. Tel.: +420 2 2435 4429; fax: +420 2 2435 4446. (Cerny, Robert) (Cerny, Robert) Czech Technical University in Prague--> , Faculty of Civil Engineering--> , Department of Materials Engineering and Chemistry--> , Thakurova 7--> , 166 29 Prague 6--> - CZECH REPUBLIC...

  1. Infrared imaging of fossil fuel power plant boiler interiors

    Science.gov (United States)

    Howard, James W.; Cranton, Brian W.; Armstrong, Karen L.; Hammaker, Robert G.

    1997-08-01

    Fossil fuel power plant boilers operate continuously for months at a time, typically shutting down only for routine maintenance or to address serious equipment failures. These shutdowns are very costly, and diagnostic tools and techniques which could be used to minimize shutdown duration and frequency are highly desirable. Due to the extremely hostile environment in these boilers, few tools exist to inspect and monitor operating boiler interiors. This paper presents the design of a passively cooled, infrared borescope used to inspect the interior of operating boilers. The borescope operates at 3.9 micrometer, where flame is partially transparent. The primary obstacles overcome in the instrument design were the harsh industrial environment surrounding the boilers and the high temperatures encountered inside the boilers. A portable yet durable lens system and enclosure was developed to work with a scanning radiometer to address these two problems by both shielding the radiometer from the environment and by extending the optical train into a snout designed to be inserted into access ports on the sides of the boiler. In this manner, interior images of the boiler can be made while keeping the radiometer safely outside the boiler. The lens views a 40 degree field of view through any 2.5' or larger opening in a foot thick boiler wall. Three of these borescopes have been built, and high resolution images of boiler interiors have been obtained.

  2. Some Geometric Inequalities Relating to an Interior Point in Triangle

    Science.gov (United States)

    Wu, Yu-Dong; Zhang, Zhi-Hua; Liang, Chun-Lei

    2010-01-01

    In this short note, by using one of Li and Liu's theorems [K.-H. Li, "The solution of CIQ. 39," "Commun. Stud. Inequal." 11(1) (2004), p. 162 (in Chinese)], "s-R-r" method, Cauchy's inequality and the theory of convex function, we solve some geometric inequalities conjectures relating to an interior point in triangle. (Contains 1 figure.)

  3. Generators with interior degeneracy on spaces of L^2 type

    Directory of Open Access Journals (Sweden)

    Genni Fragnelli

    2012-10-01

    Full Text Available We consider operators in divergence and in nondivergence form with degeneracy at the interior of the space domain. Characterizing the domain of the operators, we prove that they generate positive analytic semigroups on spaces of L^2 type. Finally, some applications to linear and semilinear parabolic evolution problems and to linear hyperbolic ones are presented.

  4. Isolated neutron stars and studies of their interiors

    Science.gov (United States)

    Popov, S. B.

    2012-12-01

    In these lectures presented at Baikal summer school on physics of elementary particles and astrophysics 2011, I present a wide view of neutron star astrophysics with special attention paid to young isolated compact objects and studies of the properties of their interiors using astronomical methods.

  5. Beacons - serveis de proximitat: sistema de posicionament a interiors

    OpenAIRE

    Ariñez Soriano, Daniel

    2015-01-01

    El projecte tracta sobre el posicionament en interiors utilitzant una combinació de les tecnologies WiFi i Bluetooth Low Energy combinades amb l'algorisme de fingerprint i Support Vector Machines. Project is about indoor positioning system using a combination of technologies WiFi and Bluetooth Low Energy combinates with fingerprint algorithm and Support Vector Machines.

  6. NASTRAN application for the prediction of aircraft interior noise

    Science.gov (United States)

    Marulo, Francesco; Beyer, Todd B.

    1987-08-01

    The application of a structural-acoustic analogy within the NASTRAN finite element program for the prediction of aircraft interior noise is presented. Some refinements of the method, which reduce the amount of computation required for large, complex structures, are discussed. Also, further improvements are proposed and preliminary comparisons with structural and acoustic modal data obtained for a large, composite cylinder are presented.

  7. HF Doppler Acoustic Imaging of the Ocean Surface and Interior

    Science.gov (United States)

    Pinkel, Robert; Smith, Jerome A.

    2004-11-01

    HF phased array Doppler sonar represents a new tool for obtaining Three-dimensional (r,q,t) images of the oceanic surface and interior velocity field. While the capabilities of the approach are unique, the design constraints are also unusual. Examples of both are presented in this work.

  8. The Attitudes of Interior Design Students towards Sustainability

    Science.gov (United States)

    Ruff, Caimen Leigh; Olson, Margot A.

    2009-01-01

    To measure attitudes toward environmental issues, interior design students responded to a four-part survey: demographics, ecology, sustainability, and comments. The ecology section was composed of modifications of questions from the New Ecological Paradigm Scale (Dunlap et al. "Journal of Environmental Education," 9:10-19, 2000). The researchers…

  9. Improving FCS Accountability: Increasing STEM Awareness with Interior Design Modules

    Science.gov (United States)

    Etheredge, Jessica; Moody, Dana; Cooper, Ashley

    2014-01-01

    This paper demonstrates ways in which family and consumer sciences (FCS) educators can explore more opportunities to integrate Science, Technology, Engineering, and Math (STEM) principles into secondary education curriculum. Interior design is used as a case study for creating learning modules that incorporate STEM principles in a creative and…

  10. Emergency evacuation : how better interior design can improve passenger flow

    NARCIS (Netherlands)

    Boer, L.C.; Skjong, R.

    2001-01-01

    The paper presents some conclusions from the EU basic research project "MEPdesign" relevant for design of ship interiors. The findings are discussed with regard to passenger flow as a function of design parameters. The paper explains that current evacuation analyses may be overly optimistic. The con

  11. Possibilities to improve the aircraft interior comfort experience

    NARCIS (Netherlands)

    Vink, P.; Bazley, C.; Kamp, I.; Blok, M.

    2012-01-01

    Comfort plays an increasingly important role in the interior design of airplanes. Although ample research has been conducted on airplane design technology, only a small amount of public scientific information is available addressing the passenger's opinion. In this study, more than 10,000 internet t

  12. U-CrAc Flexible Interior Doctrine, Agile Learning Environments

    DEFF Research Database (Denmark)

    Poulsen, Søren Bolvig; Rosenstand, Claus Andreas Foss

    2012-01-01

    The research domain of this article is flexible learning environment for immediate use. The research question is: How can the learning environment support an agile learning process? The research contribution of this article is a flexible interior doctrine. The research method is action research...

  13. Group Dynamics in the Interior Design Studio: Student Perceptions

    Science.gov (United States)

    Hill, Caroline

    2008-01-01

    This article presents the findings of a study measuring the classroom climates in collegiate interior design studios and considers these findings within the group dynamics theory framework. Three groups of students completed the College Classroom Environment Scales (CCES) questionnaire. Five of the six CCES subscale F ratios were statistically…

  14. Group Projects in Interior Design Studio Classes: Peer Feedback Benefits

    Science.gov (United States)

    Jurado, Juan A.

    2011-01-01

    Group projects have been shown to be effective for providing peer feedback in classrooms. While students in regular enrollment classes benefit from peer feedback, low-enrollment classes face many challenges. This study compares peer feedback effectiveness between two interior design studio classes with different design projects. In one class,…

  15. Service-Learning and Interior Design: A Case Study

    Science.gov (United States)

    Sterling, Mary

    2007-01-01

    The case study approach was used to analyze experiential learning through its three components: knowledge, action, and reflection. Two interior design courses were integrated through a university service-learning project. The restoration/adaptive reuse of a 95-year-old library building was to serve as a prototype for future off-campus…

  16. Computer-assisted ergonomic analysis for vehicle interior design

    NARCIS (Netherlands)

    Punte, P.A.J.; Oudenhuijzen, A.J.K.

    2000-01-01

    TNO Human Factors is involved in the process of designing and testing a new concept for driver workplaces in passenger cars, i.e. with a horizontally fixed driver seat and adjustable pedals, steering wheel and instrument panel. This new concept is intended to achieve an interior space and arrangemen

  17. The Integration of Interior Architecture Education with Digital Design Approaches

    Science.gov (United States)

    Yazicioglu, Deniz Ayse

    2011-01-01

    It is inevitable that as a result of progress in technology and the changes in the ways with which design is conceived, interior architecture schools should be updated according to these requirements and that new educational processes should be tried out. It is for this reason that the scope and aim of this study have been determined as being the…

  18. Exact solution for the interior of a black hole

    NARCIS (Netherlands)

    T.M. Nieuwenhuizen

    2008-01-01

    Within the Relativistic Theory of Gravitation it is shown that the equation of state p = rho holds near the center of a black hole. For the stiff equation of state p = rho - rho(c) the interior metric is solved exactly. It is matched with the Schwarzschild metric, which is deformed in a narrow range

  19. Protein kinase D1 (PKD1) influences androgen receptor (AR) function in prostate cancer cells

    International Nuclear Information System (INIS)

    Protein kinase D1 (PKD1), founding member of PKD protein family, is down-regulated in advanced prostate cancer (PCa). We demonstrate that PKD1 and androgen receptor (AR) are present as a protein complex in PCa cells. PKD1 is associated with a transcriptional complex which contains AR and promoter sequence of the Prostate Specific Antigen (PSA) gene. Ectopic expression of wild type PKD1 and the kinase dead mutant PKD1 (K628W) attenuated the ligand-dependent transcriptional activation of AR in prostate cancer cells and yeast cells indicating that PKD1 can affect AR transcription activity, whereas knocking down PKD1 enhanced the ligand-dependent transcriptional activation of AR. Co-expression of kinase dead mutant with AR significantly inhibited androgen-mediated cell proliferation in both LNCaP and DU145 PC cells. Our data demonstrate for the first time that PKD1 can influence AR function in PCa cells

  20. Rotational Spectrum of Ar...PROPARGYL Alcohol Complex

    Science.gov (United States)

    Mani, Devendra; Shahi, Abhishek; Arunan, E.

    2012-06-01

    Pure rotational spectrum for Ar...Propargyl alcohol complex has been observed and fitted. Fitted rotational constants for the complex are : A=4346.17307(90) MHz, B=1617.15317(19)MHz and C= 1245.42065(15) MHz. These rotational constants are very close to the ab-initio rotational constants for the geometry, in which propargyl alcohol exists in gauche conformation and Ar interacts with both, the hydroxyl group and the acetylenic group of propargyl alcohol. Rotational spectrum of deuterated isotopologue (-OD) of the complex further confirms the existence of the above mentioned geometry. In previous studies tunneling frequency corresponding to -OH tunneling motion in propargyl alocohol monomer was determined to be 652.4 GHz and for -OD tunneling motion in mono-deuterated species, it was 213.5 GHz. In Ar...Propargyl alcohol complex also, a-type and c-dipole transitions show tunneling splitting. In the parent complex, for a-type transitions, tunneling splitting was 10 KHz and for c-type transitions (c-dipole of the complex is in the same direction as in propargyl alcohol monomer, and it is antisymmetric with respect to OH tunneling motion in both monomer and the complex), it was 2.59 MHz. In deuterated complex (OD) splitting was not resolvable for a-type transitions while for c-type it reduces to 900 KHz. Search for C-13 isotopologues is in progress. Moreover, propargyl alcohol offers several possibilities for H-bonding and we are planning to study its complexes with water in near future. Results will be presented in the talk. E. Hirota,J. Mol. Spectrosc. 26 (1968) 335-350. J.C. Pearson, B.J. Drouin, J. Mol. Spectrosc. 234 (2005) 149-156.

  1. Flares and magnetic non-potentiality of NOAA AR 11158

    International Nuclear Information System (INIS)

    Magnetic non-potentiality is important for understanding flares and other solar activities in active regions (ARs). Five non-potential parameters, i.e. electric current, current helicity, source field, photospheric free energy, and angular shear, are calculated to quantify the non-potentiality of NOAA AR 11158. Benefitting from the high spatial resolution, high cadence and continuous temporal coverage of vector magnetograms from the Helioseismic and Magnetic Imager onboard the Solar Dynamics Observatory, both the long-term evolution of the AR and the rapid change during flares are studied. We confirm that, compared with the magnetic flux, the magnetic non-potentiality has a closer connection with the flare, and the emerging flux regions are important for understanding the magnetic non-potentiality and flares. The main results are as follows. (1) The vortex in the source field directly displays the deflection of the horizontal magnetic field. The deflection corresponds to the fast rotating sunspot with a time delay, which suggests that the sunspot rotation leads to an increase in the non-potentiality. (2) Two areas that have evident changes in the azimuth of the vector magnetic field are found near the magnetic polarity inversion line. The change rates of the azimuth are about 1.3° h−1 and 3.6° h−1, respectively. (3) Rapid and prominent increases are found in the variation of helicity during four flares in the regions where their initial brightening occurs. The recovery of the increases takes 3–4 h for the two biggest flares (X2.2 and M6.6), but only takes about 2 h for the two other smaller flares (M2.2 and M1.6).

  2. Flares and magnetic non-potentiality of NOAA AR 11158

    Institute of Scientific and Technical Information of China (English)

    Qiao Song; Jun Zhang; Shu-Hong Yang; Yang Liu

    2013-01-01

    Magnetic non-potentiality is important for understanding flares and other solar activities in active regions (ARs).Five non-potential parameters,i.e.electric current,current helicity,source field,photospheric free energy,and angular shear,are calculated to quantify the non-potentiality of NOAA AR 11158.Benefitting from the high spatial resolution,high cadence and continuous temporal coverage of vector magnetograms from the Helioseismic and Magnetic Imager onboard the Solar Dynamics Observatory,both the long-term evolution of the AR and the rapid change during flares are studied.We confirm that,compared with the magnetic flux,the magnetic non-potentiality has a closer connection with the flare,and the emerging flux regions are important for understanding the magnetic non-potentiality and flares.The main results are as follows.(1) The vortex in the source field directly displays the deflection of the horizontal magnetic field.The deflection corresponds to the fast rotating sunspot with a time delay,which suggests that the sunspot rotation leads to an increase in the non-potentiality.(2) Two areas that have evident changes in the azimuth of the vector magnetic field are found near the magnetic polarity inversion line.The change rates of the azimuth are about 1.3° h-1 and 3.6° h-1,respectively.(3) Rapid and prominent increases are found in the variation of helicity during four flares in the regions where their initial brightening occurs.The recovery of the increases takes 3-4 h for the two biggest flares (X2.2 and M6.6),but only takes about 2 h for the two other smaller flares (M2.2 and M1.6).

  3. Estudio del sistema simbiótico AR Pavonis

    Science.gov (United States)

    Quiroga, C.; Brandi, E.; Ferrer, O.; García, L.; Barbá, R.

    Se presenta un estudio espectroscópico y polarimétrico de la binaria eclipsante AR Pavonis a partir de observaciones obtenidas con el telescopio de 2.15 m. del CASLEO (San Juan). El estudio de la naturaleza del sistema se realizó a través del análisis de algunos espectros reunidos entre los años 1990 y 1995 y de datos polarimétricos correspondientes al intervalo 1995 y 1997. El análisis espectroscópico indica que AR Pav está compuesta por una gigante roja M3.7 y una componente caliente compacta, con una temperatura mayor a 90000 K y una luminosidad del orden de 500Lsolar. A lo largo del período orbital, las variaciones observadas en flujo y en velocidades radiales, reflejan que las emisiones permitidas se forman en una región que rodea la componente caliente. El estudio de la polarización lineal de AR Pav indica que además de una componente interestelar, existe una componente intrínseca del sistema que varía temporalmente y con la longitud de onda de la luz polarizada. El distinto comportamiento del grado de polarización y del ángulo de posición observado en fases diferentes, sugiere que distintos mecanismos pueden estar actuando, dependiendo de la región de scattering observado a lo largo de la línea de la visual.

  4. X-ray calculations for a NLTE Ar plasma

    Institute of Scientific and Technical Information of China (English)

    WUZe-qing; PANGJin-qiao; HANGuo-xing

    2004-01-01

    A model is developed to calculate emission spectrum of non-local thermodynamic equilibrium(NLTE)plasmas. The Collisional-Radiative model is adopted for non-LTE population calculations. Configuration-averaged rate coefficients that needed in the rate equations are obtained based on the first order perturbation theory. The Hatree-Fock-Slater self-consistent-field method is used to calculate electron wave functions. The present model is applied to the calculation of emissivity from a Ar plasma. The features of the spectra are in good agreement with those calculated by other theoretical models, but the data of the integrated emissivity differ by a factor 2-8.

  5. Predication of Crane Condition Parameters Based on SVM and AR

    Science.gov (United States)

    Xiuzhong, Xu; Xiong, Hu; Congxiao, Zhou

    2011-07-01

    Through statistic analysis of vibration signals of motor on the container crane hoisting mechanism in a port, the feature vectors with vibration are obtained. Through data preprocessing and training data, Training models of condition parameters based on support vector machine (SVM) are established. The testing data of condition monitoring parameters can be predicted by the training models. During training the models, the penalty parameter and kernel function of model are optimized by cross validation. In order to analysis the accurate of SVM model, autoregressive model is used to predict the trend of vibration. The research showed the predicted results of model using SVM are better than the results by autoregressive (AR) modeling.

  6. Energy Levels of Highly Ionized Ar ⅩⅣ

    Institute of Scientific and Technical Information of China (English)

    CHENG Zhang; LI Ping; DENG Xiao-Hui

    2006-01-01

    With the Breit interaction and quantum electrodynamics corrections considered, relativistic configuration interaction calculations have been carried out in the extended optimal level scheme using multi-configuration Dirac-Fock wave functions on the 204 energy levels and electric dipole transitions of Ar ⅩⅣ. The results of electric dipole transitions are in good agreement with experiments. Among the energy levels calculated, the lowest 125 levels are in good agreement with available experimental and other theoretical ones, and the other 79 levels are new ones obtained by the present work. This wide range of atomic energy levels is useful in astrophysics and plasma physics.

  7. Tissue Characterization on Common Carotid Artery using AR Model

    Science.gov (United States)

    Koya, Yoshiharu; Mizoshiri, Isao

    This study uses one image with a echocardiography and detects arteriosclerosis on the common carotid artery by tissue characterization. The conventional methods are measurement of thickness on the vessel wall or stiffness on the common carotid artery. However, they need frames of several beats and great calculation times. But, we detect the arteriosclerosis with only one image. Our method estimate the grade of arteriosclerosis by AR model parameters fitted to the texture on the lumen-intima wall. Experimental results show the validity of the proposed method.

  8. Oscillator strengths for Ar VII, Ca IX and Fe XV

    Science.gov (United States)

    Tayal, S. S.

    1986-01-01

    The excitation energies and oscillator strengths are calculated for electric-dipole-allowed and intercombination transitions between 3s2 1S, 3s3p(1,3)P0, 3p2 3P, 1D, 1S and 3s3d(1,3)D states in Ar VII, Ca IX, and Fe XV ions of the magnesium sequence. These states are represented by the fairly large configuration-interaction expansions. The calculations have been carried out in both LS and intermediate coupling schemes. The relativistic corrections have been included through the Breit-Pauli Hamiltonian. The results are compared with previous theoretical calculations and with measurements.

  9. The readout system for the ArTeMis camera

    Science.gov (United States)

    Doumayrou, E.; Lortholary, M.; Dumaye, L.; Hamon, G.

    2014-07-01

    During ArTeMiS observations at the APEX telescope (Chajnantor, Chile), 5760 bolometric pixels from 20 arrays at 300mK, corresponding to 3 submillimeter focal planes at 450μm, 350μm and 200μm, have to be read out simultaneously at 40Hz. The read out system, made of electronics and software, is the full chain from the cryostat to the telescope. The readout electronics consists of cryogenic buffers at 4K (NABU), based on CMOS technology, and of warm electronic acquisition systems called BOLERO. The bolometric signal given by each pixel has to be amplified, sampled, converted, time stamped and formatted in data packets by the BOLERO electronics. The time stamping is obtained by the decoding of an IRIG-B signal given by APEX and is key to ensure the synchronization of the data with the telescope. Specifically developed for ArTeMiS, BOLERO is an assembly of analogue and digital FPGA boards connected directly on the top of the cryostat. Two detectors arrays (18*16 pixels), one NABU and one BOLERO interconnected by ribbon cables constitute the unit of the electronic architecture of ArTeMiS. In total, the 20 detectors for the tree focal planes are read by 10 BOLEROs. The software is working on a Linux operating system, it runs on 2 back-end computers (called BEAR) which are small and robust PCs with solid state disks. They gather the 10 BOLEROs data fluxes, and reconstruct the focal planes images. When the telescope scans the sky, the acquisitions are triggered thanks to a specific network protocol. This interface with APEX enables to synchronize the acquisition with the observations on sky: the time stamped data packets are sent during the scans to the APEX software that builds the observation FITS files. A graphical user interface enables the setting of the camera and the real time display of the focal plane images, which is essential in laboratory and commissioning phases. The software is a set of C++, Labview and Python, the qualities of which are respectively used

  10. Consumo de arsénico y riesgo cardiovascular

    OpenAIRE

    Lachiner Saborío Morales; Luis Fernando Hidalgo Murillo

    2015-01-01

    El arsénico (As) es un elemento considerado como ubicuo, cuyas fuentes pueden ser naturales o productos de la actividad humana. La exposición a este elemento ocurre principalmente por la vía oral. Las presentaciones inorgánicas del As son consideradas como las más tóxicas. La absorción del As ocurre en el intestino delgado y por medio de acuaporinas ingresa a los hepatocitos, en casos de ingesta crónica el As tiende acumularse en hígado, riñones, corazón, sistema nervioso, pulmones, músculo, ...

  11. Analyzing House Fly's Exploration Behavior with AR Methods

    CERN Document Server

    Takahashi, H; Ikegamai, T; Shimada, M; Horibe, Naoto; Ikegamai, Takahshi; Shimada, Masakazu; Takahashi, Hisanao

    2007-01-01

    This paper presents a detailed characterization of the trajectory of a single housefly freely walking in a square cage. The trajectory of the fly is recorded and transformed into time series, which is fully analyzed by the method of AR model. A main discovery is that the fly switches the styles of motion from the low dimensional regular pattern to the higher dimensional disordered pattern. In particular, the anomalous diffusion is found to well characterize the fly's exploration behavior. The exploration behavior analysis is important form both psychological and dynamical system' point of view.

  12. X-ray calculations for a NLTE Ar plasma

    Institute of Scientific and Technical Information of China (English)

    WU Ze-qing; PANG Jin-qiao; HAN Guo-xing

    2004-01-01

    A model is developed to calculate emission spectrum of non-local thermodynamic equilibrium(NLTE) plasmas. The Collisional-Radiative model is adopted for non-LTE population calculations. Configuration-averaged rate coefficients that needed in the rate equations are obtained based on the first order perturbation theory. The Hatree-Fock-Slater self-consistent-field method is used to calculate electron wave functions. The present model is applied to the calculation of emissivity from a Ar plasma. The features of the spectra are in good agreement with those calculated by other theoretical models, but the data of the integrated emissivity differ by a factor 2~8.

  13. Ultra-high precision 40Ar/39Ar ages for Fish Canyon Tuff and Alder Creek Rhyolite sanidine: New dating standards required?

    Science.gov (United States)

    Phillips, D.; Matchan, E. L.

    2013-11-01

    The 40Ar/39Ar dating technique is a high precision (ACR). Despite common usage, the ages of FCT and ACR sanidine have proven contentious, with reported values varying by >2%; well outside the ±0.1% aspiration of EARTHTIME (http://www.earth-time.org).

  14. Eruption of the Continental Flood Basalts at ~259 Ma in the Emeishan Large Igneous Province, SW China: Evidence from Laser Microprobe 40Ar/39Ar Dating

    Institute of Scientific and Technical Information of China (English)

    HOU Zengqian; CHEN Wen; LU Jiren

    2006-01-01

    A suite of continental flood basalts sampled over a vast exposure and stratigraphic thickness in the Emeishan large igneous province (LLP), SW China was investigated for laser microprobe 40Ar/39Ar dating. There are two 40Ar/39Ar age groups for these basalts, corresponding to 259-246 Ma and 177-137 Ma, respectively. A well-defined isochron gives an eruption age of huge quantities of mafic magmas at 258.9±3.4 Ma, which is identical to previous dating and paleontological data. Much younger 40Ar/39Ar ages for some basalts with low-greenschist metamorphic facies probably recorded a late thermo-tectonic event caused by collision between the Yangtze and Qiangtang continental blocks during the Mesozoic, which resulted in the reset of argon isotope system. The 40Ar/39Ar age data, we present here, combined with previous dating and paleontological data, suggest relatively short duration (about 3 Ma) of mafic volcanism, which have important implication on mantle plume genesis of the Emeishan continental flood basalts in the LIP.

  15. Constraining the age of the Matuyama-Brunhes reversal using intercalibrated 40Ar/39Ar and astronomical ages of the Bishop Tuff and Australasian Tektite

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Palike, Heiko;

    ). However, this age offset is not synchronous with a new astronomically intercalibrated 40Ar/39Ar age for the normal-polarity Quaternary Bishop Tuff, stratigraphically above the MB boundary by approximately 15 ka. In order to best constrain the age of the boundary, an astronomically calibrated radio...

  16. Noble Gases in the Monahans Chondrite and Halite: Ar-39 - Ar-40 Age, Space Exposure Age, Trapped Solar Gases, and Neutron Fluence

    Science.gov (United States)

    Garrison, Daniel H.; Bogard, Donald D.

    2000-01-01

    For the Monahans chondrite and halite, we determined Ar-39 - Ar-40 ages of silicate = 4.53 Ga, halite > 4.3 Ga; a space exposure age of approx. 5 Ma; a regolith pre-irradiation; solar gas concentrations in the dark phase; and a regolith thermal neutron fluence.

  17. Precise molybdenite Re-Os and mica Ar-Ar dating of the Mesozoic Yaogangxian tungsten deposit, central Nanling district, South China

    Science.gov (United States)

    Peng, Jiantang; Zhou, Mei-Fu; Hu, Ruizhong; Shen, Nengping; Yuan, Shunda; Bi, Xianwu; Du, Andao; Qu, Wenjun

    2006-10-01

    The Yaogangxian deposit in the central Nanling region, South China consists of vein-type ore bodies hosted in Cambrian to Jurassic strata and Mesozoic granitic intrusions. Wolframite and molybdenite are the dominant ore minerals intergrown with gangue minerals of quartz, feldspar, phlogopite, and muscovite. We have carried out molybdenite Re-Os and phlogopite and muscovite 40Ar/39Ar dating to better understand the timing and genesis of mineralization. Re-Os dating of eight molybdenite samples yielded model ages ranging from 152.0±3.5 to 161.1±4.5 Ma, with an average of 156.0 Ma. The Re-Os analyses give a well-defined 187Re/187Os isochron with an age of 154.9±2.6 Ma (MSWD=2.4). Hydrothermal phlogopite and muscovite display extremely flat 40Ar/39Ar age spectra. Phlogopite yields a 40Ar/39Ar plateau age of 153.0±1.1 Ma, whereas muscovite yields a plateau age of 155.1±1.1 Ma. Both 40Ar/39Ar ages are in good agreement with the Re-Os ages, placing the timing of tungsten mineralization at about 154 Ma. This age is consistent with the field relationships. Our new data, when combined with published geochronological results from other major deposits in this region, suggest that large scale W-Sn mineralization occurred throughout the central Nanling region in the Late Jurassic.

  18. An Early Jurassic 40Ar/39Ar Age for the Puchezh-Katunki Impact Structure (Russia) — No Causal Link to an Extinction Event

    Science.gov (United States)

    Holm-Alwmark, S.; Alwmark, C.; Lindström, S.; Ferrière, L.; Scherstén, A.; Masaitis, V. L.; Mashchak, M. S.; Naumov, M. V.

    2016-08-01

    We propose a revised age of 192.0 ± 0.8 Ma for the formation of the Puchezh-Katunki impact structure, Russia, based on 40Ar/39Ar step-heating analyses of five impact melt rock samples. This age does not correlate with any known extinction event.

  19. 40Ar/39Ar Dating of the Shaxi Porphyry Cu-Au Deposit in the Southern Tan-Lu Fault Zone, Anhui Province

    Institute of Scientific and Technical Information of China (English)

    YANG Xiaoyong; ZHENG Yongfei; XIAO Yilin; DU Jianguo; SUN Weidong

    2007-01-01

    Four samples of plagioclase and biotite from the Shaxi porphyry in the lower part of the Yangtze metallogenic belt were analyzed for age determination with the 40Ar/39Ar method. The results yield reproducible ages of 126 Ma to 135 Ma with a high level of confidence according to the agreement between isochron and plateau ages. The four Ar-Ar ages are relatively consistent within the analytical error. These ages are also consistent with, but more precise than, previous K-Ar and Rb-Sr ages and thus provide better constraints on the time of porphyry formation and associated Cu-Au mineralization along the middle to lower part of the Yangtze metallogenic belt. The ages of 126 to 135 Ma are interpreted to represent the intrusive time of the Shaxi porphyry, so that the Cu-Au mineralization should have occurred later due to the post-magmatic hydrothermal event.

  20. Preservation of Sub-Microscopic Scale Structural Relics in Biotite: Implications for 40AR/39AR Geochronology

    Science.gov (United States)

    Beltrando, M.; Di Vincenzo, G.; Ferraris, C.

    2012-12-01

    Relic crystals of magmatic biotite that undewent eclogite facies metamorphism were investigated by laser step-heating and laser in-situ 40Ar/39Ar techniques, in conjunction with SEM, EMP and TEM analyses, to elucidate the influence of recrystallization on K-Ar systematics. Samples were collected from meta-granitoids of the Gran Paradiso Massif (Western Alps), emplaced at upper crustal depths (P~0.25-0.35 GPa) in the Permian and metamorphosed at P>2.0 GPa and T~500-600°C in the Middle-Late Eocene. Two different samples, which underwent different degrees of Alpine re-equilibration, were examined. Sample JT1007 still preserves the original cm-sized magmatic quartz, k-feldspar and brown biotite (Bt 1), rarely rimmed by small green biotite crystals (Bt 2) related to Alpine metamorphism. Sample JT1008, instead, is characterized by a larger degree of Alpine re-equilibration, with static re-crystallization of the original magmatic quartz into aggregates of fine-grained polygonal crystals and common green biotite rims around brown Bt 1. Compositional profiling across Bt 1 in sample JT1007 reveals a progressive decrease in Ti content towards the crystal rims, which overlap with the composition of Bt 2. Compositional profiling across Bt 1 in sample JT1008, instead, reveals a homogeneous Ti content across the grain. This compositional pattern is mirrored by TEM investigation at the sub-micron scale, revealing a systematic zoning in Bt 1 from sample JT1007, with high-temperature magmatic politypes, surrounded by 1M politypes, still preserved in crystal cores. Crystal rims, instead, are characterized by 1M politypes only. Biotites from JT1008, instead, are homogeneous, solely consisting of 1M politypes. Infrared laser step-heating experiments on mineral separates from the two samples gave contrasting results: JT1008 yielded a flat spectrum, for more than 90% of the released 39ArK, with an error-weighted mean age of 36.5±0.3 Ma; JT1007 yielded a slightly saddle-shaped profile