WorldWideScience

Sample records for ar interior provocada

  1. Qualidade do ar interior em instalações desportivas

    OpenAIRE

    Marques, Liliana Rute Dias

    2013-01-01

    A Qualidade do Ar Interior (QAI) tem vindo a despertar cada vez mais o interesse da comunidade científica, pelo facto das sociedades modernas passarem a grande maioria do seu dia em ambientes interiores, sendo o ar que respiramos um fator determinante na saúde e bem-estar do ser humano. Os indivíduos que praticam desporto estão em particular risco de inalar poluentes, não só porque durante a atividade desportiva estão sujeitos a maiores taxas de consumo de ar mas também ao f...

  2. Minu San Martín Aróstegui: la pintura interior

    OpenAIRE

    D'Agosto Forteza, Sonia Adriana

    2015-01-01

    En este trabajo se da a conocer la trayectoria vital y profesional de la pintora Minu San Martín Aróstegui. Artista nacida en San Sebastián con un interesante recorrido en el que podremos rastrear la belleza plástica que emana de la fusión entre el Romanticismo occidental y la filosofía Taoísta. In this work one occurs to know the vital and artistic trajectory Minu painter San Martin Aróstegui. Artist born in San Sebastián with an interesting artistic route where we will be able to track t...

  3. Eficiência de fogões a biomassa e impactos na qualidade do ar interior

    OpenAIRE

    Carvalho, Ricardo Luís Teles de

    2010-01-01

    A combustão residencial de biomassa é uma forma de produção de energia térmica considerada neutra do ponto de vista de CO2 de origem fóssil, mas que pode ter impactos na qualidade do ar. O presente trabalho teve como objectivo analisar o desempenho energético e ambiental de diferentes fogões a biomassa utilizados em habitações unifamiliares. Como resultado da aplicação de um modelo numérico de simulação dinâmica – BSIM Building Simulation – e das experiências realizadas em 6 habitações uni...

  4. Vacuna frente a infestaciones provocadas por artrópodos hematófagos

    OpenAIRE

    Fuente García, José de la; Villar, Margarita; Prudencio, Carlos Roberto; Pérez de Lastra, José Manuel

    2012-01-01

    [ES] La presente invención describe una vacuna frente a infestaciones provocadas por artrópodos hematófagos preferentemente garrapatas, mosquitos, flebótomos, ácaros rojos de las gallinas, pulgas, piojos, piojos de mar, etc. Así mismo, se protege un péptido capaz de inducir una respuesta inmune protectora y de reacción cruzada frente a una infestación provocada por artrópodos hematófagos, un polinucleótido, un vector de expresión, una célula hospedadora, un animal no humano, un anticuerpo, y ...

  5. Vacuna frente a infestaciones provocadas por artrópodos hematófagos

    OpenAIRE

    Fuente García, José de la; Villar, Margarita; Prudencio, Carlos Roberto; Pérez de Lastra, José Manuel

    2012-01-01

    La presente invención describe una vacuna frente a infestaciones provocadas por artrópodos hematófagos preferentemente garrapatas, mosquitos, flebótomos, ácaros rojos de las gallinas, pulgas, piojos, piojos de mar, etc. Así mismo, se protege un péptido capaz de inducir una respuesta inmune protectora y de reacción cruzada frente a una infestación provocada por artrópodos hematófagos, un polinucleótido, un vector de expresión, una célula hospedadora, un animal no hum...

  6. Modelo de simulação da temperatura e umidade relativa do ar no interior de estufa plástica Simulation model of air temperature and relative humidity in to plastic greenhouses

    Directory of Open Access Journals (Sweden)

    Edilson Costa

    2004-04-01

    Full Text Available A simulação dos parâmetros climáticos de temperatura e umidade relativa do ar no interior de uma estufa plástica, por meio do balanço de energia, pode propiciar ao produtor uma ferramenta de auxílio na tomada de decisão. Nesse propósito, realizou-se uma simulação das condições no interior de estufa plástica, em função de parâmetros externos e internos a ela. A simulação revelou uma temperatura no interior da estufa plástica de 23,6 ºC, e os sensores revelaram um valor médio de 24,1 ºC para o período de cultivo da alface. Para a umidade relativa no interior da estufa plástica, o valor simulado foi de 61,6%, e o obtido com o auxílio de sensores foi de 66,0%. Os valores simulados apresentaram-se próximos dos valores obtidos pelos sensores, mostrando que o modelo pode ser usado para a estimativa da temperatura e umidade relativa do ar no interior da estufa plástica.Simulation of climatic parameters inside air temperature and relative humidity of plastic greenhouse, trough energy balance, allows to growers a good technical tool on the decision making to improve the performance of inside environments. A simulation of internal conditions based on external and internal parameters was evaluated. The results showed the inside mean temperature of 23.6 ºC in comparison with the experimental value of 24.1 ºC, for the cultivated period. The simulated relative humidity presented a value of 61.6% against 66.0% obtained by the sensors. The simulated values were closed to the values obtained by the sensors, which means that the model can be used to determine the internal conditions of plastic greenhouses.

  7. Atención médica de lesiones intencionales provocadas por la violencia familiar

    Directory of Open Access Journals (Sweden)

    Híjar-Medina Martha

    2003-01-01

    Full Text Available OBJETIVO: Describir y analizar las características de la demanda provocada por lesiones intencionales, en especial las provocadas por violencia familiar en los servicios de urgencias de hospitales públicos de la Ciudad de México. MATERIAL Y MÉTODOS: Se realizó un estudio transversal, en el cual se incluyeron variables relacionadas con el agresor, el agredido y con la atención médica. Se diseñó un cuestionario, que se aplicó durante los meses de enero a abril de 1998 en cuatro hospitales seleccionados. Se realizó un análisis con base en frecuencias simples, ji cuadrado, razón de momios con sus respectivos intervalos de confianza de 95%, y se aplicó modelo de regresión logística ajustado por las variables asociadas con este tipo de demanda. RESULTADOS: De los 598 casos que presentaron lesiones intencionales, 16% correspondió a violencia familiar. Los más afectados fueron el sexo femenino (76%, y jóvenes entre 15 y 29 años de edad (46%. Las variables que se encontraron asociadas con la demanda por lesiones provocadas por violencia familiar, en comparación con otro tipo de violencia, fueron: edad mayor de 30 años (RM 2.36, IC 95% 1.13-4.90, sexo femenino (RM 8.60, IC 95%/4.25-17.40 antecedentes de lesiones previas (RM 4.93, IC 95% 2.03-11.95, el hogar como lugar de ocurrencia (RM 36.25, IC 95% 16.598-79.18 y escolaridad primaria o menos (RM 2.33, IC 95% 1.03-5.26. CONCLUSIONES: Los resultados encontrados coinciden con reportes de otros estudios sobre el tema, y son de gran utilidad como antecedentes para la aplicación de la Norma Oficial Mexicana para la Atención Médica de la Violencia Familiar, que entró en vigencia en marzo de 2000.

  8. Ars disyecta Ars disyecta

    Directory of Open Access Journals (Sweden)

    Alejandra Castillo

    2012-07-01

    Full Text Available Bajo la nominación Ars Disyecta se busca exponer el vínculo entre artes visuales, feminismo y metamorfosis. Las prácticas artísticas feministas aquí presentadas se proponen perturbar el espacio metafórico heredado de la diferencia sexual (pensemos, por ejemplo, en las palabras engendramiento, matriz, vida, compenetración o invaginamiento. En este sentido, la nominación Ars disyecta pone en escena un conjunto de prácticas e intervenciones que intentan interrumpir la matriz de la diferencia, desestabilizando lo femenino desde aquellas figuras que se resisten a la lógica de la totalidad y de un tiempo propio. Buscando seguir la huella de un arte disyecto es que interrogaré en este ensayo aquellas autorías feministas que en el arte contemporáneo trafican con las huellas del contagio, la mutación y la alteridad.This article aims to present the relation between visual arts, feminism I and metamorphosis. The feminist artistic practices portrayed in this article attempt to question categories inherited from the metaphor of sexual difference such as engendering, matrix and life. From this perspective, Ars disyecta will establish a set of artistic practices and interventions that intend to interrupt the proper idea of «feminine difference». Following this line of argument, I will discuss in this article a few contemporary feminist works of art that could be defined by words such as contagious, mutation and otherness.

  9. Ars Electronica

    DEFF Research Database (Denmark)

    Kristensen, Thomas Bjørnsten

    2009-01-01

    Anmeldelse af Ars Electronica festivalen 3. - 8. september, 2009 i Linz, Østrig, der fejrede 30 års jubilæum under temaet "Human Nature". Festivalen fokuserer på interaktion mellem menneske, teknologi, kunst og samfund med særlig vægt på udviklingen af computeren og det digitale. Udgivelsesdato: 15.12...

  10. Variación de la humedad relativa en el interior del hormigón debido al cambio de humedad relativa y temperatura en el ambiente externo

    OpenAIRE

    Bernal Camacho, Jesús Manuel; Moragues Terrades, Amparo; Reyes Pozo, Encarnación; Galvez Ruiz, Jaime Carlos; González, J.R. (Javier Roberto)

    2015-01-01

    En la durabilidad del hormigón juega un papel fundamental la penetración de iones agresivos en su interior debido a distintos mecanismos de transporte entre los que destacan la difusión y la advección. Esta penetración se ve afectada en gran medida por la humedad relativa existente en el interior del hormigón. El presente trabajo se centra en el estudio de las variaciones de la humedad relativa en el interior del hormigón provocadas por cambios de humedad relativa y temperatura en el ambie...

  11. Ar-Ar_Redux: rigorous error propagation of 40Ar/39Ar data, including covariances

    Science.gov (United States)

    Vermeesch, P.

    2015-12-01

    Rigorous data reduction and error propagation algorithms are needed to realise Earthtime's objective to improve the interlaboratory accuracy of 40Ar/39Ar dating to better than 1% and thereby facilitate the comparison and combination of the K-Ar and U-Pb chronometers. Ar-Ar_Redux is a new data reduction protocol and software program for 40Ar/39Ar geochronology which takes into account two previously underappreciated aspects of the method: 1. 40Ar/39Ar measurements are compositional dataIn its simplest form, the 40Ar/39Ar age equation can be written as: t = log(1+J [40Ar/39Ar-298.5636Ar/39Ar])/λ = log(1 + JR)/λ Where λ is the 40K decay constant and J is the irradiation parameter. The age t does not depend on the absolute abundances of the three argon isotopes but only on their relative ratios. Thus, the 36Ar, 39Ar and 40Ar abundances can be normalised to unity and plotted on a ternary diagram or 'simplex'. Argon isotopic data are therefore subject to the peculiar mathematics of 'compositional data', sensu Aitchison (1986, The Statistical Analysis of Compositional Data, Chapman & Hall). 2. Correlated errors are pervasive throughout the 40Ar/39Ar methodCurrent data reduction protocols for 40Ar/39Ar geochronology propagate the age uncertainty as follows: σ2(t) = [J2 σ2(R) + R2 σ2(J)] / [λ2 (1 + R J)], which implies zero covariance between R and J. In reality, however, significant error correlations are found in every step of the 40Ar/39Ar data acquisition and processing, in both single and multi collector instruments, during blank, interference and decay corrections, age calculation etc. Ar-Ar_Redux revisits every aspect of the 40Ar/39Ar method by casting the raw mass spectrometer data into a contingency table of logratios, which automatically keeps track of all covariances in a compositional context. Application of the method to real data reveals strong correlations (r2 of up to 0.9) between age measurements within a single irradiation batch. Propertly taking

  12. Estudio de las oscilaciones provocadas por los generadores de inducción en el Parque Eólico La Venta (México)

    OpenAIRE

    Mercedes Lázaro-Gonzaga; Arturo Román-Mesina; Daniel Olguín-Salinas

    2008-01-01

    Este artículo presenta un análisis del comportamiento de las oscilaciones locales provocadas por siete unidades generadoras asíncronas de un parque eólico, localizadas en la zona de La Venta, Oaxaca-México, en el sur del Istmo de Tehuantepec. Este Sistema Eléctrico de Potencia (SEP) forma parte del Sistema Interconectado Nacional Mexicano (SINM). Para su estudio se utiliza una configuración de un Sistema Máquina Bus Infinito (SMBI), el cual está formado por una unidad generadora equivalente, ...

  13. Las dos clases de actividad muscular provocada: la neuromuscular y la idiomuscular. Sinopsis fisiopatológica y clínica

    Directory of Open Access Journals (Sweden)

    Luis Barraquer-Bordas

    1950-12-01

    Full Text Available El autor denomina actividad muscular provocada a la contracción del músculo esquelético subsiguiente a la percusión mediante el martillo de reflejos, Esta actividad es llamada respuesta. Existen dos clases de respuestas: la neuromuscular o refleja, proporcionada por el sistema anatómico y funcional músculo-sistema nervioso-músculo, y la idiomuscular. El autor analiza el concepto de las respuestas reflejas fásicas por tracción muscular provocadas por el método clínico de percusión, refiriéndose a las concepciones de los clásicos, de Wartenberg, de Monrad-Krohn, etc. Expone su visión personal. Describe la respuesta idiomuscular y sus modificaciones clínicas. Estudia el régimen habitual de convivencia clínica entre la respuesta neuromuscular o refleja y la idiomuscular y las modificaciones de este régimen en los estados patológicos. Se refiere en especial ao fenómeno denominado por Barraquer-Roviralta "fenómeno del contraste de la contracción", que aparece en las lesiones de las raíces posteriores - p. ej. en la tabes - y que consiste en la pérdida de la respuesta refleja con exageración de la idiomuscular.

  14. Tolerância a agente curarizante provocada pela administração repetida da droga

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Zanini

    1974-03-01

    Full Text Available Baseados em teoria discutível segundo a qual a miastenia grave é provocada pela presença no sangue de substância curarizante liberada pelo timo, tentou-se reproduzir um modelo experimental. Foram utilizados 40 ratos, criados nas mesmas condições, nascidos no mesmo dia, pesando ao redor de 350 g e divididos em 4 grupos: o Grupo I não foi manuseado; no Grupo II foi injetada solução fisiológica, 1 ml i.p. durante 6 semanas; no Grupo III foi injetada a dimetil tubocurarina (DMT 2,8 mcg/kg i.p., durante o mesmo tempo; no Grupo IV 14 mcg/kg da mesma droga foram injetados i.p. Uma semana após a última injeção i.p. os ratos, anestesiados, foram preparados para registro neuromuscular. O nervo ciático foi estimulado nas freqüências de 0,33 pulsos/seg, 70 pulsos/seg (séries de 10 pulsos a intervalos de 3 seg, 70 pulsos/seg (mantidos por 15 seg e novamente 0,33 pulsos/seg logo após a tetanização. A dose curarizante de DMT foi determinada por uma "terceira parte cega" quando 80% do bloqueio era alcançado. Quando apenas 10 estímulos em alta freqüência foram aplicados ao nervo, foi observada diferença significativa (p<0.05 na resposta: Grupo I, 46,50 ± 20,00 g+; Grupo II, 55,25 ± 11,33 g+; Grupo III, 37,25 ± 10,77 g+; Grupo IV 37,00 ± 12,74 g+. Diferenças significantes de força muscular foram também observadas após a tetanização mantida: Grupo I, 79,00 ± 16,21 g+; Grupo II, 76,75 ± 15,23 g+; Grupo III, 59,12 ± 17,38 g+; Grupo IV, 61,62 ± 14,74 g. Doses significamente mais altas de curare i.v. foram necessárias no grupo injetado diariamente com a maior dose de curare do que em qualquer dos outros grupos (p < 0,01: Grupo I, 3,62 ± 1,17 mcg/kg; Grupo II, 3,69 ± 1,21 mcg/kg; Grupo III, 4,01 ± 0,80 mcg/kg; Grupo IV, 5,48 ± 1,40 mcg/kg. Tais resultados mostram que a administração crônica do curare leva ao enfraquecimento físico e hiposensibilidade à droga. Isto sugere que embora a existência de subst

  15. Cuidados de enfermagem na prevenção da insuficiência renal provocada por contraste após cateterismo Cuidados de enfermagem na prevenção da insuficiência renal provocada por contraste após cateterismo Nursing care in the prevention of renal failure caused by post-catheterism contrast

    Directory of Open Access Journals (Sweden)

    Flavia Giron Camerini

    2008-01-01

    Full Text Available O estudo teve como objetivo identificar produções científicas de enfermagem sobre insuficiência renal aguda provocada por contraste iodado após cateterismo cardíaco, no período de 2002 a 2007, analisando sua aplicabilidade à prática. Foi realizada ainda uma análise crítica das produções científicas selecionadas, delineando os cuidados de enfermagem. Este estudo é uma pesquisa bibliográfica de artigos de enfermagem, encontrados através de busca computadorizada. Dos 47 artigos encontrados, 10 foram selecionados por terem atendido os critérios de inclusão. Após a análise dos artigos, verificamos a importância da atuação do enfermeiro na prevenção da insuficiência renal aguda provocada por contraste. Além disso, evidenciamos a melhor prática de enfermagem para a prevenção da insuficiência renal aguda provocada por contraste.El presente estudio tuvo como objetivo identificar producciones científicas de enfermería sobre la insuficiencia renal aguda provocada por contraste yodado después del cateterismo cardíaco, en el período de 2002 a 2007, analizando su aplicabilidad a la práctica. Se realizó además el análisis crítico de las producciones científicas seleccionadas, delineando los cuidados de enfermería. Este estudio es una investigación bibliográfica de artículos de enfermería, encontrados por medio de búsqueda computarizada. De los 47 artículos encontrados, 10 fueron seleccionados por haber atendido a los criterios de inclusión. Después del análisis de los artículos, verificamos la importancia de la actuación del enfermero en la prevención de la insuficiencia renal aguda provocada por contraste. Además de lo referido, evidenciamos una mejor práctica de enfermería para la prevención de la insuficiencia renal aguda provocada por contraste.The purpose of this study was to identify the nursing scientific production on acute renal failure caused by post-catheterism iodized cardiac contrast

  16. Interior intrusion detection systems

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, J.R.; Matter, J.C. (Sandia National Labs., Albuquerque, NM (United States)); Dry, B. (BE, Inc., Barnwell, SC (United States))

    1991-10-01

    The purpose of this NUREG is to present technical information that should be useful to NRC licensees in designing interior intrusion detection systems. Interior intrusion sensors are discussed according to their primary application: boundary-penetration detection, volumetric detection, and point protection. Information necessary for implementation of an effective interior intrusion detection system is presented, including principles of operation, performance characteristics and guidelines for design, procurement, installation, testing, and maintenance. A glossary of sensor data terms is included. 36 figs., 6 tabs.

  17. Interior intrusion detection systems

    International Nuclear Information System (INIS)

    The purpose of this NUREG is to present technical information that should be useful to NRC licensees in designing interior intrusion detection systems. Interior intrusion sensors are discussed according to their primary application: boundary-penetration detection, volumetric detection, and point protection. Information necessary for implementation of an effective interior intrusion detection system is presented, including principles of operation, performance characteristics and guidelines for design, procurement, installation, testing, and maintenance. A glossary of sensor data terms is included. 36 figs., 6 tabs

  18. Microbiologia do ar : monitorização do ar em ambiente hospitalar

    OpenAIRE

    Santos, Ana Carina Marques dos

    2008-01-01

    O complexo ambiente hospitalar requer atenção especial, para assegurar uma saudável qualidade do ar interior, protegendo assim os profissionais de saúde e utentes de infecções nosocomiais e de doenças ocupacionais. Embora seja amplamente reconhecido que a contaminação de um bloco operatório seja a principal responsável pela complicação de uma cirurgia, em Portugal, estudos sobre microbiologia do ar a nível hospitalar são escassos. O objectivo deste estudo é investigar a vari...

  19. Optically measuring interior cavities

    Science.gov (United States)

    Stone, Gary Franklin

    2009-11-03

    A method of measuring the three-dimensional volume or perimeter shape of an interior cavity includes the steps of collecting a first optical slice of data that represents a partial volume or perimeter shape of the interior cavity, collecting additional optical slices of data that represents a partial volume or perimeter shape of the interior cavity, and combining the first optical slice of data and the additional optical slices of data to calculate of the three-dimensional volume or perimeter shape of the interior cavity.

  20. Ar-Ar Dating of Martian Meteorite, Dhofar 378: An Early Shock Event?

    Science.gov (United States)

    Park, J.; Bogard, D. D.

    2006-01-01

    Martian meteorite, Dhofar 378 (Dho378) is a basaltic shergottite from Oman, weighing 15 g, and possessing a black fusion crust. Chemical similarities between Dho378 and the Los Angeles 001 shergottite suggests that they might have derived from the same Mars locale. The plagioclase in other shergottites has been converted to maskelenite by shock, but Dho378 apparently experienced even more intense shock heating, estimated at 55-75 GPa. Dho378 feldspar (approximately 43 modal %) melted, partially flowed and vesiculated, and then partially recrystallized. Areas of feldspathic glass are appreciably enriched in K, whereas individual plagioclases show a range in the Or/An ratio of approximately 0.18-0.017. Radiometric dating of martian shergottites indicate variable formation times of 160-475 Myr, whereas cosmic ray exposure (CRE) ages of shergottites indicate most were ejected from Mars within the past few Myr. Most determined Ar-39-Ar-40 ages of shergottites appear older than other radiometric ages because of the presence of large amounts of martian atmosphere or interior Ar-40. Among all types of meteorites and returned lunar rocks, the impact event that initiated the CRE age very rarely reset the Ar-Ar age. This is because a minimum time and temperature is required to facilitate Ar diffusion loss. It is generally assumed that the shock-texture characteristics in martian meteorites were produced by the impact events that ejected the rocks from Mars, although the time of these shock events (as opposed to CRE ages) are not directly dated. Here we report Ar-39-Ar-40 dating of Dho378 plagioclase. We suggest that the determined age dates the intense shock heating event this meteorite experienced, but that it was not the impact that initiated the CRE age.

  1. 78 FR 5202 - Notice of Inventory Completion: Arkansas State University Museum, Jonesboro, AR

    Science.gov (United States)

    2013-01-24

    ... National Park Service Notice of Inventory Completion: Arkansas State University Museum, Jonesboro, AR AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Arkansas State University Museum... culturally affiliated with the human remains may contact the Arkansas State University Museum....

  2. 78 FR 5199 - Notice of Inventory Completion: Arkansas State University Museum, Jonesboro, AR

    Science.gov (United States)

    2013-01-24

    ... National Park Service Notice of Inventory Completion: Arkansas State University Museum, Jonesboro, AR AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY: The Arkansas State University Museum... associated funerary objects may contact the Arkansas State University Museum. Repatriation of the...

  3. Atención médica de lesiones intencionales provocadas por la violencia familiar Medical care of injuries caused intentionally by domestic violence

    Directory of Open Access Journals (Sweden)

    Martha Híjar-Medina

    2003-08-01

    Full Text Available OBJETIVO: Describir y analizar las características de la demanda provocada por lesiones intencionales, en especial las provocadas por violencia familiar en los servicios de urgencias de hospitales públicos de la Ciudad de México. MATERIAL Y MÉTODOS: Se realizó un estudio transversal, en el cual se incluyeron variables relacionadas con el agresor, el agredido y con la atención médica. Se diseñó un cuestionario, que se aplicó durante los meses de enero a abril de 1998 en cuatro hospitales seleccionados. Se realizó un análisis con base en frecuencias simples, ji cuadrado, razón de momios con sus respectivos intervalos de confianza de 95%, y se aplicó modelo de regresión logística ajustado por las variables asociadas con este tipo de demanda. RESULTADOS: De los 598 casos que presentaron lesiones intencionales, 16% correspondió a violencia familiar. Los más afectados fueron el sexo femenino (76%, y jóvenes entre 15 y 29 años de edad (46%. Las variables que se encontraron asociadas con la demanda por lesiones provocadas por violencia familiar, en comparación con otro tipo de violencia, fueron: edad mayor de 30 años (RM 2.36, IC 95% 1.13-4.90, sexo femenino (RM 8.60, IC 95%/4.25-17.40 antecedentes de lesiones previas (RM 4.93, IC 95% 2.03-11.95, el hogar como lugar de ocurrencia (RM 36.25, IC 95% 16.598-79.18 y escolaridad primaria o menos (RM 2.33, IC 95% 1.03-5.26. CONCLUSIONES: Los resultados encontrados coinciden con reportes de otros estudios sobre el tema, y son de gran utilidad como antecedentes para la aplicación de la Norma Oficial Mexicana para la Atención Médica de la Violencia Familiar, que entró en vigencia en marzo de 2000.OBJECTIVE: To describe and analyze the causes of emergency care services for intentional injuries, especially those caused by domestic violence, at four public hospitals in Mexico City. MATERIAL AND METHODS: A cross-sectional study was conducted between January and April 1998, which included

  4. Earth-atmosphere evolution based on new determination of Devonian atmosphere Ar isotopic composition

    Science.gov (United States)

    Stuart, Finlay M.; Mark, Darren F.; Gandanger, Pierre; McConville, Paul

    2016-07-01

    The isotopic composition of the noble gases, in particular Ar, in samples of ancient atmosphere trapped in rocks and minerals provides the strongest constraints on the timing and rate of Earth atmosphere formation by degassing of the Earth's interior. We have re-measured the isotopic composition of argon in the Rhynie chert from northeast Scotland using a high precision mass spectrometer in an effort to provide constraints on the composition of Devonian atmosphere. Irradiated chert samples yield 40Ar/36Ar ratios that are often below the modern atmosphere value. The data define a 40Ar/36Ar value of 289.5 ± 0.4 at K/36Ar = 0. Similarly low 40Ar/36Ar are measured in un-irradiated chert samples. The simplest explanation for the low 40Ar/36Ar is the preservation of Devonian atmosphere-derived Ar in the chert, with the intercept value in 40Ar-39Ar-36Ar space representing an upper limit. In this case the Earth's atmosphere has accumulated only 3% (5.1 ± 0.4 ×1016 mol) of the total 40Ar inventory since the Devonian. The average accumulation rate of 1.27 ± 0.09 ×108 mol40Ar/yr overlaps the rate over the last 800 kyr. This implies that there has been no resolvable temporal change in the outgassing rate of the Earth since the mid-Palaeozoic despite the likely episodicity of Ar degassing from the continental crust. Incorporating the new Devonian atmosphere 40Ar/36Ar into the Earth degassing model of Pujol et al. (2013) provides the most precise constraints on atmosphere formation so far. The atmosphere formed in the first ∼100 Ma after initial accretion during a catastrophic degassing episode. A significant volume of 40Ar did not start to accumulate in the atmosphere until after 4 Ga which implies that stable K-rich continental crust did not develop until this time.

  5. The Earth's Interior

    OpenAIRE

    Anderson, Don L.

    1992-01-01

    Seismologists have developed many methods for studying the structure and composition of the Earth's interior. Tens of thousands of earthquakes occur every year and each one sends out seismic waves in all directions. The bigger events send waves into the deep interior and these are used to infer the three-dimensional structure of our planet. Large earthquakes also generate surface waves which travel repeatedly around the surface and constructively interfere to generate ...

  6. Superdeformation of Ar hypernuclei

    Science.gov (United States)

    Isaka, Masahiro; Kimura, Masaaki; Hiyama, Emiko; Sagawa, Hiroyuki

    2015-10-01

    We investigate the differences in the Λ separation energies (S_Λ ) of the ground and superdeformed (SD) states in {}^{37}_Λ Ar, ^{39}_Λ Ar, and ^{41}_Λ Ar within the framework of antisymmetrized molecular dynamics (AMD). In this study, we find that the calculated S_Λ values in the SD states are much smaller than those in the ground states, unlike the result using the relativistic mean-field (RMF) calculation [B.-N. Lu et al., Phys. Rev. C, 89, 044307 (2014)]. One of the reasons for this difference between the present work and the RMF calculation is the difference in the density profile of the SD states in the core nuclei. We also find that the property of the Λ N odd-parity interaction affects the S_Λ trend between the ground and SD states.

  7. ARS Biodiesel Research Initiatives

    Science.gov (United States)

    Biodiesel activities within ARS are concerned with the production, quality, and properties of this alternative fuel from agriculturally derived fats and oils. Currently, in the absence of tax incentives, biodiesel production when using refined fats and oils and conventional alkali transesterificati...

  8. ARS Culture Collection

    Science.gov (United States)

    The internationally recognized Agricultural Research Service (ARS) Culture Collection will be described to include the microorganisms maintained by the collection, preservation methods and worldwide distribution of cultures. The impact of the germplasm will be described to include discovery of the f...

  9. Understanding Jupiter's Interior

    CERN Document Server

    Militzer, Burkhard; Wahl, Sean M; Hubbard, William

    2016-01-01

    This article provides an overview of how models of giant planet interiors are constructed. We review measurements from past space missions that provide constraints for the interior structure of Jupiter. We discuss typical three-layer interior models that consist of a dense central core and an inner metallic and an outer molecular hydrogen-helium layer. These models rely heavily on experiments, analytical theory, and first-principle computer simulations of hydrogen and helium to understand their behavior up to the extreme pressures ~10 Mbar and temperatures ~10,000 K. We review the various equations of state used in Jupiter models and compare them with shock wave experiments. We discuss the possibility of helium rain, core erosion and double diffusive convection may have important consequences for the structure and evolution of giant planets. In July 2016 the Juno spacecraft entered orbit around Jupiter, promising high-precision measurements of the gravitational field that will allow us to test our understandi...

  10. Planetary Interiors and Geodesy

    Science.gov (United States)

    Dehant, Veronique

    2013-04-01

    Lander and orbiter, even rover at the surface of planets or moons of the solar system help in determining their interior properties. First of all orbiters feel the gravity of the planet and its change. In particular, the tidal mass redistribution induces changes in the acceleration of the spacecraft orbiting around a planet. The Love number k2 has been determined for Venus, Mars and the Earth, as well as for Titan and will be deduced for instance for Mercury (MESSENGER and BepiColombo missions) and for the Galilean satellite from new missions such as JUICE (Jupiter Icy satellite Explorer). The properties of the interior can also be determined from the observation of the rotation of the celestial body. Radar observation from the Earth ground stations of Mercury has allowed Margo et al. (2012, JGR) to determine the moments of inertia of Mercury with an unprecedented accuracy. Rovers such as the MERs (Mars Exploration Rovers) allow as well to obtain the precession and nutation of Mars from which the moments of inertia of the planet and its core can be deduced. Future missions such as InSIGHT (Interior exploration using Seismic Investigations, Geodesy, and Heat Transport) will further help in the determination of Mars interior and evolution.

  11. INTERIOR EGG QUALITY

    Science.gov (United States)

    Without a high quality product, it is difficult for an industry to survive. This is no different for the shell egg processor. Many factors can influence shell egg interior quality. These influences occur during egg production and processing. Physiological stress, nutritional stress, heat stress,...

  12. Ars Electronica tulekul / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    6.-11. IX toimub Austrias Linzis "Ars Electronica" festival, mille teema on "Code - The Language of Our Time". Festivali kavast, osalejatest, ava-performance'ist "Europe - A Symphonic Vision", näitusest "Cyberarts 2003. Prix Ars Electronica"

  13. ARABIC LIGHT STEMMER (ARS

    Directory of Open Access Journals (Sweden)

    ASMA AL-OMARI

    2014-12-01

    Full Text Available Stemming is a main step used to process textual data. It is usually used in several types of applications such as: text mining, information retrieval (IR, and natural language processing (NLP. A major task in stemming is to standardize words; which can be achieved by reducing each word to its base (root or stem. Arabic stemming is not an easy task. Unlike other languages, Arabic language is a highly inflected language, since it uses many inflectional forms. Researchers are divided on the benefit of using stemming in fields of IR, NLP...etc., since in Arabic the morphological variants of a certain word are not always semantically related. The aim of this paper is to design and implement a new Arabic light stemmer (ARS which is not based on Arabic root patterns. Instead, it depends on well defined mathematical rules and several relations between letters. A series of tests were conducted on ARS stemmer to compare its effectiveness with the effectiveness of two other Arabic stemmers. Test shows clearly the effectiveness superiority of ARS compared to effectiveness of these two Arabic stemmers.

  14. 40Ar retention in the terrestrial planets.

    Science.gov (United States)

    Watson, E Bruce; Thomas, Jay B; Cherniak, Daniele J

    2007-09-20

    The solid Earth is widely believed to have lost its original gases through a combination of early catastrophic release and regulated output over geologic time. In principle, the abundance of 40Ar in the atmosphere represents the time-integrated loss of gases from the interior, thought to occur through partial melting in the mantle followed by melt ascent to the surface and gas exsolution. Here we present data that reveal two major difficulties with this simple magmatic degassing scenario--argon seems to be compatible in the major phases of the terrestrial planets, and argon diffusion in these phases is slow at upper-mantle conditions. These results challenge the common belief that the upper mantle is nearly degassed of 40Ar, and they call into question the suitability of 40Ar as a monitor of planetary degassing. An alternative to magmatism is needed to release argon to the atmosphere, with one possibility being hydration of oceanic lithosphere consisting of relatively argon-rich olivine and orthopyroxene. PMID:17882213

  15. Ecologism in Interior Design

    OpenAIRE

    Ruizhou Liu; Yunkai Xu

    2008-01-01

    With the progress of our mankind, great changes have taken place in economy as well as our society, so have the natural environment and ecological system in which we live. Nowadays, we are faced with decreasing natural environment, forest, species, clean water, air and cultivable land. In addition, some urgent issues such as global warming, exhausted energy and widespread rubbish force us to reflect on our future life style. In this situation, interior designers are expected to introduce ecol...

  16. Spectroanalytical investigations on inductively coupled N2/Ar and Ar/Ar high frequency plasmas

    International Nuclear Information System (INIS)

    In order to improve the detection limits of trace elements in corrosion products of metallic materials, the inductively coupled plasma excitation source (ICP) was applied for spectroscopic analysis. Besides optimizing the working conditions for the mentioned materials, the fundamental research clearing the excitation processes in ICP was carried out. Basicly, two plasma systems were investigated: the nitrogen cooled N2/Ar- and pure Ar/Ar-plasma. The computed detection limits for 8 chosen elements are between 0.1 and 50 μg ml-1 in both plasmas. The advantage of ion lines was clearly present; in N2/Ar-plasma it was larger than in Ar/Ar-plasma. The excitation temperatures measured with help of ArI, FeI and ZnI lines rise with increasing power and decreasing distance from the induction coil. The distribution of Zn excitation temperature in N2/Ar-plasma as well as the measured N+2 rotational and CN vibrational temperatures indicate, that the toroidal structure of Ar/Ar-plasma is not analogue to the N2/Ar-plasma. The values of the various excitation temperatures (Ar, Fe, Zn) and the differences between the excitation, vibration, rotation and ionization temperatures (Tsub(i) > Tsub(n) = Tsub(vib) > Tsub(rot)) indicate an absence of thermal equilibrium in the concerned system. (orig.)

  17. l977ar.m77t - MGD77 data file for Geophysical data from field activity L-9-77-AR in Arctic from 08/25/1977 to 10/08/1977

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry, magnetics, and gravity data along with transit satellite navigation data was collected as part of field activity L-9-77-AR in Arctic from...

  18. b174ar.m77t - MGD77 data file for Geophysical data from field activity B-1-74-AR in Arctic from 07/13/1974 to 08/30/1974

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry, gravity, and magnetics data along with transit satellite navigation data was collected as part of field activity B-1-74-AR in Arctic from...

  19. Interior of the Moon

    Science.gov (United States)

    Weber, Renee C.

    2013-01-01

    A variety of geophysical measurements made from Earth, from spacecraft in orbit around the Moon, and by astronauts on the lunar surface allow us to probe beyond the lunar surface to learn about its interior. Similarly to the Earth, the Moon is thought to consist of a distinct crust, mantle, and core. The crust is globally asymmetric in thickness, the mantle is largely homogeneous, and the core is probably layered, with evidence for molten material. This chapter will review a range of methods used to infer the Moon's internal structure, and briefly discuss the implications for the Moon's formation and evolution.

  20. The Earth's Magnetic Interior

    CERN Document Server

    Petrovsky, Eduard; Harinarayana, T; Herrero-Bervera, Emilio

    2011-01-01

    This volume combines review and solicited contributions, related to scientific studies of Division I of IAGA presented recently at its Scientific Assembly in Sopron in 2009. The book is aimed at intermediate to advanced readers dealing with the Earth's magnetic field generation, its historical records in rocks and geological formations - including links to geodynamics and magnetic dating, with magnetic carriers in earth materials, electromagnetic induction and conductivity studies of the Earth interior with environmental applications of rock magnetism and electromagnetism. The aim of the book

  1. Geochronology and thermochronology by the 40Ar/39Ar method

    International Nuclear Information System (INIS)

    This work is a response to the authors' belief that there is a need for a monograph on 40Ar/39Ar dating to provide concise knowledge concerning the application of this method to geological studies. They aim to provide a reasonably comprehensive but by no means exhaustive coverage of the principles and practices of 40Ar/39Ar dating, with emphasis on interpretation of results. In attempting to provide an overview of the current state of knowledge, they commonly cite examples from the available literature. They draw rather heavily upon their own work, because they feel comfortable with their own examples. (author)

  2. The lunar interior

    Science.gov (United States)

    Anderson, D. L.; Kovach, R. L.

    1972-01-01

    The compressional velocities are estimated for materials in the lunar interior and compared with lunar seismic results. The lower crust has velocities appropriate for basalts or anorthosites. The high velocities associated with the uppermost mantle imply high densities and a change in composition to a lighter assemblage at depths of the order of 120 km. Calcium and aluminum are probably important components of the upper mantle and are deficient in the lower mantle. Much of the moon may have accreted from material similar in composition to eucrites. The important mineral of the upper mantle is garnet; possible accessory minerals are kyanite, spinel, and rutile. If the seismic results stand up, the high velocity layer in the moon is more likely to be a high pressure form of anorthosite than eclogite, pyroxenite, or dunite. The thickness of the layer is of the order of 50 km. Cosmic abundances can be maintained if the lower mantle is ferromagnesium silicate with minimal amounts of calcium and aluminum. Achondrites such as eucrites and howardites have more of the required characteristics of the lunar interior than carbonaceous chondrites. A density inversion in the moon is a strong possibility.

  3. Geological Dating by 40 Ar - 39 Ar method

    International Nuclear Information System (INIS)

    The isotope 40 K is radioactive, it decays to 40 Ar stable. The number of 40 Ar atoms produced from 40 K, permits to calculate the date of rocks and minerals. This dating technique is named 'Conventional K-Ar Dating Method'. The 40 Ar - 39 Ar dating method permits to calculate the age of rocks and minerals eliminating the limitation of the K-Ar method by calculating potassium and argon concentrations in a single measurement of the ratio of argon isotopes. In this work, the irradiation of the sample with fast neutrons in the nuclear reactor was established. 39 Ar is obtained from the induced reaction 39 K (n,p) 39 Ar. Thus the ration of 40 Ar -39 Ar allows to obtain the date of rocks and minerals. This ratio was measured in a mass spectrometer. If the measurement of argon concentration in the sample is carried out at different increasing temperature values, it is possible to get information of paleotemperatures. The number of atoms 39 Ar is a function of the number 39 K atoms, irradiation time, neutrons flux, its energy E and the capture cross section σ of 39 K. These parameters are calculate indirectly by obtaining the so called 'J value ' by using a standard mineral with known age (HD-BI y Biot-133), this mineral is irradiated together with the unknown age sample. The values of 'J' obtained are in the interval of 2.85 a 3.03 (x 10-3)J/h. Rocks from 'Tres Virgenes' were dated by the method described in this work, showing an agreement with previous values of different authors. The age of this rocks are from Cenozoico era, mainly in the miocene period. (Author)

  4. Ecologism in Interior Design

    Directory of Open Access Journals (Sweden)

    Ruizhou Liu

    2008-01-01

    Full Text Available With the progress of our mankind, great changes have taken place in economy as well as our society, so have the natural environment and ecological system in which we live. Nowadays, we are faced with decreasing natural environment, forest, species, clean water, air and cultivable land. In addition, some urgent issues such as global warming, exhausted energy and widespread rubbish force us to reflect on our future life style. In this situation, interior designers are expected to introduce ecological ideas into their design to push it to a higher and advanced level, which will consequently promote the transformation of the employment of resources in architecture from the consumptive type to the recycled one.

  5. 40Ar/39Ar age calibration against counted annuallayers

    DEFF Research Database (Denmark)

    Storey, Michael; Stecher, Ole

    2008-01-01

    The 40Ar/39Ar method, based on the decay of the naturally occurring radioactive isotope 40K, is capable of producing ages with precision better than ± 0.1 %. However, accuracy is limited to no better than 1 % mainly due to the relatively large uncertainty in the 40K decay constants. One approach...

  6. Interior design and healing architecture

    DEFF Research Database (Denmark)

    Mogensen, Jeppe; Poulsen, Søren Bolvig; Hansen, Allan Grutt

    2015-01-01

    and materials are rather limited. To compliment research in hospital interior design with particular focus on the use of interior textiles, this pilot study explores if the patients’ preferences for more home-like hospital interiors can be linked to a preference for textile-based furniture and...... materials. Through a mixed-method study, 43 patients from the outpatient-lung department at Hospital Vendsyssel, Denmark were presented with different types of furniture and materials and were asked about their preferences. Additional questions on their experience of the hospital interior were asked to...... guide the interpretation of the quantitative and qualitative data. 21% of the participants requested interior design improvements, and had a pronounced preference for the textile-based furniture and materials. For this particular group, the link between home-like hospital interiors and textile materials...

  7. Interior design conceptual basis

    CERN Document Server

    Sully, Anthony

    2015-01-01

    Maximizing reader insights into interior design as a conceptual way of thinking, which is about ideas and how they are formulated. The major themes of this book are the seven concepts of planning, circulation, 3D, construction, materials, colour and lighting, which covers the entire spectrum of a designer’s activity. Analysing design concepts from the view of the range of possibilities that the designer can examine and eventually decide by choice and conclusive belief the appropriate course of action to take in forming that particular concept, the formation and implementation of these concepts is taken in this book to aid the designer in his/her professional task of completing a design proposal to the client. The purpose of this book is to prepare designers to focus on each concept independently as much as possible, whilst acknowledging relative connections without unwarranted influences unfairly dictating a conceptual bias, and is about that part of the design process called conceptual analysis. It is assu...

  8. The 38Ar(p,d)37Ar reaction

    International Nuclear Information System (INIS)

    The 38Ar(p,d)37Ar reaction has been used to study the properties of the high-lying positive parity states in 37Ar. Angular distributions in the region thetasub(c.m.)=160-1320 have been analyzed using the DWBA code DWUCK to determine the spectroscopic properties of these states. The two lowest T=3/2 states have been identified at 4.98MeV (3/2+) and 6.65MeV (1/2+). The results are compared to recent shell-model calculations; their significance for the solar neutrino experiment is also discussed. (Auth.)

  9. 40Ar-39Ar geochronology and thermochronology: principles and potential

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well-established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in poly deformed specimens

  10. Electron scattering from 36Ar and 40Ar

    International Nuclear Information System (INIS)

    The argon isotopes, 36Ar and 40Ar, have been investigated using electron scattering at the high-resolution Linac facilities of the National Bureau of Standards. Both elastic scattering and scattering to low-lying states have been observed. A high-pressure, low-volume gas target cell was designed and developed for this experiment. The cell features a transmission geometry and has resolution comparable to solid targets. Spectra were obtained at incident beam energies ranging from 65 to 115 MeV at scattering angles of 92.50 and 1100. Values obtained for the rms charge radii are 3.327 +- 0.015 and 3.393 +- 0.015 fm for 36Ar and 40Ar respectively. A sensitive measurement was made of the difference in the two radii yielding a value of Δ r = 0.079 +- 0.006 fm. The inelastic levels observed are the 1.97 (2+) and 4.18 MeV (3-) levels in 36Ar, and the 1.46 (2+), 2.52 (2+), 3.21 (2+), and 3.68 MeV (3-) levels in 40Ar. A Tassie model analysis was made of the inelastic transitions in the DWBA approximation and transition strengths of these levels were extracted

  11. Ars Poetica : [luuletused] / Mats Traat

    Index Scriptorium Estoniae

    Traat, Mats, 1936-

    2008-01-01

    Sisu: Ars poetica ; Veepeegel ; Kontrollõed ; Mandariiniriik ; Nikolai Siamashvili (1888-1911) ; Kolmekümne kolmas aasta ; Kiri linast 1966 ; Italmaz Nuriyev ; Rudolf Rimmelile mõeldes ; Gennadi Aigi

  12. Tolerância a agente curarizante provocada pela administração repetida da droga Tolerance to curarizing drug induced by chronic administration: an experimental study

    Directory of Open Access Journals (Sweden)

    Antonio Carlos Zanini

    1974-03-01

    Full Text Available Baseados em teoria discutível segundo a qual a miastenia grave é provocada pela presença no sangue de substância curarizante liberada pelo timo, tentou-se reproduzir um modelo experimental. Foram utilizados 40 ratos, criados nas mesmas condições, nascidos no mesmo dia, pesando ao redor de 350 g e divididos em 4 grupos: o Grupo I não foi manuseado; no Grupo II foi injetada solução fisiológica, 1 ml i.p. durante 6 semanas; no Grupo III foi injetada a dimetil tubocurarina (DMT 2,8 mcg/kg i.p., durante o mesmo tempo; no Grupo IV 14 mcg/kg da mesma droga foram injetados i.p. Uma semana após a última injeção i.p. os ratos, anestesiados, foram preparados para registro neuromuscular. O nervo ciático foi estimulado nas freqüências de 0,33 pulsos/seg, 70 pulsos/seg (séries de 10 pulsos a intervalos de 3 seg, 70 pulsos/seg (mantidos por 15 seg e novamente 0,33 pulsos/seg logo após a tetanização. A dose curarizante de DMT foi determinada por uma "terceira parte cega" quando 80% do bloqueio era alcançado. Quando apenas 10 estímulos em alta freqüência foram aplicados ao nervo, foi observada diferença significativa (pThe trial is a temptative experimental model of myasthenia gravis based on a doubtful theory whereby this disease is atributed to circulating curare in blood. Forty rats kept under the same conditions, bom on the same day and weighing around 350 g entered the trial, divided in four groups. Group I was not handled, Group II was injected with saline, 1 ml i.p. Group III was submitted to dimethyl tubocurarine iodide (DMT 2,8 mcg/kg i.p. and Group IV received 14 mcg/kg, all solutions being administered daily for a six-week period. One week after the last rats were anesthetized and prepared for cyatic-gastrocnemius neuro-muscular recording. Monopolar pulses were given at frequencies of 0.33 p/sec, 70 p/sec, (trains of 10 pulses at 3 sec intervals, 70 p/sec (kept for 15 sec and again 0.33 p/sec right after tetanus. Curarizing

  13. Graviatoms with de Sitter Interior

    Directory of Open Access Journals (Sweden)

    Irina Dymnikova

    2013-01-01

    Full Text Available We present a graviatom with de Sitter interior as a new candidate to atomic dark matter generically related to a vacuum dark energy through its de Sitter vacuum interior. It is a gravitationally bound quantum system consisting of a nucleus represented by a regular primordial black hole (RPBH, its remnant or gravitational vacuum soliton G-lump, and a charged particle. We estimate probability of formation of RPBHs and G-lumps in the early Universe and evaluate energy spectrum and electromagnetic radiation of graviatom which can in principle bear information about a fundamental symmetry scale responsible for de Sitter interior and serve as its observational signatures.

  14. Ar-39-Ar-40 Ages of Two Nakhlites, MIL03346 and Y000593: A Detailed Analysis

    Science.gov (United States)

    Park, Jisun; Garrison, Daniel; Bogard, Donald

    2007-01-01

    Radiometric dating of martian nakhlites by several techniques have given similar ages of approx.1.2-1.4 Ga [e.g. 1, 2]. Unlike the case with shergottites, where the presence of martian atmosphere and inherited radiogenic Ar-40 produce apparent Ar-39-Ar-40 ages older than other radiometric ages, Ar-Ar ages of nakhlites are similar to ages derived by other techniques. However, even in some nakhlites the presence of trapped martian Ar produces some uncertainty in the Ar-Ar age. We present here an analysis of such Ar-Ar ages from the MIL03346 and Y000593 nakhlites.

  15. Mirador - Earth Surface and Interior

    Data.gov (United States)

    National Aeronautics and Space Administration — Earth Science data access made simple. The goal of the Earth Surface and Interior focus area is to assess, mitigate and forecast the natural hazards that affect...

  16. Interior Alaska Bouguer Gravity Anomaly

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 1 kilometer Complete Bouguer Anomaly gravity grid of interior Alaska. Only those grid cells within 10 kilometers of a gravity data point have gravity values....

  17. Interior Alaska Bouguer Gravity Anomaly

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 1 kilometer Complete Bouguer Anomaly gravity grid of interior Alaska. All grid cells within the rectangular data area (from 61 to 66 degrees North latitude and...

  18. Desain Interior Gedung Kesenian Jakarta

    Directory of Open Access Journals (Sweden)

    Sri Rachmayanti

    2011-03-01

    Full Text Available The purpose of this study was to examine the interior design of Gedung Kesenian Jakarta in detail. Another thing is to obtain complete data and analyze the interior design development of GKJ. This study will described in terms of design style and different designs since the early period of this building, the arrival of the Dutch until the present era. Besides aesthetic of interior design, it will review technical factors in the building that related to its interior design, such as acoustic, air conditioning, lighting system, sound system. This research is based on data literartures and interviews with the GKJ. In conclusion, it will discuss the existence of GKJ in relation to local identity, culture and heritage.

  19. REGISTRATION OF BIRDSFOOT TREFOIL GERMPLASM ARS-2622

    Science.gov (United States)

    ARS-2622 broadleafed birdsfoot trefoil (Lotus corniculatus L.) germplasm was released by the USDA-ARS in cooperation with the Missouri Agricultural Experiment Station in August 2002. The merit of ARS-2622 is that it is a rhizome producing population with a broad genetic base. ARS-2622 was developed ...

  20. La temperatura del interior de la tierra

    Directory of Open Access Journals (Sweden)

    Eslava R. Jesús A.

    1993-10-01

    Full Text Available AR-SA;" lang="EN-US">The problem of defining the Earth interior temperature is analized from Heat Flow observations and the acceptance of convection processes in the mantle. Comparative analyses of thermal, adiabatic, and melting point profiles, allow to obtain the optimum temperature profile, wich fits the seismic model of a liquid external core.

    EI problema de definir la temperatura del interior de la Tierra, se analiza a partir de las observaciones del flujo térmico y la aceptación de procesos de convección en el manto.

    Análisis comparativos de perfiles térmicos, adiabáticos y de puntos de fusión, permiten obtener un perfil óptimo de distribución de temperaturas, que además satisface la observación sísmica de un núcleo externo líquido.

  1. Whole-rock Ar-Ar dating for low-grade metavolcanics within the Dabie orogen and its geological significance

    Institute of Scientific and Technical Information of China (English)

    GAO Tianshan; TANG Jiafu; SANG Haiqing; HU Shiling; QIAN Cunchao

    2006-01-01

    The genetic relationship between low- grade and ultrahigh-pressure (UHP) metamorphic units in the interior of the Dabie orogen has been controversial with respect to preservation of volcanic texture during continental subduction to mantle depths. In order to resolve this issue, whole-rock Ar-Ar dating was carried out for greenschist-facies metatuff that is in contact with UHP eclogite in Yuexi County, Anhui Province. One sample gave a plateau age of 784.4±2.0 Ma and an isochron age of 785.0± 4.7 Ma, and the other sample a plateau age of 770.9± 2.0 Ma and an isochron age of 769.5±3.1 Ma. It appears that the Ar isotopic system was not disturbed since the volcanic eruption at the middle Neoproterozoic. Because of the low closure temperature of Ar diffusion in volcanic rocks, retention of the Neoproterozoic ages indicates that the low-grade metavolcanics did not experience high-grade metamorphism up to eclogite-facies conditions during the Triassic subduction of continental crust. Furthermore, the Neoproterozoic Ar-Ar ages are also in agreement with protolith ages of UHP metaigneous rocks in the Dabie orogen. Therefore, the metatuff is interpreted as a tectonic relict that was scraped off during the Triassic subduction and thus was not subducted to mantle depths like the adjacent eclogite. This lends support to the model for crustal detachment between cover and basement during continental collision. A tectonic mélange model is proposed to explain the occurrence of contrasting grades of metamorphic rock within the UHP metamorphic zone.

  2. Analysis list: AR [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available AR Blood,Breast,Prostate + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/AR.1.tsv http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/target/AR.5.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/tar...get/AR.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Blood.tsv,http://dbar...chive.biosciencedbc.jp/kyushu-u/hg19/colo/AR.Breast.tsv,http://dbarchive.biosc...iencedbc.jp/kyushu-u/hg19/colo/AR.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/Blood.gml,http://dbar

  3. Analysis list: Ar [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Ar Gonad,Kidney,Prostate + mm9 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/targe...t/Ar.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/target/Ar.5.tsv http://dbarchive.biosciencedbc.jp/...kyushu-u/mm9/target/Ar.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Ar.Gonad.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/mm9/colo/Ar.Kidney.tsv,http://dbarchive.bioscienced...bc.jp/kyushu-u/mm9/colo/Ar.Prostate.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/colo/Gonad.gml,http://dbarchive.bioscience

  4. A detailed 40Ar/39Ar age study of an Abitibi dike from the Canadian Superior Province

    International Nuclear Information System (INIS)

    40Ar/39Ar step-heating analyses were performed on 11 felsic and mafic mineral separates from a 90m wide Precambrian Shield. Deuterically altered minerals from the dike interior define a primary age of 2150 +- 25 Ma. Updated ages, obtained from felsic separates within 30, and mafic within 1.5 m of the dike border, are evidence of a previously undetected Hudsonian (1.7-1.8 Ga) hydrothermal event in the area. It is possible to distinguish the deuteric from the later hydrothermal alteration by both dating and petrographic methods. The data from this study demonstrate the successful application of 40Ar/39Ar dating to early Proterozoic dikes which have suffered low grade metamorphism. The ages support a north to south sense of motion of the Track 5 apparent polar wander path (APWP). A monotonic decrease in apparent age of felsic spectra indicates reactor induced recoil effects which are correlated with the fine-grained saussurite in the feldspar. (auth)

  5. "Ars Electronica 2009" / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2009-01-01

    30. "Ars Electronica" festival "Human Nature" ("Inimese loomus") Linzis. Osaka ülikooli professori Hiroshi Ishiguro mehaanilis-digitaalsest nukust. Hübriidkunsti kategoorias peapreemia saanud Eduardo Kaci inimtaimest. Konverentsidest. Näitusest "See this Sound", mis oli pühendatud helile kujutavas kunstis

  6. Variational Principle for Planetary Interiors

    CERN Document Server

    Zeng, Li

    2016-01-01

    In the past few years, the number of confirmed planets has grown above 2000. It is clear that they represent a diversity of structures not seen in our own solar system. In addition to very detailed interior modeling, it is valuable to have a simple analytical framework for describing planetary structures. Variational principle is a fundamental principle in physics, entailing that a physical system follows the trajectory which minimizes its action. It is alternative to the differential equation formulation of a physical system. Applying this principle to planetary interior can beautifully summarize the set of differential equations into one, which provides us some insight into the problem. From it, a universal mass-radius relation, an estimate of error propagation from equation of state to mass-radius relation, and a form of virial theorem applicable to planetary interiors are derived.

  7. Dewatering tailings impoundments : interior drains

    International Nuclear Information System (INIS)

    For the design of a new uranium tailings impoundment in the western United States, it was proposed that an interior drainage system be considered to economically and reliably minimize potential short- and long-term environmental impacts. The objectives were to decrease the effective hydraulic head on the clay liner, to dewater and stabilize the tailings, and to increase the amount of water recycled to the mill. In addition, desaturation of the impoundment would induce capillary pressure (negative porewater pressure), further reducing the potential movement of dissolved pollutants. This paper presents saturated and unsaturated seepage principles and reviews the concept, criteria and design of the various interior drainage systems considered

  8. Oldest human footprints dated by Ar/Ar

    Science.gov (United States)

    Scaillet, Stéphane; Vita-Scaillet, Grazia; Guillou, Hervé

    2008-11-01

    Fossilized human trackways are extremely rare in the geologic record. These bear indirect but invaluable testimony of human/hominid locomotion in open air settings and can provide critical information on biomechanical changes relating to bipedalism evolution throughout the primitive human lineage. Among these, the "Devil's footsteps" represent one of the best preserved human footprints suite recovered so far in a Pleistocene volcanic ash of the Roccamonfina volcano (southern Italy). Until recently, the age of these footprints remained speculative and indirectly correlated with a loosely dated caldera-forming eruption that produced the Brown Leucitic Tuff. Despite extensive hydrothermal alteration of the pyroclastic deposit and variable contamination with excess 40Ar, detailed and selective 40Ar/ 39Ar laser probe analysis of single leucite crystals recovered from the ash deposit shows that the pyroclastic layer and the footprints are 345 ± 6 kyr old (1 σ), confirming for the first time that these are the oldest human trackways ever dated, and that they were presumably left by the modern human predecessor, Homo heidelbergensis, close to Climatic Termination IV.

  9. INTERIORITY

    DEFF Research Database (Denmark)

    Hvejsel, Marie Frier

    of furnishing ‘gestures’ requiring of the envelope itself to guide, reveal, cover, caress and embrace us. These ‘gestures’ unite function and emotion by describing at once a physical movement and a feeling which is intrinsic of the spatial envelope itself. - The explanatory level has resulted in the...... Danish prefab housing manufacturer Boel Living A/S. Hence, this cooperation has been the starting point for pursuing a methodological linking of theory and practice, through a number of research loops, moving from theory development to practical application and vice versa. Together the 2 volumes...... signifying our experience of domestic architectural quality applicaple as a critical means within the practical realm of domestic architectural practice. In addition the result of the thesis can be seen as a contribution to a future discussion of the role of the architect in the general domestic...

  10. A qualidade do ar de interiores e a química

    OpenAIRE

    Brickus Leila S. R.; Aquino Neto Francisco R.

    1999-01-01

    In Brazil, very little experimental work on measurements of indoor air pollutant levels has been done. Nowadays, increasing attention is being given to indoor air quality and the health problems associated with buildings and the indoor work environment. The scope of this paper is to review the major pollutants found in indoor environments and their sources. Subsequently, exposure to indoor air pollutants and health effects are considered. The review concludes by briefly addressing assessment ...

  11. AR DOC: Augmented reality documentaries

    DEFF Research Database (Denmark)

    Vistisen, Peter

    2014-01-01

    Augmented Reality Documentaries (AR DOC) er et ’lille’ Shareplay projekt (ansøgte midler <= 125.000 DKK), der af haft som sit formål at afprøve et unikt samarbejde omkring udforskningen af nye teknikker til augmented reality cross media løsninger, til at skabe engagerende publikumsformidling...... indenfor oplevelsesindustrien. Projektet har genereret ny viden omkring, hvordan fysisk og digital formidling kan understøttes via Augmented Reality som formidlingsformat....

  12. ARS - Helsinki - 2006 / Galina Balashova

    Index Scriptorium Estoniae

    Balashova, Galina

    2006-01-01

    Steven Holli projekteeritud Kiasma muuseumihoonest Helsingis. Kontseptuaalkunsti näitusest ARS 06 "Reaalsustunne" Kiasmas. Eestlastest esineb Mark Raidpere. Vene kunstnikegrupi AEC+F ja vene kunstnike Juri Vassiljevi ning Aleksandr Ponomarjovi töödest näitusel. Ka Gerda Steineri & Jörg Lenzlingeri (Šveits), Martin & Munoz'i (USA, Hispaania), arvutigraafik Charles Sandisoni (SB), videokunstnik Bill Viola (USA) jt. töödest

  13. Ars Industrialis, arsindustrialis.org

    Directory of Open Access Journals (Sweden)

    Frédérique Mingant

    2012-03-01

    Full Text Available The arsindustrialis.org website was created in 2005, when the association Ars Industrialis came into being. The association was founded by a group of philosophers and jurists, on the initiative of philosopher Bernard Stiegler, the former director of the IRCAM (Institut de Recherche et Coordination Acoustique/Musique–Institute of Research and Coordination on Acoustic/Music and the current director of the Department of cultural development at the Centre Georges Pompidou (French National Arts C...

  14. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-01-01

    The website arXiv.org (pronounced "archive") is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open…

  15. Functional textiles in hospital interiors

    DEFF Research Database (Denmark)

    Mogensen, Jeppe

    This PhD thesis explores the possibilities and design qualities of using functional textiles in the interior of hospital environments, and is the result of a three years collaboration between Aalborg University, Department of Civil Engineering, and VIA University College, VIA Design. The project is...... overall related to the construction of new Danish hospitals, where the design concept healing architecture is introduced in a national context, representing the vision of a promoted healing process of hospitalised patients, supported by design related influence. Past research studies provides evidence...... that the physical environments affect the patients’ level of stress and influence their process of recovery and healing. However, although research in this field of hospital design has increased substantially in recent years, knowledge on the use of new materials and textiles in hospital interiors is...

  16. Black Hole: The Interior Spacetime

    CERN Document Server

    Ong, Yen Chin

    2016-01-01

    The information loss paradox is often discussed from the perspective of the observers who stay outside of a black hole. However, the interior spacetime of a black hole can be rather nontrivial. We discuss the open problems regarding the volume of a black hole, and whether it plays any role in information storage. We also emphasize the importance of resolving the black hole singularity, if one were to resolve the information loss paradox.

  17. Ars Memorativa, Ars Oblivionis in Middle English Religious Plays

    Directory of Open Access Journals (Sweden)

    Ciobanu Estella Antoaneta

    2015-12-01

    Full Text Available This paper investigates the multi-layered violence of religious representation in the late medieval York biblical plays, with a focus on the Supper at Emmaus. I read Emmaus (Y40, a play which commemorates the Crucifixion and openly encourages strong anti-Judaism, alongside scenes in an early predecessor pageant, The Crucifixion (Y35, within their contemporary devotional and mnemonic practices, i.e. the confessional Book of Margery Kempe and Thomas Bradwardine’s tract on ars memorativa. Emmaus in particular demonstrates how a fundamentally violent ars memorativa, the legacy of ancient rhetoric to the Middle Ages, also underpins the instruction of the laity in the basics of Christian faith, here with the aid of highly musical prosody and repetition, and thereby hones a biased, intolerant and violence-inured Christian collective memory. To study the York play’s position relative to late medieval mnemonic practices, I frame my analysis within memory studies, enriched with the more specific insights offered by social-psychological, neurobiological and cognitivist studies of memory.

  18. Dependence of the measured 38Ar/36Ar ratio on the total Ar amount and its implications

    International Nuclear Information System (INIS)

    The sensitivity of a mass spectrometer for different isotopes of an element usually is not the same and causes a systematic difference between measured and actual isotopic ratios and is defined as mass discrimination. In noble gas mass spectrometry, the correction factor for mass discrimination can be calculated using a reference gas (air in most cases) with known isotopic composition. The mass discrimination factor (mdf) is defined as the ratio of true isotopic ratio to the measured isotopic ratio. Usually, mdf values, determined using argon in air as standard, are nearly constant for a given element over long periods of time. Both mass discrimination and sensitivity remain the same over a certain range of total pressure in the mass spectrometer, during the measurement of a given gas. For the case of Xe, Kr and Ne, in general, the total gas pressure in the mass spectrometer during the analysis of a sample gas falls within this range and consequently, a fixed value of sensitivity and mdf are used. But in the case of argon and particularly in certain cases (like in ureilites), this may not be true as we deal with samples having a wide range of 40Ar/36Ar ratios (10-3 to 104). It was noticed that the values for 38Ar/36Ar in ureilites (having 40Ar/36Ar 40Ar/36Ar = 295.5. This was the motivation for investigating the pressure effect on the measured ratio of 38Ar/36Ar

  19. Beta decay of 31Ar

    International Nuclear Information System (INIS)

    A complete study of 31Ar beta decay has been made by high-resolution charged-particle and gamma-ray spectroscopy. Beta-delayed radiation was detected by an array of three charged-particle detectors and a large-volume germanium detector. Fifteen new energy levels were discovered in 31Cl. The beta-strength distribution, measured to 14.5 MeV, is compared with a shell-model calculation in the full sd space. The quenching of the Gamow-Teller strength and the isospin impurity of the IAS in 31Cl are discussed. (orig.)

  20. 40Ar/39Ar Age Constraints on Caldera Formation of the Emmons Lake Volcanic Center, Alaska Peninsula, Alaska

    Science.gov (United States)

    Drake, J.; Layer, P. W.; Mangan, M. T.; Miller, T. P.; Waythomas, C. F.

    2001-12-01

    The Emmons Lake Volcanic Center located on the Alaska Peninsula is a large shield/stratovolcano complex composed of basaltic to andesitic lava flows and dacite to rhyolite pyroclastic flows, domes and ashfall. Two caldera forming eruptions in Pleistocene time each produced more than 50 cubic kilometers of silicic ejecta and created a nested depression measuring 20 km long and 10 km wide. We conducted 40Ar/39Ar whole rock dating of units associated with the first caldera forming event, which because of broad geochemical similarities, has been suggested as a possible source of the Old Crow Tephra, dated throughout interior Alaska and the Yukon at about 140 ka. Samples dated ranged in composition from ~62 to 69 wt % SiO2 and contained 2 - 3 wt % K2O. For each sample, 15 specimens, consisting of small ( ~1 mm) whole rock chips, were fused with an argon ion laser. From these analyses, weighted mean and isochron ages were calculated. For all samples, the initial 40Ar/36Ar ratio was indistinguishable from that of the present-day atmosphere (295.5), indicating that these samples do not contain significant quantities of excess argon. The age of a welded tuff interpreted to be from the opening plinian phase of the eruption is 233 +/- 6 ka, and is identical to the age of a post-collapse rheomorphic tuff (234 +/- 5 ka). A lithic fragment from a syn-collapse lag breccia has an age of 419 +/- 9 ka, which we interpret as representing incorporation of older material. Younger tuffs and domes were dated at 99 +/- 7 ka and 16 +/- 10 ka and imply that the complex was active throughout the late Quaternary. Based on these new age data, and subtle but significant trace element differences in glass and Fe-Ti oxide composition, we conclude that the first major caldera building event occurred at approximately 230 ka, and is probably not responsible for the deposition of the Old Crow tephra.

  1. Department of the Interior : Bison Conservation Initiative

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This framework for managing bison by the Department of the Interior (DOI) bureaus articulates a basis for improved management of the species and provides a...

  2. k179ar.m77t - MGD77 data file for Geophysical data from field activity K-1-79-AR in Prudhoe Bay, Alaska, Arctic Ocean from 07/23/1979 to 08/20/1979

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-1-79-AR in Prudhoe Bay, Alaska, Arctic Ocean from 07/23/1979...

  3. k281ar.m77t - MGD77 data file for Geophysical data from field activity K-2-81-AR in Arctic from 08/04/1981 to 08/07/1981

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-2-81-AR in Arctic from 08/04/1981 to 08/07/1981,...

  4. k178ar.m77t - MGD77 data file for Geophysical data from field activity K-1-78-AR in Barrows to Pt. Barrows, Arctic from 08/18/1978 to 09/18/1978

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-1-78-AR in Barrows to Pt. Barrows, Arctic from 08/18/1978 to...

  5. k180ar.m77t - MGD77 data file for Geophysical data from field activity K-1-80-AR in Arctic from 07/18/1980 to 08/19/1980

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-1-80-AR in Arctic from 07/18/1980 to 08/19/1980,...

  6. k283ar.m77t - MGD77 data file for Geophysical data from field activity K-2-83-AR in Arctic and Beaufort Sea, Alaska from 08/05/1983 to 08/22/1983

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-2-83-AR in Arctic and Beaufort Sea, Alaska from 08/05/1983 to...

  7. k382ar.m77t - MGD77 data file for Geophysical data from field activity K-3-82-AR in Arctic from 08/25/1982 to 09/08/1982

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-3-82-AR in Arctic from 08/25/1982 to 09/08/1982,...

  8. k183ar.m77t - MGD77 data file for Geophysical data from field activity K-1-83-AR in Arctic from 07/22/1983 to 08/03/1983

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-1-83-AR in Arctic from 07/22/1983 to 08/03/1983,...

  9. l678ar.m77t - MGD77 data file for Geophysical data from field activity L-6-78-AR in Arctic from 08/26/1978 to 09/20/1978

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry and gravity data along with DGPS navigation data was collected as part of field activity L-6-78-AR in Arctic from 08/26/1978 to 09/20/1978,...

  10. l676ar.m77t - MGD77 data file for Geophysical data from field activity L-6-76-AR in Arctic from 08/27/1976 to 09/03/1976

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry, gravity, and magnetic data along with DGPS navigation data was collected as part of field activity L-6-76-AR in Arctic from 08/27/1976 to...

  11. k176ar.m77t - MGD77 data file for Geophysical data from field activity K-1-76-AR in Arctic from 07/24/1976 to 09/26/1976

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with DGPS navigation data was collected as part of field activity K-1-76-AR in Arctic from 07/24/1976 to 09/26/1976,...

  12. Ars discendi, ars docendi : programme Pascal

    OpenAIRE

    Goyet, Thérèse

    2016-01-01

    Le latin de l’intitulé, c’est pour le plaisir, mais on peut lui donner quelques autres justifications. Ars évoque tout à la fois le savoir‑faire, le talent, la compétence professionnelle, le goût de la solution élégante. La parataxe permet le va-et-vient entre le thème et le prédicat (sujet et attribut). On interprétera au choix : savoir étudier, c’est savoir enseigner. Ou : pour apprendre, il faut enseigner ; ou : l’enseignement consiste en étude ; et d’autres variations communes sur une vér...

  13. 40Ar/39Ar dating of the Late Cretaceous

    International Nuclear Information System (INIS)

    As part of the wider European GTS Next project, I propose new constraints on the ages of the Late Cretaceous, derived from a multitude of geochronological techniques, and successful stratigraphic interpretations from Canada and Japan. In the Western Canada Sedimentary Basin, we propose a new constraint on the age of the K/Pg boundary in the Red Deer River section (Alberta, Canada). We were able to cyclo-stratigraphically tune sediments in a non-marine, fluvial environment utilising high-resolution proxy records suggesting a 11-12 precession related cyclicity. Assuming the 40Ar/39Ar method is inter-calibrated with the cyclo-stratigraphy, the apparent age for C29r suggests that the K/Pg boundary falls between eccentricity maxima and minima, yielding an age of the C29r between 65.89 ± 0.08 and 66.30 ± 0.08 Ma. Assuming that the bundle containing the coal horizon represents a precession cycle, the K/Pg boundary is within the analytical uncertainty of the youngest zircon population achieving a revised age for the K/Pg boundary as 65.75 ± 0.06 Ma. The Campanian - Maastrichtian boundary is preserved in the sedimentary succession of the Horseshoe Canyon Formation and has been placed 8 m below Coal nr. 10. Cyclo-stratigraphic studies show that the formation of these depositional sequences (alternations) of all scales are influenced directly by sea-level changes due to precession but more dominated by eccentricity cycles proved in the cyclo-stratigraphic framework and is mainly controlled by sand horizons, which have been related by auto-cyclicity in a dynamic sedimentary setting. Our work shows that the Campanian - Maastrichtian boundary in the Western Canada Sedimentary Basin coincides with 2.5 eccentricity cycles above the youngest zircon age population at the bottom of the section and 4.9 Myr before the Cretaceous - Palaeogene boundary (K/Pg), and thus corresponds to an absolute age of 70.65 ± 0.09 Ma producing an 1.4 Myr younger age than recent published ages

  14. State Skill Standards: Housing and Interior Design

    Science.gov (United States)

    Nevada Department of Education, 2008

    2008-01-01

    Meeting the Housing and Interior Design Standards will provide students with skills for personal family life and towards becoming a professional in the interior design field. The mission of Housing and Interior Design education is to prepare students for family life, work life, and careers in the fashion industry by creating opportunities to…

  15. 24 CFR 3280.108 - Interior passage.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Interior passage. 3280.108 Section... DEVELOPMENT MANUFACTURED HOME CONSTRUCTION AND SAFETY STANDARDS Planning Considerations § 3280.108 Interior passage. (a) Interior doors having passage hardware without a privacy lock, or with a privacy lock...

  16. Dating blueschist metamorphism: a combined 40Ar/39Ar and electron microprobe approach

    International Nuclear Information System (INIS)

    40Ar/39Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of 40Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (3140 to 4500C), however, is close to the estimated peak metamorphic temperatures (3250 +- 500C), suggesting that phengite 40Ar/39Ar plateau dates may coincide closely with the time of blueschist metamorphism. (author)

  17. p194ar.m77t and p194ar.h77t: MGD77T data and header files for single-beam bathymetry data for field activity P-1-94-AR in Arctic Ocean from 07/25/1994 to 08/30/1994

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with SINS navigation data was collected as part of the U.S. Geological Survey cruise P-1-94-AR. The cruise was conducted in...

  18. k185ar.m77t and k185ar.h77t: MGD77T data and header files for single-beam bathymetry data for field activity K-1-85-AR in the Arctic from 09/04/1985 to 09/04/1985

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Single-beam bathymetry data along with SINS navigation data was collected as part of the U.S. Geological Survey cruise K-1-85-AR. The cruise was conducted in the...

  19. Triaxial superdeformation in $^{40}$Ar

    CERN Document Server

    Taniguchi, Yasutaka; Kimura, Masaaki; Ikeda, Kiyomi; Horiuchi, Hisashi; Ideguchi, Eiji

    2010-01-01

    Superdeformed (SD) states in $^{40}$Ar have been studied using the deformed-basis antisymmetrized molecular dynamics. Low energy states were calculated by the parity and angular momentum projection (AMP) and the generator coordinate method (GCM). Basis wave functions were obtained by the energy variation with a constraint on the quadrupole deformation parameter $\\beta$, while other quantities such as triaxiality $\\gamma$ were optimized by the energy variation. By the GCM calculation, an SD band is obtained just above the ground state band. The SD band involves a $K^\\pi = 2^+$ side band due to the triaxiality. The calculated quadrupole electric transition strengths of the SD band reproduce well the experimental values. Triaxiality is significantly important to understand low-lying states.

  20. Ars grammatica de Dionisio Tracio

    Directory of Open Access Journals (Sweden)

    Beltrán Jorge Enrique

    2003-06-01

    Full Text Available

    Ars Grammatica de Dionisio Tracio (170-90 a. C fue la primera gramática griega que se escribió. Su contenido y método fueron modelos que siguieron las gramáticas escolares posteriores. La versión española que se presenta ahora responde a la necesidad que se tenía en nuestro medio de una traducción completa de este texto. Finalmente, se acompaña la traducción de una introducción y de abundantes notas, en un intento por hacerla comprensible para el hablante del español, no necesariamente conocedor de la lengua griega.

  1. Spatial heterogeneity in the radiogenic activity of the lunar interior: Inferences from CHACE and LLRI on Chandrayaan-1

    CERN Document Server

    Sridharan, R; Ahmed, S M; Supriya, Gogulapati; Bhardwaj, Anil; Kamalakar, J A; 10.1016/j.asr.2012.08.005

    2013-01-01

    In the past, clues on the potential radiogenic activity of the lunar interior have been obtained from the isotopic composition of noble gases like Argon. Excess Argon (40) relative to Argon (36), as compared to the solar wind composition, is generally ascribed to the radiogenic activity of the lunar interior. Almost all the previous estimates were based on, 'on-the-spot' measurements from the landing sites. Relative concentration of the isotopes of 40Ar and 36Ar along a meridian by the Chandra's Altitudinal Composition Explorer (CHACE) experiment, on the Moon Impact Probe (MIP) of India's first mission to Moon, has independently yielded clues on the possible spatial heterogeneity in the radiogenic activity of the lunar interior in addition to providing indicative 'antiquity' of the lunar surface along the ground track over the near side of the moon. These results are shown to broadly corroborate the independent topography measurements by the Lunar Laser Ranging Instrument (LLRI) in the main orbiter Chandrayaa...

  2. Volatiles in Earths interior (Invited)

    Science.gov (United States)

    Keppler, H.

    2010-12-01

    much more water than chlorine and therefore become concentrated. From available data on the salinities of fluids released from the slab and the Cl/H2O ratio in primitive melt inclusions from arc volcanoes, we can estimate that the ratio of rock to fluid that must have reached chemical equilibrium must exceed 1000, implying that fluids percolate by pervasive flow through the mantle wedge. The relative abundance of noble gases on Earth, particularly the depletion of Xe relative to Ar must be due to some process occurring very early in Earth history. We show new experimental results (Shcheka & Keppler, in prep.) that demonstrate that argon is highly compatible in MgSiO3 perowskite, with concentrations reaching more than 1 wt. % at 24 GPa and 1600 C, while xenon solubility is negligible. We therefore suggest that during the crystallization of a magma ocean, argon was preferentially incorporated into perovskite, while most noble gases from the atmosphere were lost to space. Mantle convection later released argon, but not xenon from the deep mantle to the surface and therefore produced the high Ar/Xe ratio in Earths atmosphere. The depletion of Xe relative to Ar is therefore likely to be characteristic for a planet that underwent fractionation of silicate perovskite from a magma ocean.

  3. Development and Applications of Interior Tomography - Multi-source Interior Tomography for Ultrafast Performance

    OpenAIRE

    Wang, Ge; Ritman, Erik; Ye, Yangbo; Katsevich, Alexander; Yu, Hengyong; Cao, Guohua; Zhou, Otto

    2010-01-01

    Conventional tomography allows excellent reconstruction of an object from non-truncated projections. The long-standing interior problem is to reconstruct an interior ROI accurately only from local projection segments. Interior tomography solves the interior problem with practical knowledge such as a known sub-region or a sparsity model using compressive sensing. Advantages of interior tomography include radiation dose reduction (no x-rays go outside an ROI), scattering artifact suppression (n...

  4. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharge

    Directory of Open Access Journals (Sweden)

    Euclides Alexandre Bernardelli

    2011-12-01

    Full Text Available Stearic acid (CH3(CH216COOH was treated with Ar and Ar-O2 (10% pulsed DC discharges created by a cathode-anode confined system to elucidate the role of oxygen in plasma cleaning. The treatment time (5 to 120 minutes and plasma gas mixture (Ar and Ar-O2 were varied, and the results showed that the mass variation of stearic acid after Ar-O2 plasma exposure was greater than that of pure Ar plasma treatment. Thus, compared to Ar*, active oxygen species (O and O2, in all states enhance the etching process, regardless of their concentration. During the treatments, a liquid phase developed at the melting temperature of stearic acid, and differential thermal analyses showed that the formation of a liquid phase was associated with the breakage of bonds due to treatment with an Ar or Ar-O2 plasma. After treatment with Ar and Ar-O2 plasmas, the sample surface was significantly modified, especially when Ar-O2 was utilized. The role of oxygen in the treatment process is to break carbonaceous chains by forming oxidized products and/or to act as a barrier again ramification, which accelerates the etching of stearic acid.

  5. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  6. The Coronae of AR Lac

    CERN Document Server

    Huenemoerder, D P; Drake, J J; Sanz-Forcada, J; Canizares, Claude R.; Drake, Jeremy J.; Huenemoerder, David P.; Sanz-Forcada, Jorge

    2003-01-01

    We observed the coronally active eclipsing binary, AR Lac, with the High Energy Transmission Grating on Chandra for a total of 97 ks, spaced over five orbits, at quadratures and conjunctions. Contemporaneous and simultaneous EUV spectra and photometry were also obtained with the Extreme Ultraviolet Explorer. Significant variability in both X-ray and EUV fluxes were observed, dominated by at least one X-ray flare and one EUV flare. We saw no evidence of primary or secondary eclipses. X-ray flux modulation was largest at high temperature, indicative of flare heating of coronal plasma. Line widths interpreted in terms of Doppler broadening suggest that both binary stellar components are active. From line fluxes obtained from total integrated spectra, we have modeled the emission measure and abundance distributions. A strong maximum was found in the differential emission measure, characterized by peaks at log T = 6.9 and 7.4, together with a weak but significant cooler maximum near log T=6.2, and a moderately str...

  7. Interior insulation in existing; Innendaemmung im Bestand

    Energy Technology Data Exchange (ETDEWEB)

    Geburtig, Gerd (ed.)

    2010-07-01

    Within the third expert meeting of the regional German group of the International Association for Science and Technology of Building and Maintenance and Monuments Preservation (WTA, Pfaffenhofen, Federal Republic of Germany) in November 2009 in Weimar (Federal Republic of Germany) the following lectures were held: (a) Interior insulation according to WTA - The leaflet 6-4 (Anatol Worch); (b) Dimensioning of interior insulation (Hartwig M. Kuenzel); (c) Interior insulation in the field of monument conservation (Roswitha Kaiser); (d) Possibilities of interior insulation (Frank Essmann); (e) Interior insulation - everything considered? (Uwe Gronau); (f) Interior insulation - considered under another view (Georg Dittie); (g) Built practice - this is it (Manuela Kramp); (h) Some practical considerations (Klaus Graupner).

  8. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    CERN Document Server

    Zellner, N E B

    2015-01-01

    Lunar impact glasses, quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. Based on the relationships presented in this paper, lunar impact glasses with compositions and sizes sufficient to have retained 90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integra...

  9. Effects of shock pressure on 40Ar-39Ar radiometric age determinations

    International Nuclear Information System (INIS)

    The relation of shock to the drop in the 40*Ar/39*Ar ratio seen at high release temperatures in some neutron-irradiated lunar samples is investigated through measurements of the 40*Ar/39*Ar ratio in gas samples released by stepwise heating of rock samples previously subjected to shock, either in the laboratory or in nature. Explosives were used to shock solid pieces and powder of a basalt from a diabase dike in Liberia to calculated pressures of 65, 150 and 270 kbar. These, an unshocked sample of the powder, two naturally shocked samples from the Brent impact crater in Canada, one unshocked sample from near the crater, and appropriate monitors were irradiated. Ar from stepwise heating was analyzed. The unshocked basalt shows a good 40*Ar/39*Ar plateau at age 198 +-9 m.y. in agreement with a previous result of 186 +- 2 m.y. The shocked samples contain varying amounts of implanted atmospheric Ar, the isotopes of which have experienced mass fractionation. This effect is small enough in four samples so that the linearity of their graphs of 39*Ar/40Ar vs 36Ar/40Ar is evidence of a plateau. The ages of these samples are then 201 +- 10, 205 +- 12 and 201 +-9 m.y. It appears that the shock has had little effect on the 40Ar-39Ar age spectrum, although the release patterns of the 39*Ar are shifted downward by the order of 2000C. Shock implantation of Ar was at lower shock pressure, in the presence of less Ar, and into a less porous material than previously demonstrated. The Brent Crater samples do not all show good plateaus, but do indicate an age of 420 m.y. for the crater event and 795 +- 24 m.y. for the rock formation, in agreement with previous results. None of the 40*Ar/39*Ar profiles shows a drop at high temperature, but a possible role of shock implantation of Ar is indicated in the production of this effect. Further experiments are suggested. (author)

  10. Architecture, or the Presence of an Interior

    OpenAIRE

    Hedrick, Martin Joseph

    2014-01-01

    An object or thing with no interiority is sculpture. Architecture begins with the making of an interior. The real character of Architecture is revealed in the distinguishing qualities of the interior: the arrangement of spaces, the heights of the ceilings and the placement of walls, the entrance of light, the colors, the textures, the patterns and the surfaces. Emphasis on and development of these formal elements elevates a work from the world of building into the realm of Architecture. The s...

  11. AR-40 AR-39 Age of an Impact-Melt Lithology in DHOFAR 961

    Science.gov (United States)

    Frasl, B.; Cohen, B. A.; Li, Z.-H.; Jolliff, B.; Korotev, R.; Zeigler, R.

    2016-01-01

    The South Pole-Aitken (SPA) basin is the stratigraphically oldest identifiable lunar basin and is therefore one of the most important targets for absolute age-dating to help understand whether ancient lunar bombardment history smoothly declined or was punctuated by a cataclysm. The SPA basin also has another convenient property, a geochemically distinct interior, unobscured by extensive mare basalt fill. A case has been made for the possible origin of the Dhofar 961 lunar meteorite in the South Pole-Aitken (SPA) basin, based on comparing its composition with Lunar Prospector gamma-ray data for the interior of the SPA basin. Dhofar 961 contains several different impact-melt (IM) lithologies. Jolliff et al. described two classes of mafic impact-melt lithologies, one dominated by olivine (Lithology A) and the other by plagioclase (An 95-96.5) (Lithology B). Broad-beam analyses of these lithologies yielded (is) approximately 14.0 wt% FeO, 11.7 wt% MgO, and 15.4 wt% Al2O3. Lithologies A and B differ by approximately 2.5% Al2O3, 1.5% FeO and 1.5% MgO, consistent with the occurrence of olivine phenocrysts in A and plagioclase clasts in B. Both lithologies are considerably more mafic than the Apollo mafic impact-melt breccias, corresponding to olivine gabbronorite. Joy et al. used U-Pb dating to investigate phosphate fragments in the Dhofar 961 matrix and impact-melt clasts. Matrix phosphates have 4.34 to 4 Ga ages, consistent with ancient KREEP-driven magmatic episodes and Pre-Nectarian ((is) greater than 3.92 Ga). Phosphates found within Dhofar 961 crystalline impact melt breccia clasts range from 4.26 to 3.89 Ga, potentially recording events throughout the basin forming epoch of lunar history. The youngest reset ages in the Dhofar 961 sample represent an upper limit for the time of formation of the meteorite. Joy et al suggested this age represents the final impact that mixed and consolidated several generations of precursor rocks into the Dhofar meteorite group

  12. 40Ar/39Ar laser-probe dating of diamond inclusions from the Premier kimberlite

    International Nuclear Information System (INIS)

    Inclusions encapsulated by diamonds at the time of their formation provide a means for determining diamond crystallization ages and the chemistry of the surrounding upper mantle at that time. Sm-Nd studies of peridotitic inclusions, from Cretaceous-age kimberlites in southern Africa, suggest that the diamonds formed 3.3 Gyr ago. By contrast, eclogite-suite inclusions generally yield younger ages, sometimes approaching the time of kimberlite eruption. Here we report the results of 40Ar/39Ar laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds, which yield a mean age of 1,198±14 Myr. This age agrees well with Sm-Nd and 40Ar/39Ar analyses on similar Premier inclusions, and is indistinguishable from the inferred time of emplacement of the host kimberlite (1,150-1,230 Myr), which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated non-radiogenic 40Ar/36Ar ratio of 334±102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source (40Ar/36Ar>20,000). Pre-entrapment equilibration of the inclusions with an 36Ar-rich fluid is the most probable explanation for the low non-radiogenic (40Ar/36Ar) composition. (author)

  13. 40Ar/39Ar ages of lunar impact glasses: Relationships among Ar diffusivity, chemical composition, shape, and size

    Science.gov (United States)

    Zellner, N. E. B.; Delano, J. W.

    2015-07-01

    Lunar impact glasses, which are quenched melts produced during cratering events on the Moon, have the potential to provide not only compositional information about both the local and regional geology of the Moon but also information about the impact flux over time. We present in this paper the results of 73 new 40Ar/39Ar analyses of well-characterized, inclusion-free lunar impact glasses and demonstrate that size, shape, chemical composition, fraction of radiogenic 40Ar retained, and cosmic ray exposure (CRE) ages are important for 40Ar/39Ar investigations of these samples. Specifically, analyses of lunar impact glasses from the Apollo 14, 16, and 17 landing sites indicate that retention of radiogenic 40Ar is a strong function of post-formation thermal history in the lunar regolith, size, and chemical composition. This is because the Ar diffusion coefficient (at a constant temperature) is estimated to decrease by ∼3-4 orders of magnitude with an increasing fraction of non-bridging oxygens, X(NBO), over the compositional range of most lunar impact glasses with compositions from feldspathic to basaltic. Based on these relationships, lunar impact glasses with compositions and sizes sufficient to have retained ∼90% of their radiogenic Ar during 750 Ma of cosmic ray exposure at time-integrated temperatures of up to 290 K have been identified and are likely to have yielded reliable 40Ar/39Ar ages of formation. Additionally, ∼50% of the identified impact glass spheres have formation ages of ⩽500 Ma, while ∼75% of the identified lunar impact glass shards and spheres have ages of formation ⩽2000 Ma. Higher thermal stresses in lunar impact glasses quenched from hyperliquidus temperatures are considered the likely cause of poor survival of impact glass spheres, as well as the decreasing frequency of lunar impact glasses in general with increasing age. The observed age-frequency distribution of lunar impact glasses may reflect two processes: (i) diminished

  14. Ar-40/Ar-39 laser-probe dating of diamond inclusions from the Premier kimberlite

    Science.gov (United States)

    Phillips, D.; Onstott, T. C.; Harris, J. W.

    1989-01-01

    The results of Ar-40/Ar-39 laser-probe analyses of individual eclogitic clinopyroxene inclusions from Premier diamonds are reported which yield a mean age of 1198 + or - 14 Myr. This age agrees well with Sm-Nd and Ar-40/Ar-39 analyses on similar Premier inclusions and is indistinguishable from the inferred time of emplacement of the host kimberlite, which implies that diamond formation was essentially synchronous with kimberlite generation. The extrapolated nonradiogenic Ar-40/Ar-36 ratio of 334 + or - 102 is similar to the present-day atmospheric composition. This value is inconsistent with Sr and Nd isotopic signatures from Premier eclogite inclusions, which suggest a depleted mantle source. Preentrapment equilibration of the inclusions with an Ar-36-rich fluid is the most probable explanation for the low nonradiogenic composition.

  15. 39Ar-40Ar systematics of two millimeter-sized rock fragments from Mare Crisium

    International Nuclear Information System (INIS)

    Two small fragments, L24B, a glass-rich agglutinate (1.9mg) and L24A, a fine-grained lithic fragment (9.4mg), from the Luna 24 landing site have been neutron irradiated for the purpose of 39Ar-40Ar dating. A fairly well-defined 39Ar-40Ar plateau age of 3.65+-0.12 AE was found for the larger fragment. After appropriate corrections the composition of the trapped and spallogenic Ar could be deciphered. The evolution of 38Arsub(sp)/37Ar showed that 660 m.y. and 500 m.y. were the most reliable exposure ages for L24A and L24B, respectively. The Ti contents of <=0.6% determined by gamma-counting prior to the Ar analysis indicate both fragments being associated with the group of low-Ti or even very low-Ti basalts. (Auth.)

  16. 39Ar/Ar measurements using ultra-low background proportional counters

    Energy Technology Data Exchange (ETDEWEB)

    Hall, Jeter C.; Aalseth, Craig E.; Bonicalzi, Ricco; Brandenberger, Jill M.; Day, Anthony R.; Humble, Paul H.; Mace, Emily K.; Panisko, Mark E.; Seifert, Allen

    2016-01-08

    Age dating groundwater and seawater using 39Ar/Ar ratios is an important tool to understand water mass flow rates and mean residence time. For modern or contemporary argon, the 39Ar activity is 1.8 mBq per liter of argon. Radiation measurements at these activity levels require ultra low-background detectors. Low-background proportional counters have been developed at Pacific Northwest National Laboratory. These detectors use traditional mixtures of argon and methane as counting gas, and the residual 39Ar from commercial argon has become a predominant source of background activity in these detectors. We demonstrated sensitivity to 39Ar by using geological or ancient argon from gas wells in place of commercial argon. The low level counting performance of these proportional counters is then demonstrated for sensitivities to 39Ar/Ar ratios sufficient to date water masses as old as 1000 years.

  17. arXiv.org and Physics Education

    Science.gov (United States)

    Ramlo, Susan

    2007-09-01

    The website arXiv.org (pronounced archive) is a free online resource for full-text articles in the fields of physics, mathematics, computer science, nonlinear science, and quantitative biology that has existed for about 15 years. Available directly at http://www.arXiv.org, this e-print archive is searchable. As of Jan. 3, 2007, arXiv had open access to 401,226 e-prints in the topic areas. Those who sign up for an ID and password can also sign up for daily submission abstract emails for specific subject classes of arXiv, including physics education, physics and society, and history of physics. Founded and developed by Paul Ginsparg when he was at Los Alamos National Laboratory, arXiv's original name was the LANL preprint archive or xxx.lanl.gov. The location and name changed after Ginsparg moved to the physics department at Cornell University. Today, arXiv is hosted and operated by Cornell University library. Mirror sites for arXiv exist worldwide.2

  18. On mechanism of Ar(3p54p) states excitation in low-energy Ar-Ar collisions

    International Nuclear Information System (INIS)

    The present work is devoted to study of Ar(3p54p) states excitation in binary low-energy Ar-Ar collisions. The results of the experimental investigation of excitation cross sections of Ar I 4p'[l/2]1, 4p'[3/2]1, 4p'[3/2]2 and 4p[3/2]2 levels in the collision energy range from threshold up to 500 eV (cm) and degree of polarization for 4s[3/2]20-4p'[l/2]1 and 4s[3/2]20-4p[3/2]2 transitions in this energy range are represented.

  19. Orbits and Interiors of Planets

    Science.gov (United States)

    Batygin, Konstantin

    2012-05-01

    The focus of this thesis is a collection of problems of timely interest in orbital dynamics and interior structure of planetary bodies. The first three chapters are dedicated to understanding the interior structure of close-in, gaseous extrasolar planets (hot Jupiters). In order to resolve a long-standing problem of anomalously large hot Jupiter radii, we proposed a novel magnetohydrodynamic mechanism responsible for inflation. The mechanism relies on the electro-magnetic interactions between fast atmospheric flows and the planetary magnetic field in a thermally ionized atmosphere, to induce electrical currents that flow throughout the planet. The resulting Ohmic dissipation acts to maintain the interior entropies, and by extension the radii of hot Jupiters at an enhanced level. Using self-consistent calculations of thermal evolution of hot Jupiters under Ohmic dissipation, we demonstrated a clear tendency towards inflated radii for effective temperatures that give rise to significant ionization of K and Na in the atmosphere, a trend fully consistent with the observational data. Furthermore, we found that in absence of massive cores, low-mass hot Jupiters can over-flow their Roche-lobes and evaporate on Gyr time-scales, possibly leaving behind small rocky cores. Chapters four through six focus on the improvement and implications of a model for orbital evolution of the solar system, driven by dynamical instability (termed the "Nice" model). Hydrodynamical studies of the orbital evolution of planets embedded in protoplanetary disks suggest that giant planets have a tendency to assemble into multi-resonant configurations. Following this argument, we used analytical methods as well as self-consistent numerical N-body simulations to identify fully-resonant primordial states of the outer solar system, whose dynamical evolutions give rise to orbital architectures that resemble the current solar system. We found a total of only eight such initial conditions, providing

  20. Age of the Lava Creek supereruption and magma chamber assembly at Yellowstone based on 40Ar/39Ar and U-Pb dating of sanidine and zircon crystals

    Science.gov (United States)

    Matthews, Naomi E.; Vazquez, Jorge A.; Calvert, Andrew T.

    2015-01-01

    The last supereruption from the Yellowstone Plateau formed Yellowstone caldera and ejected the >1000 km3 of rhyolite that composes the Lava Creek Tuff. Tephra from the Lava Creek eruption is a key Quaternary chronostratigraphic marker, in particular for dating the deposition of mid Pleistocene glacial and pluvial deposits in western North America. To resolve the timing of eruption and crystallization history for the Lava Creek magma, we performed (1) 40Ar/39Ar dating of single sanidine crystals to delimit eruption age and (2) ion microprobe U-Pb and trace-element analyses of the crystal faces and interiors of single zircons to date the interval of zircon crystallization and characterize magmatic evolution. Sanidines from the two informal members composing Lava Creek Tuff yield a preferred 40Ar/39Ar isochron date of 631.3 ± 4.3 ka. Crystal faces on zircons from both members yield a weighted mean 206Pb/238U date of 626.5 ± 5.8 ka, and have trace element concentrations that vary with the eruptive stratigraphy. Zircon interiors yield a mean 206Pb/238U date of 659.8 ± 5.5 ka, and reveal reverse and/or oscillatory zoning of trace element concentrations, with many crystals containing high U concentration cores that likely grew from highly evolved melt. The occurrence of distal Lava Creek tephra in stratigraphic sequences marking the Marine Isotope Stage 16–15 transition supports the apparent eruption age of ∼631 ka. The combined results reveal that Lava Creek zircons record episodic heating, renewed crystallization, and an overall up-temperature evolution for Yellowstone's subvolcanic reservoir in the 103−104 year interval before eruption.

  1. Black Hole Interior in Quantum Gravity.

    Science.gov (United States)

    Nomura, Yasunori; Sanches, Fabio; Weinberg, Sean J

    2015-05-22

    We discuss the interior of a black hole in quantum gravity, in which black holes form and evaporate unitarily. The interior spacetime appears in the sense of complementarity because of special features revealed by the microscopic degrees of freedom when viewed from a semiclassical standpoint. The relation between quantum mechanics and the equivalence principle is subtle, but they are still consistent. PMID:26047218

  2. Lather (Interior Systems Mechanic). Occupational Analyses Series.

    Science.gov (United States)

    Chapman, Mike; Chapman, Carol; MacLean, Margaret

    This analysis covers tasks performed by a lather, an occupational title some provinces and territories of Canada have also identified as drywall and acoustical mechanic; interior systems installer; and interior systems mechanic. A guide to analysis discusses development, structure, and validation method; scope of the occupation; trends; and…

  3. 14 CFR 125.113 - Cabin interiors.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Cabin interiors. 125.113 Section 125.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS....113 Cabin interiors. (a) Upon the first major overhaul of an airplane cabin or refurbishing of...

  4. 14 CFR 121.215 - Cabin interiors.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Cabin interiors. 121.215 Section 121.215 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS..., FLAG, AND SUPPLEMENTAL OPERATIONS Special Airworthiness Requirements § 121.215 Cabin interiors....

  5. Interior Design Students Perceptions of Sustainability

    Science.gov (United States)

    Stark, Johnnie; Park, Jin Gyu

    2016-01-01

    Purpose: This longitudinal study assessed student perceptions of sustainable design issues in the context of an accredited interior design program. Although literature exists documenting the integration of sustainable strategies into interior design curriculum, more analysis is needed to determine the impact of program experiences on students'…

  6. Department of Interior Semiannual Regulatory Agenda

    Science.gov (United States)

    2010-04-26

    ...: Action Date FR Cite Final Action 04/00/10 Regulatory Flexibility Analysis Required: Yes Agency Contact... idle facilities. Timetable: Action Date FR Cite NPRM 12/00/10 NPRM Comment Period End 02/00/11... Part IX Department of the Interior Semiannual Regulatory Agenda ] DEPARTMENT OF THE INTERIOR...

  7. Ars Baltica-verkoston puheenjohtajuus Suomeen Risto Ruohoselle

    Index Scriptorium Estoniae

    1999-01-01

    1990. a. loodud võrgustiku Ars Baltica sekretariaat (Ars Baltica Contact Point & Communication Center) tuleb Kielist Tallinnasse Eesti kultuuriministeeriumi kuni aastani 2002 (Suur-Karja 23). Ars Baltica (ühendus)

  8. Instrumentation development for planetary in situ 40Ar/39Ar geochronology

    Science.gov (United States)

    Davidheiser-Kroll, B.; Morgan, L. E.; Munk, M.; Warner, N. H.; Gupta, S.; Slaybaugh, R.; Harkness, P.; Mark, D. F.

    2015-12-01

    The chronology of the Solar System, particularly the timing of formation of extraterrestrial bodies and their features, is a major outstanding problem in planetary science. Although various chronological methods for in situ geochronology have been proposed (e.g. Rb-Sr, K-Ar), and even applied (K-Ar, Farley et al., 2014), the reliability, accuracy, and applicability of the 40Ar/39Ar method makes it by far the most desirable chronometer for dating extraterrestrial bodies. The method however relies on the neutron irradiation of samples, and thus a neutron source. We will discuss the challenges and feasibility of deploying a passive neutron source to planetary surfaces for the in situ application of the 40Ar/39Ar chronometer. Requirements in generating and shielding neutrons, as well as analyzing samples are discussed, along with an exploration of limitations such as mass, power, and cost. Two potential solutions for the in situ extraterrestrial deployment of the 40Ar/39Ar method will be presented. Although this represents a challenging task, developing the technology to apply the 40Ar/39Ar method on planetary surfaces would represent a major advance towards constraining the timescale of solar system formation and evolution.

  9. Ars ornata / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1998-01-01

    V rahvusvaheline ehtekunsti konverents 'Ars ornata Europeana' juuni lõpus Stockholmis. New Yorgis elava kuraatori Charon Kranseni ja prantsuse ehtekunstniku Christophe Burger' juhitud vestlusringidest. 1997. a. Pariisis loodud International Craft Design Association'ist (ICDA).

  10. "Ars Ornata" Mediterrania / Kadri Mälk

    Index Scriptorium Estoniae

    Mälk, Kadri, 1958-

    1999-01-01

    VI rahvusvaheline ehtekunstinäitus "Ars Ornata" juuni lõpus Barcelonas. Konverentsist, peanäitusest (osalejad Eestist), ehtekunstiõpetust andvast kõrgkoolist Escola Massana'st Barcelonas, õppejõude. Eesti ehtekunsti tulevikust.

  11. ARS 01 Helsingi Kiasmas / Tarmo Virki

    Index Scriptorium Estoniae

    Virki, Tarmo

    2001-01-01

    Helsingis Kiasmas avatud rahvusvahelisest kunstinäitusest ARS 01 alapealkirjaga "Avanevaid perspektiive", kus esines oma töödega ka Marko Mäetamm. Näituse raames toimuvast Santiago Sierra kunstiprojektist kodututega

  12. The mass of 32Ar and 33Ar for fundamental tests

    International Nuclear Information System (INIS)

    Masses of the short-lived radionuclides 32Ar (T1/2 = 98 ms) 33Ar (T1/2 = 173 ms) have been determined with the Penning trap mass spectrometer ISOLTRAP. Relative uncertainties of 6.0 x 10-8 (δm = 1.8 keV) and 1.4 x 10-8 (δm = 0.44 keV), respectively, have been achieved. At present, these new mass data serve as the most stringent test of the quadratic form of the isobaricmultiplet mass equation IMME. Furthermore, the improved accuracy for the mass of 32Ar yields a better constraint on scalar contributions to the weak interaction. New mass values have also been measured for 44Ar and 45Ar, and a 20σ deviation for 44Ar from the literature value was found and interpreted. (orig.)

  13. Dating blueschist metamorphism: a combined /sup 40/Ar//sup 39/Ar and electron microprobe approach

    Energy Technology Data Exchange (ETDEWEB)

    Sisson, V.B.; Onstott, T.C.

    1986-09-01

    /sup 40/Ar//sup 39/Ar and electron microprobe examination of blueschist samples from the Iceberg Lake schist, southern Alaska suggest that phengite inclusions are the source of /sup 40/Ar in crossite. Because such fine-grained inclusions may be susceptible to argon loss, caution should be exercised in interpreting K-Ar ages from this phase, and possibly other low-K amphiboles from blueschist suites. The estimated blocking temperature for phengite in the matrix (314/sup 0/ to 450/sup 0/C), however, is close to the estimated peak metamorphic temperatures (325/sup 0/ +- 50/sup 0/C), suggesting that phengite /sup 40/Ar//sup 39/Ar plateau dates may coincide closely with the time of blueschist metamorphism.

  14. The effects of retrograde reactions and of diffusion on 39Ar-40Ar ages of micas

    DEFF Research Database (Denmark)

    Allaz, Julien; Engi, Martin; Berger, Alfons;

    2011-01-01

    Effects of metamorphic reactions occurring during decompression were explored to understand their influence on 39Ar-40Ar ages of micas. Monometamorphic metasediments from the Lepontine Alps (Switzerland) were studied. Collected samples reached lower amphibolite facies during the Barrovian...... retrograde chlorite formation. We conclude that even very minor chloritisation of biotite is apparently a more effective parameter than temperature in resetting the Ar clock, as is the formation of plagioclase from paragonite decomposition. Multi-equilibrium thermobarometry is necessary to ensure that...

  15. Convective Overshoot in Stellar Interior

    Science.gov (United States)

    Zhang, Q. S.

    2015-07-01

    In stellar interiors, the turbulent thermal convection transports matters and energy, and dominates the structure and evolution of stars. The convective overshoot, which results from the non-local convective transport from the convection zone to the radiative zone, is one of the most uncertain and difficult factors in stellar physics at present. The classical method for studying the convective overshoot is the non-local mixing-length theory (NMLT). However, the NMLT bases on phenomenological assumptions, and leads to contradictions, thus the NMLT was criticized in literature. At present, the helioseismic studies have shown that the NMLT cannot satisfy the helioseismic requirements, and have pointed out that only the turbulent convection models (TCMs) can be accepted. In the first part of this thesis, models and derivations of both the NMLT and the TCM were introduced. In the second part, i.e., the work part, the studies on the TCM (theoretical analysis and applications), and the development of a new model of the convective overshoot mixing were described in detail. In the work of theoretical analysis on the TCM, the approximate solution and the asymptotic solution were obtained based on some assumptions. The structure of the overshoot region was discussed. In a large space of the free parameters, the approximate/asymptotic solutions are in good agreement with the numerical results. We found an important result that the scale of the overshoot region in which the thermal energy transport is effective is 1 HK (HK is the scale height of turbulence kinetic energy), which does not depend on the free parameters of the TCM. We applied the TCM and a simple overshoot mixing model in three cases. In the solar case, it was found that the temperature gradient in the overshoot region is in agreement with the helioseismic requirements, and the profiles of the solar lithium abundance, sound speed, and density of the solar models are also improved. In the low-mass stars of open

  16. 40Ar/39Ar age and thermal history of the Kirin chondrite

    International Nuclear Information System (INIS)

    The Kirin meteorite, a large (> 2800 kg) H5 chondrite, fell in Kirin Province, China in 1976. A sample from each of the two largest fragments (K-1. K-2) yield 40Ar/39Ar total fusion ages of 3.63 +- 0.02 b.y. and 2.78 +- 0.02 b.y. respectively. 40Ar/40Ar age spectra show typical diffusional argon loss profiles. Maximum apparent ages of 4.36 b.y. (K-1) and approx. 4.0 b.y. (K-2) are interpreted as possible minimum estimates for the age of crystallization of the parent body. (orig./ME)

  17. Ar-39-Ar-40 Evidence for Early Impact Events on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Garrison, D. H.; Rubin, A. E.

    2006-01-01

    We determined Ar-39-Ar-40 ages of eight LL chondrites, and one igneous inclusion from an LL chondrite, with the object of understanding the thermal history of the LL-chondrite parent body. The meteorites in this study have a range of petrographic types from LL3.3 to LL6, and shock stages from S1 to S4. These meteorites reveal a range of K-Ar ages from 23.66 to 24.50 Ga, and peak ages from 23.74 to 24.55 Ga. Significantly, three of the eight chondrites (LL4, 5, 6) have K-Ar ages of -4.27 Ga. One of these (MIL99301) preserves an Ar-39-Ar-40 age of 4.23 +/- 0.03 Ga from low-temperature extractions, and an older age of 4.52 +/- 0.08 Ga from the highest temperature extractions. In addition, an igneous-textured impact melt DOM85505,22 has a peak Ar-39-Ar-40 age of >= 4.27 Ga. We interpret these results as evidence for impact events that occurred at about 4.27 Ga on the LL parent body that produced local impact melts, reset the Ar-39-Ar-40 ages of some meteorites, and exhumed (or interred) others, resulting in a range of cooling ages. The somewhat younger peak age of 3.74 Ga from GR095658 (LL3.3) suggests an additional impact event close to timing of impact-reset ages of some other ordinary chondrites between 3.6-3.8 Ga. The results from MIL99301 suggest that some apparently unshocked (Sl) chondrites may have substantially reset Ar-39-Ar-40 ages. A previous petrographic investigation of MIL99301 suggested that reheating to temperatures less than or equal to type 4 petrographic conditions (600C) caused fractures in olivine to anneal, resulting in a low apparent shock stage of S1 (unshocked). The Ar-39-Ar-40 age spectrum of MIL99301 is consistent with this interpretation. Older ages from high-T extractions may date an earlier impact event at 4.52 +/- 0.08 Ga, whereas younger ages from lower-T extractions date a later impact event at 4.23 Ar-39-Ar-40 0.03 Ga that may have caused annealing of feldspar and olivine

  18. 40Ar - 39Ar dating of meteorites and the history of chondrite parent bodies

    International Nuclear Information System (INIS)

    The 40Ar-39Ar analyses of eleven ordinary chondrites and the unique meteorite Pontylyfni are presented. Results of previous 40Ar-39Ar age analyses have shown that the uncertainty in the calculated ages arises principally from the difficulties of interpretation of release patterns obtained from stepped heating experiments. For this reason considerable attention is paid to identifying the causes of complicating features in the age spectra. The ages obtained range from 4.52Ga to a lower limit of 4.38Ga and it is inferred that these date the time of cooling of the chondrites after formation and metamorphism. (author)

  19. 40Ar/39Ar ages in deformed potassium feldspar: evidence of microstructural control on Ar isotope systematics

    Science.gov (United States)

    Reddy, Steven M.; Potts, Graham J.; Kelley, Simon P.

    2001-05-01

    Detailed field and microstructural studies have been combined with high spatial resolution ultraviolet laser 40Ar/39Ar dating of naturally deformed K-feldspar to investigate the direct relationship between deformation-related microstructure and Ar isotope systematics. The sample studied is a ~1,000 Ma Torridonian arkose from Skye, Scotland, that contains detrital feldspars previously metamorphosed at amphibolite-facies conditions ~1,700 Ma. The sample was subsequently deformed ~430 Ma ago during Caledonian orogenesis. The form and distribution of deformation-induced microstructures within three different feldspar clasts has been mapped using atomic number contrast and orientation contrast imaging, at a range of scales, to identify intragrain variations in composition and lattice orientation. These variations have been related to thin section and regional structural data to provide a well-constrained deformation history for the feldspar clasts. One hundred and forty-three in-situ 40Ar/39Ar analyses measured using ultraviolet laser ablation record a range of apparent ages (317-1030 Ma). The K-feldspar showing the least strain records the greatest range of apparent ages from 420-1,030 Ma, with the oldest apparent ages being found close to the centre of the feldspar away from fractures and the detrital grain boundary. The most deformed K-feldspar yields the youngest apparent ages (317-453 Ma) but there is no spatial relationship between apparent age and the detrital grain boundary. Within this feldspar, the oldest apparent ages are recorded from orientation domain boundaries and fracture surfaces where an excess or trapped 40Ar component resides. Orientation contrast images at a similar scale to the Ar analyses illustrate a significant deformation-related microstructural difference between the feldspars and we conclude that deformation plays a significant role in controlling Ar systematics of feldspars at both the inter- and intragrain scales even at relatively low

  20. Computer vision based room interior design

    Science.gov (United States)

    Ahmad, Nasir; Hussain, Saddam; Ahmad, Kashif; Conci, Nicola

    2015-12-01

    This paper introduces a new application of computer vision. To the best of the author's knowledge, it is the first attempt to incorporate computer vision techniques into room interior designing. The computer vision based interior designing is achieved in two steps: object identification and color assignment. The image segmentation approach is used for the identification of the objects in the room and different color schemes are used for color assignment to these objects. The proposed approach is applied to simple as well as complex images from online sources. The proposed approach not only accelerated the process of interior designing but also made it very efficient by giving multiple alternatives.

  1. Bounds on positive interior transmission eigenvalues

    International Nuclear Information System (INIS)

    This paper contains lower bounds on the counting function of the positive eigenvalues of the interior transmission problem when the latter is elliptic. In particular, these bounds justify the existence of an infinite set of interior transmission eigenvalues and provide asymptotic estimates from above on the counting function for the large values of the wave number. They also lead to certain important upper estimates on the first few interior transmission eigenvalues. We consider the classical transmission problem as well as the case when the inhomogeneous medium contains an obstacle. (paper)

  2. The thermal significance of potassium feldspar K-Ar ages inferred from 40Ar/39Ar age spectrum results

    International Nuclear Information System (INIS)

    40Ar/39Ar age spectrum analyses of three microcline separates from the Separation Point Batholith, northwest Nelson, New Zealand, which cooled slowly through the temperature zone of partial radiogenic 40Ar accumulation are characterized by a linear age increase over the first 65 percent of gas release with the lowest ages corresponding to the time that the samples cooled below about 1000C. The last 35 percent of 39Ar released from the microclines yields plateau ages which reflect the different bulk mineral ages, and correspond to cooling temperatures between about 130 to 1600C. Theoretical calculations confirm the likelihood of diffusion gradients in feldspars cooling at rates =0C-Ma-1. Diffusion parameters calculated from the 39Ar release yield an activation energy, E = 28.8 +- 1.9 kcal-mol-1, and a frequency factor/grain size parameter, D0/l2 = 5.6sub(-3.9)sup(+14) sec-1. This Arrhenius relationship corresponds to a closure temperature of 132 +- 130C which is very similar to the independently estimated temperature. From the observed diffusion compensation correlation, this D0/l2 implies an average diffusion half-width of about 3 μm, similar to the half-width of the perthite lamellae in the feldspars. The results are discussed. (author)

  3. Phobos interior structure from its gravity field

    Science.gov (United States)

    Le Maistre, S.; Rosenblatt, P.; Rivoldini, A.

    2015-10-01

    Phobos origin remains mysterious. It could be a captured asteroid, or an in-situ object co-accreted with Mars or formed by accretion from a disk of impact ejecta.Although it is not straightforward to relate its interior properties to its origin, it is easy to agree that the interior properties of any body has to be accounted for to explain its life's history. What event could explain such an internal structure? Where should this object formed to present such interior characteristics and composition? We perform here numerical simulations to assess the ability of a gravity experiment to constrain the interior structure of the martian moon Phobos, which could in turn allow distinguishing among the competing scenarios for the moon's origin.

  4. Material Ramah Lingkungan untuk Interior Rumah Tinggal

    Directory of Open Access Journals (Sweden)

    Dila Hendrassukma

    2011-03-01

    Full Text Available Housing is one of the biggest contributors in polluting the ozone layer and consuming the natural resources in making one. Home interior takes part in the over-produced material used for covering the interior elements, such as floor, wall, ceiling, and furniture. The article conducting is to study the green aspect of building materials to find alternative material to beautify the house that is not harming the earth. The result is options of eco material to be used in the making of greener home interior. It is materials that can be renewed, recycled, and low in embodied energy. Materials used in home interior have impact to the natures. Thus, awareness in choosing the right material to decorate the house is very important.

  5. Seismic View of the Solar Interior

    Indian Academy of Sciences (India)

    H. M. Antia

    2002-03-01

    The interior of the Sun is not directly observable to us. Nevertheless, it is possible to infer the physical conditions prevailing in the solar interior with the help of theoretical models coupled with observational input provided by measured frequencies of solar oscillations. The frequencies of these solar oscillations depend on the internal structure and dynamics of the Sun and from the knowledge of these frequencies it is possible to infer the internal structure as well as the large scale flows inside the Sun, in the same way as the observations of seismic waves on the surface of Earth help us in the study of its interior. With the accumulation of seismic data over the last six years it has also become possible to study temporal variations in the solar interior. Some of these seismic inferences would be described.

  6. Project management in interior design services

    OpenAIRE

    Şahinoglu, Alp

    1997-01-01

    Ankara : Bilkent University, Department of Interior Architecture and Environmental Design and Institute of Fine Arts, 1997. Thesis (Master's) -- Bilkent University, 1997. Includes bibliographical references. In this study, the concept of project management is analyzed within the framework of interior design services. Project management has been defined as the managing and coordination of all human and physical resources, in order to accomplish the predetermined goals (aim of the proj...

  7. Interior Design and Navigation in Virtual Reality

    OpenAIRE

    Tingvall, Jesper

    2015-01-01

    This thesis examined how virtual reality could be used in interior design. The thesis was limited to virtual reality experienced using a head mounted display. The Method was to integrate virtual reality into an existing interior design software called CET Designer. After investigating the available commercial virtual reality hardware and software Oculus SDK and OpenVR was chosen. Unity 3D was used as a prototyping tool for experimenting with different interaction and navigation methods. An use...

  8. Colour-emotion associations in interior spaces

    OpenAIRE

    Helvacıoğlu, Elif

    2011-01-01

    Colour as an effective design tool influences people’s emotions in interior spaces. Depending on the assumption that colour has an impact on human psychology, this study stresses the need for further studies that comprise colour and emotion association in interior space in order to provide healthier spaces for inhabitants. Emotional reactions to colour in a living room were investigated by using self report measure. Pure red, green and blue were chosen to be investigated as ...

  9. Charges in the hydrophobic interior of proteins

    OpenAIRE

    Isom, Daniel G.; Castañeda, Carlos A.; Cannon, Brian R.; Velu, Priya D.; García-Moreno E., Bertrand

    2010-01-01

    Charges are inherently incompatible with hydrophobic environments. Presumably for this reason, ionizable residues are usually excluded from the hydrophobic interior of proteins and are found instead at the surface, where they can interact with bulk water. Paradoxically, ionizable groups buried in the hydrophobic interior of proteins play essential roles, especially in biological energy transduction. To examine the unusual properties of internal ionizable groups we measured the pKa of glutamic...

  10. ArDroneXT - Ar.Drone 2 eXTension for swarming and service hosting

    OpenAIRE

    Autefage, Vincent; Chaumette, Serge

    2013-01-01

    This report explains how to upgrade an Ar.Drone 2 for swarming and services hosting. In other words, it gives the technical information required to easily create a swarm of Ar.Drone 2 sharing a Wi-Fi network. Moreover, it describes the process to install new services and applications on the drone.

  11. A Refined Astronomically Calibrated 40Ar/39Ar Age for Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian; Hilgen, Frederik; Kuiper, Klaudia

    sanidine age of 0.7674±0.0022 Ma (2σ, external errors) is indistinguishable from the ID-TIMS U/Pb zircon age (0.7671±0.0019 Ma). The consistency between the astronomically calibrated 40Ar/39Ar sanidine age and U/Pb zircon age for this Quaternary unit suggests that agreement between these two radio...

  12. 39Ar-40Ar dating of mesosiderites: Evidence for major parent body disruption < 4 Ga ago

    International Nuclear Information System (INIS)

    39Ar-40Ar ages were measured on 17 samples of 14 different mesosiderites and indicate major degassing of Ar by one or more thermal events less than 4.0 Ga ago. Three samples gave release patterns of constant age, whereas the other samples typically showed 200-400 Ma increases in 39Ar-40Ar age with increasing gas extraction temperature. These stepwise releases indicate ages of ∼3.4-3.8 Ga; averaged ages for individual meteorites are 3.45-3.82 Ga. No substantial evidence exists in the temperature releases for 39Ar-40Ar ages older than 4.0 Ga, and the Ar ages appear to be in contradiction to 244Pu fission track ages previously reported for a few mesosiderites. We suggest that metal-silicate mixing occurred ∼4.4 Ga ago, but that a major collisional event disrupted the mesosiderite parent planet 500 degree C, and left them deeply buried to undergo slow cooling

  13. K/Ar ages from basal gneiss region

    International Nuclear Information System (INIS)

    K/Ar and 40Ar/39Ar geochronology of minerals from the Stadlandet region, Norway, is complicated by the presence of excess 40Ar in many samples. There is a correlation between excess 40Ar concentration and textural occurrence of samples. Amphiboles and micas closely accociated with eclogite pods are likely to contain significant concentrations of excess 40Ar, while samples from the country rocks are not. K/Ar and 40Ar/39Ar ages for hornblende from the country rocks suggest that post-metamorphic cooling through 5000C occured about 410 Ma ago, shortly after eclogite formation. Biotites containing no excess 40Ar cooled through 3000C about 370 Ma ago. A post-metamorphic cooling rate of about 50C/Ma can be inferred

  14. Ar-41 measurements and nuclear emergency preparedness

    International Nuclear Information System (INIS)

    During the early phase of an emergency is necessary to confirm the release of radioactivity predictions made by the operator of the nuclear plant. In this context, it has begun measuring Ar-41 in the vicinity of a research reactor. Since the Ar-41 is produced in the reactor, it has been studied as a good way to validate the air dispersion model used in nuclear emergencies and to develop a method to improve the characterization of the release. For this latter purpose a pilot experiment was conducted to determine computational and experimental methods, the flux of 1.29 MeV of Ar-41 and compared to evaluate the accuracy of the assessments made. This paper describes meteorological forecasting systems used in the experiment, the estimate of the stability class and the concentration of nuclides using a calculation code developed by the ARN, as well as the methodology and equipment used for measurement in the field. (authors)

  15. Improved Ar(II) transition probabilities

    OpenAIRE

    Danzmann, K.; de Kock, M

    1986-01-01

    Precise Ar(II) branching ratios have been measured on a high current hollow cathode with a 1-m Fourier transform spectrometer. Absolute transition probabilities for 11 Ar(II) lines were calculated from these branching ratios and lifetime measurements published by Mohamed et al. For the prominent 4806 Å line, the present result is Aik = 7.12×107s-1 ±2.8%, which is in excellent agreement with recent literature data derived from pure argon diagnostics, two-wavelength-interferometry, and Hβ-diagn...

  16. Online Scene Modeling for Interactive AR Applications

    OpenAIRE

    Yoo, Jaesang; Cho, Kyusung; Jung, Jinki; Yang, Hyun S.

    2010-01-01

    Augmented reality applications require 3D model of environment to provide even more realistic experience. Unfortunately, however, most of researches on 3D modeling have been restricted to an offline process up to now, which conflicts with characteristics of AR such as realtime and online experience. In addition, it is barely possible not only to generate 3D model of whole world in advance but also trasfer the burden of 3D model generation to a user, which limits the usability of AR. Thus, it ...

  17. AR-扩增实境

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    1、什么是AR-扩增实境?AR-扩增实境(Augmented Reality,简称AR),简单地说,就是把虚拟的物体和现实的场景进行嫁接。这是一种实时地计算摄影机影像的位置及角度并加上相应图像的技术,这种技术的目标是在屏幕上把虚拟世界套在现实世界并进行互动。

  18. Penning ionization : In benzene · Ar and fluorobenzene · Ar van der waals molecules and in collisions of benzene with metastable Ar atoms

    Science.gov (United States)

    Rühl, E.; Bisling, P.; Brutschy, B.; Beckmann, K.; Leisen, O.; Morgner, H.

    1986-08-01

    The photoion efficiency curves of the van der Waals complexes benzene ·Ar (Bz·Ar) and fluorobenzene·Ar (Fb·Ar) exhibit sharp resonances, which correspond to excitation to the Ar 2P 3/24s and 2P 1/24s resonance states. The peaks are redshifted relative to their asymptotic values (Bz·Ar, Δ E = -70 ± 10 meV; Fb·Ar, Δ E = -40 ± 10 meV). These findings are supported by electron spectroscopy studies of the Penning ionization of benzene by state-selected metastable Ar ( 3p 2, 3p 0) atoms. Strong evidence is presented that Penning ionization is the process observed in both cases.

  19. Comparative 40Ar/39Ar and K-Ar dating of illite-type clay minerals: A tentative explanation for age identities and differences

    Science.gov (United States)

    Clauer, Norbert; Zwingmann, Horst; Liewig, Nicole; Wendling, Raymond

    2012-10-01

    The 40K/40Ar (K-Ar) and 40Ar/39Ar dating methods are applied here to the same, very small, micrometric illite-type particles that crystallized under low-temperature (samples with a total of fifteen size fractions from advantages, such as the plateaus obtained by incremental step heating of the various size fractions, even if not translatable straight as ages of the illite populations; they allow identification of two generations of authigenic illite that formed at about 200 and 175 Ma, and one detrital generation. However, 40Ar/39Ar dating of clay minerals remains challenging as technical factors, such as the non-standardized encapsulation, may have potential unexpected effects. Both dating methods have their limitations: (1) K-Ar dating requires relatively large samples (ca. 10-20 mg) incurring potential sample homogeneity problems, with two aliquots required for K and Ar analysis for an age determination, also inducing a higher analytical uncertainty; (2) an identified drawback of 40Ar/39Ar dating is Ar recoil and therefore potential loss that occurs during neutronic creation of 39Ar from 39K, mostly in the finer mineral particles. If all the recoiled 39Ar is redistributed into adjacent grains/minerals, the final 40Ar/39Ar age of the analyzed size fraction remains theoretically identical, but it is not systematic in clay-type material. The finest grain sizes (e.g., convenient and straightforward use supported by a standardized and well-controlled technical approach. The present comparison of the two Ar-dating methods as applied to clay material shows that neither method is presently outdated, and that they are even of reciprocal use. Both methods have distinct application fields in clay geochronology and complementary application fields in clay crystallography.

  20. The State of Environmentally Sustainable Interior Design Practice

    OpenAIRE

    Mihyun Kang; Denise A. Guerin

    2009-01-01

    Problem statement: Research that investigates how interior designers use environmentally sustainable interior design criteria in their design solutions has not been done. To provide a base to develop education strategies for sustainable interior design, this study examined the state of environmentally sustainable interior design practice. Approach: A national, Internet-based survey of interior design practitioners was conducted. To collect data, the random sample of US interior design practit...

  1. Collective dipole response of proton-rich nuclei 32Ar and 34Ar

    International Nuclear Information System (INIS)

    The earlier observation of low-lying dipole strength in neutron rich nuclei and its interpretation with respect to basic nuclear properties (symmetry energy, skin thickness) initiated the investigation of this phenomenon in proton-rich nuclei. Macroscopically this strength could be explained with the resonant dipole oscillation of a proton skin against the isospin-symmetric core. For nuclei like 32Ar the occurrence of pronounced dipole strength is predicted in the low-energy region between 8-10 MeV excitation energy. For the 34Ar the pygmy strength is expected to drop sharply and vanish entirely for the N=Z nucleus 36Ar. The experiment S327 has been performed in August 2008 at the GSI Darmstadt in Cave C using the LAND reaction setup. Fragmentation of a 800 A MeV primary 36Ar beam on a Be target was used to produce the radioactive isotopes 34Ar and 32Ar. After passing the FRS (Fragment Separator) the ions impinged on a Pb target. The dipole response is observed using the Coulomb excitation method in inverse kinematics. The concept and the experimental method will be shown in the context of the underlying physics case in 32,34Ar.

  2. Modification of stearic acid in Ar and Ar-O2 pulsed DC discharges

    International Nuclear Information System (INIS)

    Stearic acid (C18H36O2) was treated into Ar and Ar-O2(10%) pulsed DC discharge created by a cathode-anode confined system. The samples were placed at the floating potential. The results show that the mass variation of the stearic acid samples after Ar-O2 plasma exposure is more important than the pure Ar plasma treatments. This comportment demonstrate that the oxygen actives species (O and O2 in all states) strongly enhance the etching process with regards to A* species, regardless of their concentration. After treatment by Ar and Ar-O2 plasma, analyses by X-ray diffraction show a significant structural modification of the samples surface, utilizing Ar-O2 plasma the modification was more pronounced. The chemical composition evolution shows that the acid function is etched preferentially in the beginning of the treatment (about 5 min) and that after 10 min the carbonic chains seems to be functionalized by oxygen. (author)

  3. Study of Ar and Ar-CO2 microwave surfaguide discharges by optical spectroscopy

    Science.gov (United States)

    Silva, Tiago; Britun, Nikolay; Godfroid, Thomas; van der Mullen, Joost; Snyders, Rony

    2016-05-01

    A surfaguide microwave discharge operating at 2.45 GHz in Ar and Ar-CO2 mixtures is studied using diagnostics methods based on optical emission spectroscopy. The population densities of Ar metastable and resonant states of the lowest group of excited levels ( 1 s x ) are investigated for several experimental conditions using the self-absorption technique. It is found that the densities of these levels, ranging from 1017 to 1016 m-3 for the pure Ar case, are dependent on the discharge pressure and applied power. The electron temperature and electron density are calculated via the balances of creation/loss mechanisms of radiative and metastable levels. In the range of the studied experimental conditions (50-300 W of applied power and 0.5-6 Torr of gas pressure), the results have shown that lower values of electron temperature correspond to higher values of power and pressure in the discharge. Adding CO2 to the argon plasma results in a considerable decrease (about 3 orders of magnitude) of the Ar metastable atom density. The feasibility of using the ratio of two Ar emission line intensities to measure the electron temperature in CO2 discharges with small Ar admixtures is studied.

  4. Potassium Isotopic Compositions of NIST Potassium Standards and 40Ar/39Ar Mineral Standards

    Science.gov (United States)

    Morgan, Leah; Tappa, Mike; Ellam, Rob; Mark, Darren; Higgins, John; Simon, Justin I.

    2013-01-01

    Knowledge of the isotopic ratios of standards, spikes, and reference materials is fundamental to the accuracy of many geochronological methods. For example, the 238U/235U ratio relevant to U-Pb geochronology was recently re-determined [1] and shown to differ significantly from the previously accepted value employed during age determinations. These underlying values are fundamental to accurate age calculations in many isotopic systems, and uncertainty in these values can represent a significant (and often unrecognized) portion of the uncertainty budget for determined ages. The potassium isotopic composition of mineral standards, or neutron flux monitors, is a critical, but often overlooked component in the calculation of K-Ar and 40Ar/39Ar ages. It is currently assumed that all terrestrial materials have abundances indistinguishable from that of NIST SRM 985 [2]; this is apparently a reasonable assumption at the 0.25per mille level (1s) [3]. The 40Ar/39Ar method further relies on the assumption that standards and samples (including primary and secondary standards) have indistinguishable 40K/39K values. We will present data establishing the potassium isotopic compositions of NIST isotopic K SRM 985, elemental K SRM 999b, and 40Ar/39Ar biotite mineral standard GA1550 (sample MD-2). Stable isotopic compositions (41K/39K) were measured by the peak shoulder method with high resolution MC-ICP-MS (Thermo Scientific NEPTUNE Plus), using the accepted value of NIST isotopic SRM 985 [2] for fractionation [4] corrections [5]. 40K abundances were measured by TIMS (Thermo Scientific TRITON), using 41K/39K values from ICP-MS measurements (or, for SRM 985, values from [2]) for internal fractionation corrections. Collectively these data represent an important step towards a metrologically traceable calibration of 40K concentrations in primary 40Ar/39Ar mineral standards and improve uncertainties by ca. an order of magnitude in the potassium isotopic compositions of standards.

  5. Hazard evaluation for 244-AR vault facility

    International Nuclear Information System (INIS)

    This document presents the results of a hazard identification and evaluation performed on the 244-AR Vault Facility to close a USQ (USQ No. TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed in HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities

  6. "ARS 01", perspektiivide avamine / Helen Kivisoo

    Index Scriptorium Estoniae

    Kivisoo, Helen

    2001-01-01

    30. IX 2001-20. I 2002 Kiasmas kuuendat korda toimuvast rahvusvahelisest näitusest "ARS", kus Eestist osaleb Marko Mäetamm. Kuraatorid Tuula Arkio, Maaretta Jaukkuri, Patrik Nyberg, Jari-Pekka Vanhala. Teemaks "kolmas ruum". Näituse kajastamisest.

  7. Lignocellulosic Biofuels: Bioenergy Research at ARS

    Science.gov (United States)

    The growth and long-term viability of bioenergy production in the Nation are impeded by a number of technical and commercial barriers. Agricultural Research Service (ARS) addresses technical barriers and does so by leveraging its strengths and unique capabilities to (1) pursue technical barriers th...

  8. Ionization of Argon n=2 (Ar+9 to Ar+16) by a 'relativistic' laser field

    International Nuclear Information System (INIS)

    The high field photoionization cross sections for the (n=2) shell of argon were measured with pulsed 800 nm radiation (27±5 fs duration) at an intensity of 1.5x1019 W/cm2±1x1019 W/cm2. The pondermotive energy for an electron at these field intensities is approximately 1 MeV. The best agreement with a calculated AC tunneling model was at an intensity of 0.6x1019 W/cm2. The difference between experimental and calculated relative charge state yields is less than an order of magnitude for Ar+9 to Ar+14 and Ar+16

  9. A compilation of 40Ar-39 and K-Ar ages: report 25

    International Nuclear Information System (INIS)

    Twenty-three 40Ar-39Ar age determinations (including two potassium-argon analyses) carried out by the Geological Survey of Canada are reported. Each age determination is accompanied by a description of the rock and mineral concentrate used; brief interpretative comments regarding the geological significance of each age are also provided where possible. The experimental procedures employed are described in outline. An index of all Geological Survey of Canada K-Ar age determinations published in this format has been prepared using NTS quadrangles as the primary reference. (author). 6 refs., 2 tabs., 1 fig

  10. The ChArMEx database

    Science.gov (United States)

    Ferré, Hélène; Belmahfoud, Nizar; Boichard, Jean-Luc; Brissebrat, Guillaume; Cloché, Sophie; Descloitres, Jacques; Fleury, Laurence; Focsa, Loredana; Henriot, Nicolas; Mière, Arnaud; Ramage, Karim; Vermeulen, Anne; Boulanger, Damien

    2015-04-01

    The Chemistry-Aerosol Mediterranean Experiment (ChArMEx, http://charmex.lsce.ipsl.fr/) aims at a scientific assessment of the present and future state of the atmospheric environment in the Mediterranean Basin, and of its impacts on the regional climate, air quality, and marine biogeochemistry. The project includes long term monitoring of environmental parameters , intensive field campaigns, use of satellite data and modelling studies. Therefore ChARMEx scientists produce and need to access a wide diversity of data. In this context, the objective of the database task is to organize data management, distribution system and services, such as facilitating the exchange of information and stimulating the collaboration between researchers within the ChArMEx community, and beyond. The database relies on a strong collaboration between ICARE, IPSL and OMP data centers and has been set up in the framework of the Mediterranean Integrated Studies at Regional And Locals Scales (MISTRALS) program data portal. ChArMEx data, either produced or used by the project, are documented and accessible through the database website: http://mistrals.sedoo.fr/ChArMEx. The website offers the usual but user-friendly functionalities: data catalog, user registration procedure, search tool to select and access data... The metadata (data description) are standardized, and comply with international standards (ISO 19115-19139; INSPIRE European Directive; Global Change Master Directory Thesaurus). A Digital Object Identifier (DOI) assignement procedure allows to automatically register the datasets, in order to make them easier to access, cite, reuse and verify. At present, the ChArMEx database contains about 120 datasets, including more than 80 in situ datasets (2012, 2013 and 2014 summer campaigns, background monitoring station of Ersa...), 25 model output sets (dust model intercomparison, MEDCORDEX scenarios...), a high resolution emission inventory over the Mediterranean... Many in situ datasets

  11. Inequivalence of interior and exterior dynamical problems

    International Nuclear Information System (INIS)

    We begin a series of notes with the review of the historical distinction by Lagrange, Hamilton, Jacobi and other Founding Fathers of analytic dynamics, between the exteriordynamical problem, consisting of motion in vacuum under action-at-a-distance interactions, and the interior dynamical problem, consisting of motion within a resistive medium with the additional presence of contact, nonlinear, nonlocal and nonhamiltonian internal forces. After recalling some of the historical reasons that led to the contemporary, virtually complete restriction of research to the exterior problem, we show that the interior dynamical problem cannot be reduced to the exterior one. This establishes the open character of the central objective of these notes: the identification of the space-time symmetries and relativities that are applicable to interior, nonlinear, nonlocal and nonhamiltonian systems. (author). 29 refs

  12. Planetary deep interiors, geodesy, and habitability

    Science.gov (United States)

    Dehant, Veronique

    2014-05-01

    The evolution of planets is driven by the composition, structure, and thermal state of their internal core, mantle, lithosphere, crust, and by interactions with possible ocean and atmosphere. This presentation puts in perspective the fundamental understanding of the relationships and interactions between those different planetary reservoirs and their evolution through time. It emphasizes on the deep interior part of terrestrial planets and moons. The core of a planet, when composed of liquid iron alloy, may provide magnetic field and further interaction with the magnetosphere, ingredients believed to be important for the evolution of an atmosphere and of a planet in general. The deep interior is believed to be of high importance for its habitability. Lander and orbiter, even rover at the surface of planets or moons of the solar system help in determining their interior properties. First of all orbiters feel the gravity of the planet and its variations. In particular, the tidal mass redistribution induces changes in the acceleration of the spacecraft orbiting around a planet. The Love number k2 has been determined for Venus, Mars, and the Earth, as well as for Titan and will be deduced for Mercury and for some of the Galilean satellites from new missions such as JUICE (Jupiter Icy satellite Explorer). The properties of the interior can also be determined from the observation of the rotation of the celestial body. Radar observation from the Earth ground stations of Mercury has allowed Margo et al. (2012, JGR) to determine the moments of inertia of Mercury with an unprecedented accuracy. Rovers such as the MERs (Mars Exploration Rovers) allow as well to obtain the precession and nutation of Mars from which the moments of inertia of the planet and its core can be deduced. Future missions such as the InSIGHT (Interior exploration using Seismic Investigations, Geodesy, and Heat Transport) NASA mission will further help in the determination of Mars interior and evolution

  13. The Prefabricated Interior Design Studio: An Exploration into the History and Sustainability of Interior Prefabrication

    Science.gov (United States)

    Schneiderman, Deborah; Freihoefer, Kara

    2013-01-01

    This article examines the integration of prefabrication into an interior design studio. A review of the literature revealed that while there is a paucity of categorical research focused on this subject, the subject is historically significant with an abundance of evidence regarding the prefabrication of the interior environment dating back…

  14. A study of helicopter interior noise reduction

    Science.gov (United States)

    Howlett, J. T.; Clevenson, S. A.

    1975-01-01

    The interior noise levels of existing helicopters are discussed along with an ongoing experimental program directed towards reducing these levels. Results of several noise and vibration measurements on Langley Research Center's Civil Helicopter Research Aircraft are presented, including measurements taken before and after installation of an acoustically-treated cabin. The predominant noise source in this helicopter is the first stage planetary gear-clash in the main gear box, both before and after installation of the acoustically treated cabin. Noise reductions of up to 20 db in some octave bands may be required in order to obtain interior noise levels comparable to commercial jet transports.

  15. Material Ramah Lingkungan untuk Interior Rumah Tinggal

    OpenAIRE

    Dila Hendrassukma

    2011-01-01

    Housing is one of the biggest contributors in polluting the ozone layer and consuming the natural resources in making one. Home interior takes part in the over-produced material used for covering the interior elements, such as floor, wall, ceiling, and furniture. The article conducting is to study the green aspect of building materials to find alternative material to beautify the house that is not harming the earth. The result is options of eco material to be used in the making of greener hom...

  16. Interior point algorithms theory and analysis

    CERN Document Server

    Ye, Yinyu

    2011-01-01

    The first comprehensive review of the theory and practice of one of today's most powerful optimization techniques. The explosive growth of research into and development of interior point algorithms over the past two decades has significantly improved the complexity of linear programming and yielded some of today's most sophisticated computing techniques. This book offers a comprehensive and thorough treatment of the theory, analysis, and implementation of this powerful computational tool. Interior Point Algorithms provides detailed coverage of all basic and advanced aspects of the subject.

  17. New Approach to Estimate 40Ar/36Ar Ratio in Shocked Meteorites

    Science.gov (United States)

    Fujimoto, H.; Hyodo, H.; Ninagawa, K.

    2008-12-01

    Measurement of a 40Ar/39Ar age in a meteorite requires proper estimation of a 40Ar/36Ar "initial" ratio. For a primordial one, it is reported to be an order of 10-4, suggesting that one can ignore it in age calculation. However, there is no basis for applying this value as individual meteorites have different histories. In terms of 40Ar/39Ar studies on various meteorites, very few studies discuss how the ratios were estimated. Using terrestrial value of 295.5 is invalid. The only case in which the ratio does not affect on the results is when an age of a meteorite is in an order of billion years, resulting in a large raw 40Ar/36Ar ratio. A proper approach to estimate the ratio is application of isochron analyses. When a small amount of sample (a few micrograms) is studied in laserprobe analysis, this often becomes difficult. A shocked meteorite Y-75097 has developed maskelynite veins, which were identified in optical microscope, electron microprobe and thermoluminescence studies. We have applied 40Ar/39Ar dating method using both stepwise heating by a continuous laser and pinpoint dating by a pulsed laser. Stepwise heating results of several fragments (about 50 micrograms) of the meteorite yielded various old and young ages. Most pinpoint analyses gave the raw 40Ar/36Ar ratio less than the terrestrial value with sporadically and anomalously old ages. Among the data, three points isochron from a maskelynite vein yielded about 300 Ma with "initial" ratio of 180. To confirm this result, plagioclase and olivine data near the vein were plotted in a correlation diagram, but an isochron is not well defined due to relatively large analytical errors. A new method to analyze these data is proposed. Once 40Ar/39Ar ratio is determined from an experiment, the only factor which determines the age is the "initial" ratio in the 40Ar/39Ar age equation. Instead of using a known fixed ratio, we set the ratio (y-axis) and the age (x-axis) as variables. In this diagram, a single data

  18. Planar defects as Ar traps in trioctahedral micas: A mechanism for increased Ar retentivity in phlogopite

    Science.gov (United States)

    Camacho, A.; Lee, J. K. W.; Fitz Gerald, J. D.; Zhao, J.; Abdu, Y. A.; Jenkins, D. M.; Hawthorne, F. C.; Kyser, T. K.; Creaser, R. A.; Armstrong, R.; Heaman, L. W.

    2012-08-01

    The effects of planar defects and composition on Ar mobility in trioctahedral micas have been investigated in samples from a small marble outcrop (∼500 m2) in the Frontenac Terrane, Grenville Province, Ontario. These micas crystallized during amphibolite-facies metamorphism at ∼1170 Ma and experienced a thermal pulse ∼100 Ma later at shallow crustal levels associated with the emplacement of plutons. 87Rb/86Sr ages of the phlogopites range from ∼950 to ∼1050 Ma, consistent with resetting during the later thermal event. The same phlogopites however, give 40Ar/39Ar ages between ∼950 and 1160 Ma, spanning the age range of the two thermal events. This result is intriguing because these micas have undergone the same thermal history and were not deformed after peak metamorphic conditions. In order to understand this phenomenon, the chemical, crystallographical, and microstructural nature of four mica samples has been characterized in detail using a wide range of analytical techniques. The scanning electron microscope (SEM), electron microprobe (EMP), and laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) data show that the micas are chemically homogeneous (with the exception of Ba) and similar in composition. The Fourier transform infrared spectroscopy and Mossbauer results show that the M sites for three of the micas are dominated by divalent cations and the Fe3+/(Fe2++Fe3+) ratio for all four phlogopites ranges from 0.10 to 0.25. The stable-isotopic data for calcite indicate that this outcrop was not affected by hydrothermal fluids after peak metamorphism. No correlation between chemical composition and 87Rb/86Sr and 40Ar/39Ar age or between crystal size and 40Ar/39Ar age is observed. The only major difference among all of the micas was revealed through transmitted electron microscope (TEM), which shows that the older 1M micas contain significantly more layer stacking defects, associated with crystallization, than the younger micas. We

  19. An 40 Ar- 39 Ar study of the Cape Verde hot spot

    DEFF Research Database (Denmark)

    Holm, Paul Martin; Grandvuinet, Tanja; Wilson, James Richard;

    2008-01-01

    The 40Ar-39Ar analyses of 28 groundmass separates from volcanic rocks from the islands of Santiago, Sal, and São Vicente, Cape Verde archipelago, are presented. The new age data record the volcanic evolution for Santiago from 4.6 to 0.7 Ma, for Sal from around 15 to 1.1 Ma, and for São Vicente fr...

  20. Variscan polyphase tectonothermal record in the West Sudetes (Bohemian Massif) - deduced from Ar-Ar ages

    Czech Academy of Sciences Publication Activity Database

    Marheine, D.; Kachlík, V.; Patočka, František; Maluski, H.; Zelazniewicz, A.

    La Coruňa : International Basement Tectonics Association, 2000, s. 254-257. [International Conference on Basement Tectonics /15./, Galicia 2000.. La Coruňa (ES), 04.07.2000-08.07.2000] R&D Projects: GA AV ČR BARRANDE97008; GA AV ČR KSK1012601 Institutional research plan: CEZ:AV0Z3013912 Keywords : HP-LT-; HT- metamorphic rocks * tectonothermal events * Ar-Ar geochronology Subject RIV: DB - Geology ; Mineralogy

  1. Ar-Ar Isotopic age of lamproite dikes of the Chuisky complex, Gorny Altai

    International Nuclear Information System (INIS)

    The age of lamproite dikes of the Chuisky complex of the Gorny Altai was identified by the method of Ar-Ar isotope dating. The previously established Early-Middle Triassic age (236.5 ± 3.8 mln. years) of the dikes permits relating their formation and activities of the superplume, which dictated the development of the Permian-Triassic magmatism within vast territories in the Northern and Central Asia

  2. Ar/39Ar age spectrum analysis of detrital microclines from the southern San Joaquin Basin, California

    International Nuclear Information System (INIS)

    Detrital microcline grains from sedimentary strata preserve a record of thermal evolution in the temperature range approx.= 1000 to 2000C which can be revealed by 40Ar/39Ar age spectrum analysis. Microcline separates from deep drill hole intersections with Eocene to Miocene sediments in the Basin and Tejon Blocks of the southern San Joaquin Valley, California, analysed by the age spectrum approach show radiogenic 40Ar (40Ar*) gradients that record both the slow cooling of the uplifting sediment source approx.= 65 Ma ago, and a recent thermal event. This information, in conjunction with the observation of fission track annealing in the coexisting apatites, allows estimation of the temperature-time conditions of this thermal event at about 1400C for approx.= 200 ka. Present and paleotemperature data is in accord with heating related to several kilometers of Pleistocene sediment deposition. Heat flow calculations suggest that this recent subsidence has depressed the thermal gradient from about 300C km-1 to the present apparent gradient of 240C km-1. 40Ar/39Ar analysis of detrital microcline crystals yields thermochronological information in the temperature-time range of petroleum maturation and provides this technique with potential as both a useful exploration tool and as a means of probing the fundamental geodynamic processes of basin evolution. (orig.)

  3. Plasma etching of III-nitrides in ICl/Ar and IBr/Ar plasmas

    International Nuclear Information System (INIS)

    Two new plasma chemistries, ICl/Ar and IBr/Ar, were investigated for dry etching of III-nitrides. Under electron cyclotron resonance conditions, we examined the effect of plasma composition, and source and chuck power on etch rates and surface morphology. The etch rate of InN proved to be the most sensitive of the materials investigated to the plasma composition and ion density in ICl plasmas. The GaN, InN, and InGaN etch rates reached ∼13000, 11500, and 7000 Angstrom/min, respectively, at 250 W rf chuck power and 1000 W microwave source power for ICl discharges. The etch rates in IBr plasmas were somewhat slower than in ICl. The etched surface of GaN was found to be smooth, with no significant preferential loss of N from the surface at low rf powers in either chemistry. There was no significant residue on the GaN surfaces after etching in IBr/Ar, and only slight chlorine contamination on the surfaces etched in ICl/Ar. Selectivities of 5 endash 10 for GaN over InN, AlN, or InAlN were achieved in ICl/Ar, but were <4 under all conditions with IBr/Ar. copyright 1997 American Vacuum Society

  4. Ar-Ar Dating on the Metallogenesis of the Dongchuang Gold Deposit in the Xiaoqinling Area

    Institute of Scientific and Technical Information of China (English)

    李强之; 陈衍景; 钟增球; 李文良; 李绍如; 郭晓东; 金宝义

    2002-01-01

    The Dongchuang gold deposit in the Xiaoqinling area is an orogenic-type lode gold deposit. It is one ofthe few superlarge (>100 t Au) deposits in China. Although it has been argued that it was formed in the Mesozoic,related isotopic age data have not been reported in previous studies. Based on detailed geological study, the authors havecarried out isotopic dating on various metallogenic generations. The ore-forming process of the Dongchuang golddeposit consists of four stages: coarse-grained pyrite-bearing quartz veins (stageⅠ), fine-grained pyrite-quartz veinlets(stage Ⅱ), multi-sulfides (stage Ⅲ) and carbonate-quartz veinlets (stage Ⅳ). Ar-Ar dating on mineral separates of stagesⅠ, Ⅱ and Ⅲ yields plateau ages of 142.9±2.9 Ma, 132.2±2.6 Ma and 128.3±6.2 Ma, respectively. Sericite separates fromstage Ⅱ assemblage also yield an Ar-Ar isochron age of 132.6±2.7 Ma, similar to the Ar-Ar plateau age. These resultssuggest that the Dongchuang gold deposit was mainly formed during 143-128 Ma, coinciding with the authors'geological observations and previous hypothesis. This ore formation is coeval with the regional-tectonic transition fromcollisional compression to extension, strongly showing that the decompression-geothermal increase regime duringcompression-to-extension transition is the most conducive geodynamic environment to orogenic-type goldmineralization.

  5. Neutron Star Interior Composition Explorer (NICE)

    Science.gov (United States)

    Gendreau, Keith C.; Arzoumanian, Zaven

    2008-01-01

    This viewgraph presentation contains an overview of the mission of the Neutron Star Interior Composition Explorer (NICE), a proposed International Space Station (ISS) payload dedicated ot the study of neutron stars. There are also reviews of the Science Objectives of the payload,the science measurements, the design and the expected performance for the instruments for NICE,

  6. Solar Powered Automobile Interior Climate Control System

    Science.gov (United States)

    Howard, Richard T. (Inventor)

    2003-01-01

    There is provided a climate control system for a parked vehicle that includes a solar panel, thermostatic switch, fans, and thermoelectric coolers. The solar panel can serve as the sole source of electricity for the system. The system affords convenient installation and removal by including solar panels that are removably attached to the exterior of a vehicle. A connecting wire electrically connects the solar panels to a housing that is removably mounted to a partially opened window on the vehicle. The thermostatic switch, fans, and thermoelectric coolers are included within the housing. The thermostatic switch alternates the direction of the current flow through the thermoelectric coolers to selectively heat or cool the interior of the vehicle. The interior surface of the thermoelectric coolers are in contact with interior heat sinks that have air circulated across them by an interior fan. Similarly, the exterior surface of the thermoelectric coolers are in contact with exterior heat sinks that have air circulated across them by an exterior fan.

  7. The interiors of the giant planets - 1983

    International Nuclear Information System (INIS)

    The last few years brought progress in understanding the interiors of the giant planets especially of the two larger ones which have been visited by Pioneer and Voyager spacecraft. An analysis of the formation of the giant planets also helped to clarify certain important common features. The presently available model of Jupiter is still based on certain somewhat bothersome approximations but it appears to satisfy the main observational constraints. Saturn's interior is much better understood than it was previously although the quantitative aspects of the role of the miscibility gap in the hydrogen-helium system have not yet been entirely resolved. Much attention has been directed at the interiors of Uranus and Neptune and the outstanding question appears to be the location and the amount of ices and methane present in their outer layers. Both the two- and the three-layer models are moderately successful. Serious difficulties arise from the considerable uncertainties concerning the rotational periods of both planets. Also the estimates of the internal heat fluxes and of the magnetic fields of both planets are not sufficiently certain. It is hoped that the forthcoming flyby of these two planets by a Voyager spacecraft will provide important new data for a future study of their interiors. (Auth.)

  8. 24 CFR 3280.107 - Interior privacy.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Interior privacy. 3280.107 Section 3280.107 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... DEVELOPMENT MANUFACTURED HOME CONSTRUCTION AND SAFETY STANDARDS Planning Considerations § 3280.107...

  9. 49 CFR 179.12 - Interior heater systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Interior heater systems. 179.12 Section 179.12... Design Requirements § 179.12 Interior heater systems. (a) Interior heater systems shall be of approved... each compartment. (b) Each interior heater system shall be hydrostatically tested at not less than...

  10. A qualidade do ar de interiores e a química Indoor air quality and chemistry

    OpenAIRE

    Leila S. R. Brickus; Aquino Neto, Francisco R

    1999-01-01

    In Brazil, very little experimental work on measurements of indoor air pollutant levels has been done. Nowadays, increasing attention is being given to indoor air quality and the health problems associated with buildings and the indoor work environment. The scope of this paper is to review the major pollutants found in indoor environments and their sources. Subsequently, exposure to indoor air pollutants and health effects are considered. The review concludes by briefly addressing assessment ...

  11. K/Ar dating of diagenetic illite

    International Nuclear Information System (INIS)

    Ascertaining the potassium/argon (K/Ar) age of diagenetic illite yields important information for hydrocarbon exploration since the growth of this mineral in the pores of sandstone reservoir and oil migration are inter linked events in the diagenetic evolution of rocks. Illite was mechanically separated by repeating a series of ultrasonic baths and ultrasonic probes followed by high-speed centrifuging. Resultant fractions were analyzed by X-ray diffractometry to measure the illite content of each sample. The separated illite material was found to be composed of illite and ordered mixed layer illite-smectite with 80% illite layers. Separated fractions were dated radiometrically by the K/Ar method. Preliminary results indicate an average age of some 200 m.y., which marks the end of the diagenetic development of the illite of this area. (author)

  12. A natural laboratory for 40Ar/39Ar geochronology: ICDP cores from Lake Van, Turkey

    Science.gov (United States)

    Engelhardt, Jonathan; Sudo, Masafumi; Oberhänsli, Roland

    2015-04-01

    Pore water samples from ICDP Paleovan cores indicate a limited pore water exchange within Quaternary lake sediments. The core's volcaniclastic sections bear unaltered K-rich ternary feldspar and fresh to altered glass shards of predominantly rhyolitic composition. Whereas applying the 40Ar/39Ar method on feldspars resulted in ages timing a late-stage crystallization, glass shards had the potential to date the eruption. Volcanic glass is prone to modifications such as hydrous alteration (palagonitization) and devitrification (Cerling et al., 1985). These modifications affect the glass' chemistry and challenge the application of the 40Ar/39Ar method. Gaining precise radiometric ages from two phases has the potential to strengthen a climate-stratigraphic age-model (Stockhecke et al., 2014), and to significantly increase the temporal resolution on the deposition of the lake sediments. Vice versa the core's previous age model has the ability to question the reliability of 40Ar/39Ar eruption ages derived from ternary feldspars and glass shards. Multi- and single-grain total fusion on alkali feldspars from six volcaniclastic deposits resulted in Pleistocene ages that are in good agreement with the predicted age model. Feldspar phenocrysts from three ashes in the core's youngest section yielded consistent isochron ages that are significantly older than the model's prediction. Several distinct stratigraphic and paleomagnetic time markers of similar stratigraphic positions contradict to the older radiometric dates (Stockhecke et al., 2014). Partial resorption features of inherited feldspar domains and the involvement of excess 40Ar indicate incomplete degassing of older domains. To evaluate the magmatic history of the different domains EMPA mappings of trace elements that could be interpreted as Ar diffusion couples are currently conducted. Geochronology on Paleovan cores offers unique opportunities to monitor the effect of alteration on the Ar-systematics of volcanic glass

  13. Dicty_cDB: FC-AR02 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR02 (Link to dictyBase) - - - Contig-U15981-1 FC-AR02P (Li...nk to Original site) FC-AR02F 518 FC-AR02Z 247 FC-AR02P 764 - - Show FC-AR02 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR02Q.Seq.d/ Representative seq. ID FC-AR...02P (Link to Original site) Representative DNA sequence >FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR02 (FC-AR02Q) /CSM/FC/FC-AR/FC-AR

  14. Age of the Lava Creek supereruption and magma chamber assembly at Yellowstone based on 40Ar/39Ar and U-Pb dating of sanidine and zircon crystals

    Science.gov (United States)

    Vazquez, J. A.; Matthews, N. E.; Calvert, A. T.

    2015-12-01

    The last supereruption from the Yellowstone Plateau formed Yellowstone caldera and ejected the >1000 km3 of rhyolite that composes the Lava Creek Tuff (LCT). Tephra from the eruption blanketed much of the western United States, and is a key Quaternary chronostratigraphic marker, in particular for dating deposition of mid-Pleistocene glacial and pluvial deposits in western North America. We performed 40Ar/39Ar dating of single sanidines to delimit eruption age, and ion microprobe U-Pb and trace-element analyses of crystal faces on single zircons to characterize magmatic evolution and date near-eruption crystallization, as well as analyses of crystal interiors to date the interval of zircon crystallization. Sanidines from the two LCT members A and B yield an 40Ar/39Ar isochron date of 631 ± 4 ka (2σ). Crystal faces on zircons from both members yield a weighted mean 206Pb/238U date of 627 ± 6 ka (2σ) and have trace element concentrations that vary with eruptive stratigraphy. Zircon interiors yield a weighted mean 206Pb/238U date of 660 ± 6 ka, and reveal reverse and/or oscillatory zoning of trace element concentrations, with many crystals containing high-U concentrations and dark cathodoluminescence (CL) cores. These crystals with high-U cores are possibly sourced from 'defrosting' of melt-impregnated margins of the growing subvolcanic reservoir. LCT sanidines mirror the variation of zircon composition within the eruptive stratigraphy, with crystals from upper LCT-A and basal LCT-B having bright-CL rims with high Ba concentrations, suggesting late crystallization after addition of less evolved silicic magma. The occurrence of distal LCT in stratigraphic sequences marking the Marine Isotope Stage 16-15 transition supports the apparent eruption age of ca. 631 ka. These results reveal that Lava Creek zircons record episodic heating, renewed crystallization, and an overall up-temperature evolution for Yellowstone's subvolcanic reservoir in the 103-104 year interval

  15. Theoretical photoabsorption spectra of Ar n+ clusters

    Science.gov (United States)

    Doltsinis, Nikos L.; Knowles, Peter J.

    2000-08-01

    The photoabsorption spectra of selected Ar n+ clusters ( n=7, 8, 17, 19, 23) have been investigated theoretically using an extended Diatomics-in-Molecules approach including induced dipole - induced dipole and spin-orbit coupling interaction effects. Our calculations at 0 K confirm the experimentally observed spectral red-shift of the visible photoabsorption peak in the region 15Haberland et al., Phys. Rev. Lett. 67 (1991) 3290] by carrying out finite temperature Monte Carlo simulations.

  16. Irradiation of samples for 40Ar/39Ar dating using the Soreq Nuclear Research Center IRR-1 Reactor, Israel

    International Nuclear Information System (INIS)

    A facility for the irradiation of geological samples for 40Ar/39Ar dating has been established at the Israel Research Reactor No.1 (IRR-1). A Cd shielded Al irradiation canister is rotated at a position close to the core. The power of the reactor is usually rated at 4.5 MW and the total neutron flux is 1 to 3 x 1013 n/cm2 x s in the center of the core. The ratio of thermal/fast neutrons has been found to be 2 and K2SO4. The Ar production rations for these are: (36Ar/37Ar)Ca = 2.38(±0.28) x 10-4; (39Ar/37Ar)Ca = 12.1(±3.07) x 10-4; (40Ar/39Ar)k = 1.56(±0.40) x 10-2. Irradiations in the reactor are designed to produce 40Ar*/39Ar>1.6 and 40Aratm/37Ar>0.63. This results in convenient measurements with 40Artotal/39Ar near 1. (author)

  17. Ar-O2 rf plasma diagnostics by mass spectrometry

    International Nuclear Information System (INIS)

    An investigation on the nature, energy and fluxes of the dominant species from an rf 13.56 MHz argon-oxygen plasma is realized using quadrupolar mass spectrometer (QMS). The QMS is sampling the plasma species through the anode space charge, being placed on the grounded electrode. The ion energy distributions of the most important ions in plasma, Ar+, Ar++, ArH+, Ar2+, O2+, O+ are investigated. (authors)

  18. High-spin yrast levels of 38Ar

    NARCIS (Netherlands)

    Aarts, H.J.M.; Engelbertink, G.A.P.; Eggenhuisen, H.H.; Ekström, L.P.

    1979-01-01

    High-spin states of 38Ar have been studied with the 35Cl(α, pγ)38Ar reaction at Eα = 18 MeV and with the 24Mg(16O, 2pγ)38Ar reaction at E(16O) = 38 and 45 MeV. The 38Ar level scheme is obtained with the former reaction from a proton-γ coincidence measurement. Gamma-gamma coincidence, γ-ray angular d

  19. Crater Retention Ages from (4) Vesta Matching Independent Ar-Ar Ages of HED Meteorites

    Science.gov (United States)

    Schmedemann, Nico; Kneissl, Thomas; Ivanov, Boris A.; Michael, Gregory G.; Neukum, Gerhard; Nathues, Andreas; Sierks, Holger; Wagner, Roland; Krohn, Katrin; Le Corre, Lucille; Reddy, Vishnu; Ruesch, Ottaviano; Hiesinger, Harald; Jaumann, Ralf; Raymond, Carol A.; Russell, Christopher T.

    2013-04-01

    In July 2012 the Dawn spacecraft completed its mapping task of the Main Belt asteroid Vesta with a second high altitude mapping orbit. Dawn is now on its way to the dwarf planet (1) Ceres, where it will perform a similar mapping campaign like that at Vesta [1]. The Main Belt is the source region of most impactors in the inner solar system [2,3,4], making it a key region for understanding the early history of our Solar System. In order to determine absolute surface ages from Vesta we derived a crater production function and a chronology function for Vesta. We derived these functions from the respective lunar functions [2] and scaled [5] them to the impact conditions on Vesta [6]. In general we find good agreement between the derived crater production function and the measured crater distribution. However, we also find disagreement between 8 and 15 km crater size, on areas older ~2.2 Ga. Older areas show a steep (~-6 cumulative) slope, which we link to a decaying influence of the vestan collisional family (Vestoids). The lower boundary of 8 km crater size may be explained by fast ejected small spalls and/or a more efficient Yarkovsky effect [7]. This influence is not observed for instance inside the large Rheasilvia basin, which we date with ~2.2 Ga. Since the formation of this basin is believed to be a major source of replenishment of the Vestoids, it's currently observed cratering record is not indicative for the basin formation age in contrast to [8]. The young interior of the Rheasilvia basin is likely a result of repeated resets of the crater retention age due to mass wasting processes on the basin walls. We use topographic heights, which are less affected by mass wasting such as the top of the central peak of the basin as well as proximal ejecta blankets outside the basin to date the formation age of Rheasilvia. For the central peak we derive a surface age of 3.59 (+0.079/-0.18) Ga. The proximal ejecta blanket at the Oppia crater is dated with 3.62 (+0

  20. Dicty_cDB: FC-AR12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR12 (Link to dictyBase) - - - Contig-U15450-1 FC-AR12E (Li...nk to Original site) - - - - - - FC-AR12E 643 Show FC-AR12 Library FC (Link to library) Clone ID FC-AR12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR12Q.Seq.d/ Representative seq. ID FC-AR...12E (Link to Original site) Representative DNA sequence >FC-AR12 (FC-AR12Q) /CSM/FC/FC-AR/FC-AR12Q.Seq....cid sequence KMSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRA AKVLEQLTGQTPVYSKARYTVRSFNIRRNEQIAA

  1. Dicty_cDB: FC-AR03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR03 (Link to dictyBase) - - - Contig-U14922-1 FC-AR03E (Li...nk to Original site) - - - - - - FC-AR03E 619 Show FC-AR03 Library FC (Link to library) Clone ID FC-AR03 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR03Q.Seq.d/ Representative seq. ID FC-AR...03E (Link to Original site) Representative DNA sequence >FC-AR03 (FC-AR03Q) /CSM/FC/FC-AR/FC-AR03Q.Seq....MGELTSAGLSFSSCEIPVRQDIANGYQRLTEVENNIRQGMEDLSNNEQG YFEEGIRDYLRAISSVKELLNDRLDALMSMQNNERNVAAKKEKAAKTTGAKAANMQKEVD DAVRKLTEATTEYEKISASAR

  2. A Competitive Study on the Interior Environment and the Interior Circulation Design of Malaysian Museums and Elderly Satisfaction

    OpenAIRE

    Raed M. Elottol; Azizi Bahauddin

    2011-01-01

    The study explains how the interior environment, the circulation design quality, and visitors’ satisfaction are related in the context of interior environment and design of museums in Malaysia. The research intends to examine the interior circulation design that interacts with the interior environment and space planning in museums. This is to understand the relationship between the elderly visitors’ satisfaction and the interior circulation design. This paper plans to answer critical question...

  3. The thermal history of the Lhasa Block, South Tibetan Plateau based on FTD and Ar-Ar dating

    CERN Document Server

    Yang, T F; Lo Chong Huah; Chung, S L; Tien, R L; Xu, R; Deng, W

    1999-01-01

    Twelve basement samples were collected from South Tibet Plateau for FTD and Ar-Ar analysis to demonstrate their uplifting history since Cenozoic era. The preliminary results from different minerals with different closure temperatures, including apatite and zircon for fission-track dating, and K-feldspar, biotite for Ar-Ar dating, show that at least four stages of thermal history can be recognized in the studied area.

  4. A test of the 40Ar/39Ar age spectrum technique on some terrestrial materials

    Science.gov (United States)

    Lanphere, M.A.; Brent, Dalrymple G.

    1971-01-01

    40Ar/39Ar age spectra were determined for 10 terrestrial rock and mineral samples whose geologic history is known from independent evidence. The spectra for six mineral and whole rock samples, including biotite, feldspar, hornblende, muscovite, and granodiorite, that have experienced post-crystallization heating did not reveal the age of crystallization in any obvious way. Minima in the spectra, however, give reasonable maximum ages for reheating and high-temperature maxima can be interpreted as minimum crystallization ages. High-temperature ages of microcline and albite that have not been reheated are approximately 10% younger than the known crystallization age. Apparently there are no domains in these feldspars that have retained radiogenic 40Ar quantitatively. Spectra from two diabase samples that contain significant quantities of excess argon might mistakenly be interpreted as spectra from reheated samples and do not give the age of emplacement. The 40Ar/39Ar age spectrum technique may be a potentially valuable tool for the study of geologic areas with complex histories, but the interpretation of age spectra from terrestrial samples seems to be more difficult than suggested by some previous studies. ?? 1971.

  5. Recent Advances in Modeling Stellar Interiors

    CERN Document Server

    Guzik, Joyce Ann

    2010-01-01

    Advances in stellar interior modeling are being driven by new data from large-scale surveys and high-precision photometric and spectroscopic observations. Here we focus on single stars in normal evolutionary phases; we will not discuss the many advances in modeling star formation, interacting binaries, supernovae, or neutron stars. We review briefly: 1) updates to input physics of stellar models; 2) progress in two and three-dimensional evolution and hydrodynamic models; 3) insights from oscillation data used to infer stellar interior structure and validate model predictions (asteroseismology). We close by highlighting a few outstanding problems, e.g., the driving mechanisms for hybrid gamma Dor/delta Sct star pulsations, the cause of giant eruptions seen in luminous blue variables such as eta Car and P Cyg, and the solar abundance problem.

  6. The Neutron Star Interior Composition Explorer

    Science.gov (United States)

    Gendreau, Keith C.

    2008-01-01

    The Neutron star Interior Composition Explorer (NICE) will be a Mission of Opportunity dedicated to the study of neutron stars, the only places in the universe where all four fundamental forces of nature are simultaneously in play. NICE will explore the exotic states of matter within neutron stars, revealing their interior and surface compositions through rotation resolved X-ray spectroscopy. Absolute time-referenced data will allow NICE to probe the extreme physical environments associated with neutron stars, leveraging observations across the electromagnetic spectrum to answer decades-old questions about one of the most powerful cosmic accelerators known. Finally, NICE will definitively measure stabilities of pulsars as clocks, with implications for navigation, a pulsar-based timescale, and gravitational-wave detection. NICE will fly on the International Space Station, while GLAST is on orbit and post-RXTE, and will allow for the discovery of new high-energy pulsars and provide continuity in X-ray timing astrophysics.

  7. Recent advances in modeling stellar interiors (u)

    Energy Technology Data Exchange (ETDEWEB)

    Guzik, Joyce Ann [Los Alamos National Laboratory

    2010-01-01

    Advances in stellar interior modeling are being driven by new data from large-scale surveys and high-precision photometric and spectroscopic observations. Here we focus on single stars in normal evolutionary phases; we will not discuss the many advances in modeling star formation, interacting binaries, supernovae, or neutron stars. We review briefly: (1) updates to input physics of stellar models; (2) progress in two and three-dimensional evolution and hydrodynamic models; (3) insights from oscillation data used to infer stellar interior structure and validate model predictions (asteroseismology). We close by highlighting a few outstanding problems, e.g., the driving mechanisms for hybrid {gamma} Dor/{delta} Sct star pulsations, the cause of giant eruptions seen in luminous blue variables such as {eta} Car and P Cyg, and the solar abundance problem.

  8. Constraining Ceres' interior from its Rotational Motion

    CERN Document Server

    Rambaux, Nicolas; Dehant, Véronique; Kuchynka, Petr

    2011-01-01

    Context. Ceres is the most massive body of the asteroid belt and contains about 25 wt.% (weight percent) of water. Understanding its thermal evolution and assessing its current state are major goals of the Dawn Mission. Constraints on internal structure can be inferred from various observations. Especially, detailed knowledge of the rotational motion can help constrain the mass distribution inside the body, which in turn can lead to information on its geophysical history. Aims. We investigate the signature of the interior on the rotational motion of Ceres and discuss possible future measurements performed by the spacecraft Dawn that will help to constrain Ceres' internal structure. Methods. We compute the polar motion, precession-nutation, and length-of-day variations. We estimate the amplitudes of the rigid and non-rigid response for these various motions for models of Ceres interior constrained by recent shape data and surface properties. Results. As a general result, the amplitudes of oscillations in the r...

  9. Interior Models of Uranus and Neptune

    CERN Document Server

    Helled, Ravit; Podolak, Morris; Schubert, Gerald

    2010-01-01

    'Empirical' models (pressure vs. density) of Uranus and Neptune interiors constrained by the gravitational coefficients J_2, J_4, the planetary radii and masses, and Voyager solid-body rotation periods are presented. The empirical pressure-density profiles are then interpreted in terms of physical equations of state of hydrogen, helium, ice (H_2O), and rock (SiO_2) to test the physical plausibility of the models. The compositions of Uranus and Neptune are found to be similar with somewhat different distributions of the high-Z material. The big difference between the two planets is that Neptune requires a non-solar envelope while Uranus is best matched with a solar composition envelope. Our analysis suggests that the heavier elements in both Uranus' and Neptune's interior might increase gradually towards the planetary centers. Indeed it is possible to fit the gravitational moments without sharp compositional transitions.

  10. INTERIOR MODELS OF URANUS AND NEPTUNE

    International Nuclear Information System (INIS)

    'Empirical' models (pressure versus density) of Uranus and Neptune interiors constrained by the gravitational coefficients J2, J4, the planetary radii and masses, and Voyager solid-body rotation periods are presented. The empirical pressure-density profiles are then interpreted in terms of physical equations of state of hydrogen, helium, ice (H2O), and rock (SiO2) to test the physical plausibility of the models. The compositions of Uranus and Neptune are found to be similar with somewhat different distributions of the high-Z material. The big difference between the two planets is that Neptune requires a non-solar envelope, while Uranus is best matched with a solar composition envelope. Our analysis suggests that the heavier elements in both Uranus' and Neptune's interior might increase gradually toward the planetary centers. Indeed it is possible to fit the gravitational moments without sharp compositional transitions.

  11. Solar Interior Rotation and its Variation

    Directory of Open Access Journals (Sweden)

    Howe Rachel

    2009-02-01

    Full Text Available This article surveys the development of observational understanding of the interior rotation of the Sun and its temporal variation over approximately forty years, starting with the 1960s attempts to determine the solar core rotation from oblateness and proceeding through the development of helioseismology to the detailed modern picture of the internal rotation deduced from continuous helioseismic observations during solar cycle 23. After introducing some basic helioseismic concepts, it covers, in turn, the rotation of the core and radiative interior, the “tachocline” shear layer at the base of the convection zone, the differential rotation in the convection zone, the near-surface shear, the pattern of migrating zonal flows known as the torsional oscillation, and the possible temporal variations at the bottom of the convection zone. For each area, the article also briefly explores the relationship between observations and models.

  12. Gravitational Higgs Mechanism in Neutron Star Interiors

    CERN Document Server

    Coates, Andrew; Sotiriou, Thomas P

    2016-01-01

    We suggest that nonminimally coupled scalar fields can lead to modifications of the microphysics in the interiors of relativistic stars. As a concrete example, we consider the generation of a non-zero photon mass in such high-density environments. This is achieved by means of a light gravitational scalar, and the scalarization phase transition in scalar-tensor theories of gravitation. Two distinct models are presented, and phenomenological implications are briefly discussed.

  13. Interiors of the Planets [Book Review

    OpenAIRE

    Stevenson, D. J.

    1981-01-01

    The number of scientists devoted to the problems of planetary interiors (especially for planets other than the Earth) is small, appropriately so in view of the limited data base. However, the recent results from deep space missions together with recent rapid advances in high pressure physics are providing planetary modelers with well-constrained problems and solutions of limited ambiguity. These advances are important and interesting for a wide community of planetary and oth...

  14. DESIGNING TIMELESS PATTERNS FOR INTERIOR TEXTILE INDUSTRIES

    OpenAIRE

    Bashyal, Anita

    2012-01-01

    This project was conducted in collaboration with a Helsinki based design studio, Saara Renvall Design. The task was to design patterns for interior textiles. This thesis describes about the processes that took place during creating the ideas for three different textile patterns. The whole thesis can be divided into two parts. The thesis first describes about a material research which was conducted to gather the information about textile patterns from different periods and ethnic groups. The...

  15. Quantum state of the black hole interior

    CERN Document Server

    Brustein, Ram

    2015-01-01

    If a black hole (BH) is initially in an approximately pure state and it evaporates by a unitary process, then the emitted radiation will be in a highly quantum state. As the purifier of this radiation, the state of the BH interior must also be in some highly quantum state. So that, within the interior region, the mean-field approximation cannot be valid and the state of the BH cannot be described by some semiclassical metric. On this basis, we model the state of the BH interior as a collection of a large number of excitations that are packed into closely spaced but single-occupancy energy levels; a sort-of "Fermi sea" of all light-enough particles. This highly quantum state is surrounded by a semiclassical region that lies close to the horizon and has a non-vanishing energy density. It is shown that such a state looks like a BH from the outside and decays via gravitational pair production in the near-horizon region at a rate that agrees with the Hawking rate. We also consider the fate of a classical object th...

  16. PCX, Interior-Point Linear Programming Solver

    International Nuclear Information System (INIS)

    1 - Description of program or function: PCX solves linear programming problems using the Mehrota predictor-corrector interior-point algorithm. PCX can be called as a subroutine or used in stand-alone mode, with data supplied from an MPS file. The software incorporates modules that can be used separately from the linear programming solver, including a pre-solve routine and data structure definitions. 2 - Methods: The Mehrota predictor-corrector method is a primal-dual interior-point method for linear programming. The starting point is determined from a modified least squares heuristic. Linear systems of equations are solved at each interior-point iteration via a sparse Cholesky algorithm native to the code. A pre-solver is incorporated in the code to eliminate inefficiencies in the user's formulation of the problem. 3 - Restriction on the complexity of the problem: There are no size limitations built into the program. The size of problem solved is limited by RAM and swap space on the user's computer

  17. The interior transmission spectrum in one dimension

    International Nuclear Information System (INIS)

    This paper seeks conditions on acoustic profiles c(x) and b(x) which imply the existence of intervals free of transmission eigenvalues. The existence of intervals free of transmission eigenvalues has important implications in the question of unique recovery of the acoustic profile for inverse acoustic scattering theory using the linear sampling method and for the inverse source problem in thermoacoustic tomography. We examine the interior transmission spectrum relative to two acoustic profiles on the unit interval. This research includes the case when the difference of the two acoustic profiles changes sign and is, to the author's knowledge, the only work to date on the interior transmission spectrum allowing this behavior. It is shown that for a large class of acoustic profiles the transmission spectrum is asymptotically sparse. The spectrum exhibits three distinct types of behavior dependent on the relation of the two acoustic profiles. Numerical examples of each type of behavior are given which show how the transmission eigenvalues are distributed depending on the relation between c(x) and b(x). Our method of study is to reduce the interior transmission problem on [0, 1] to a problem of finding roots of a determinant of fundamental solutions to a Sturm–Liouville problem. The asymptotic expansion of solutions of the Sturm–Liouville problem then allows us to analyze properties of the transmission spectrum for large values of the wavenumber. (paper)

  18. Ar + NO microwave plasmas for Escherichia coli sterilization

    Energy Technology Data Exchange (ETDEWEB)

    Hueso, Jose L; Rico, Victor J; Cotrino, Jose; Gonzalez-Elipe, Agustin R [Instituto de Ciencia de Materiales de Sevilla, Centro Mixto CSIC-Universidad de Sevilla, Centro de Investigaciones Cientificas Isla de la Cartuja, Avda. Americo Vespucio 49, 41092 Sevilla (Spain); Frias, Jose E [Instituto de BioquImica Vegetal y FotosIntesis (IBVF-CSIC). Centro de Investigaciones CientIficas Isla de la Cartuja. Avda Americo Vespucio, 49, 41092 Sevilla (Spain)], E-mail: jhueso@icmse.csic.es

    2008-05-07

    Ar + NO microwave discharges are used for sterilization and the results are compared with additional experiments with Ar, O{sub 2} and N{sub 2}-O{sub 2} plasma mixtures. The NO{sup *} species produced in the Ar-NO mixtures remain up to long distances from the source, thus improving the sterilization efficiency of the process. E. coli individuals exposed to the Ar + NO plasma undergo morphological damage and cell lysis. Combined effects of etching (by O{sup *} and Ar{sup *} species) and UV radiation (from deactivation of NO{sup *} species) are responsible for the higher activity found for this plasma mixture. (fast track communication)

  19. Operation of a Thick Gas Electron Multiplier (THGEM) in Ar, Xe and Ar-Xe

    International Nuclear Information System (INIS)

    We present the results of our recent studies of a Thick Gaseous Electron Multiplier (THGEM)-based detector, operated in Ar, Xe and Ar:Xe (95:5) at various gas pressures. Avalanche-multiplication properties and energy resolution were investigated with soft x-rays for different detector configurations and parameters. Gains above 104 were reached in a double-THGEM detector, at atmospheric pressure, in all gases, in almost all the tested conditions; in Ar:Xe (95:5) similar gains were reached at pressures up to 2 bar. The energy resolution dependence on the gas, pressure, hole geometry and electric fields was studied in detail, yielding in some configurations values below 20% FWHM with 5.9 keV x-rays

  20. MEIS1 functions as a potential AR negative regulator

    International Nuclear Information System (INIS)

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells

  1. Argon defect complexes in low energy Ar irradiated molybdenum

    Energy Technology Data Exchange (ETDEWEB)

    van Veen, A.; Buters, W.T.M.; van der Kolk, G.J.; Caspers, L.M. (Interuniversitair Reactor Instituut, Delft (Netherlands)); Armstrong, T.R. (Victoria Univ., Wellington (New Zealand). Dept. of Physics)

    1982-03-15

    Thermal desorption spectrometry has been used to study the defects created in Mo irradiated along the <110> direction with Ar ions ranging in energy from 0.1 to 2 keV. In addition to monitoring the release of the implanted Ar, additional information has been obtained by decoration of the defects with low energy helium and subsequent monitoring of the helium release. The studies show evidence that the Ar can be trapped in both substitutional sites and in a configuration in which the Ar is associated with vacancies (ArVsub(n), n >= 2). Most of the Ar implanted at high energy is released at approx. equal to 1500 K by thermal vacancy assisted diffusion. Argon trapped closer to the surface is released at lower temperatures via at least three different surface related release mechanisms. Additional results are presented on the interaction of self interstitial atoms (introduced by 100 eV Xe bombardment) with the Ar defects. Substitutional Ar is found to convert to interstitial Ar which seems to be mobile at room temperature. The Ar-vacancy complexes are found to be reduced to substitutional Ar. The results of atomistic calculations of the release mechanisms will also be presented.

  2. MEIS1 functions as a potential AR negative regulator

    Energy Technology Data Exchange (ETDEWEB)

    Cui, Liang [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Department of Urology, Civil Aviation General Hospital/Civil Aviation Medical College of Peking University, Beijing 100123 (China); Li, Mingyang [Department of Gastroenterology, Nan Lou Division, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China); Feng, Fan [Department of Pharmacy, General Hospital of Shenyang Military Command, Shenyang 110016 (China); Yang, Yutao [Beijing Institute for Neuroscience, Capital Medical University, Beijing 100069 (China); Hang, Xingyi [National Scientific Data Sharing Platform for Population and Health, Beijing 100730 (China); Cui, Jiajun, E-mail: cuijn@ucmail.uc.edu [Department of Cancer and Cell Biology, University of Cincinnati College of Medicine, Cincinnati, OH 45267 (United States); Gao, Jiangping, E-mail: jpgao@163.com [Department of Urology, Chinese PLA Medical School/Chinese PLA General Hospital, Beijing 100853 (China)

    2014-10-15

    The androgen receptor (AR) plays critical roles in human prostate carcinoma progression and transformation. However, the activation of AR is regulated by co-regulators. MEIS1 protein, the homeodomain transcription factor, exhibited a decreased level in poor-prognosis prostate tumors. In this study, we investigated a potential interaction between MEIS1 and AR. We found that overexpression of MEIS1 inhibited the AR transcriptional activity and reduced the expression of AR target gene. A potential protein–protein interaction between AR and MEIS1 was identified by the immunoprecipitation and GST pull-down assays. Furthermore, MEIS1 modulated AR cytoplasm/nucleus translocation and the recruitment to androgen response element in prostate specific antigen (PSA) gene promoter sequences. In addition, MEIS1 promoted the recruitment of NCoR and SMRT in the presence of R1881. Finally, MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells. Taken together, our data suggests that MEIS1 functions as a novel AR co-repressor. - Highlights: • A potential interaction was identified between MEIS1 and AR signaling. • Overexpression of MEIS1 reduced the expression of AR target gene. • MEIS1 modulated AR cytoplasm/nucleus translocation. • MEIS1 inhibited the proliferation and anchor-independent growth of LNCaP cells.

  3. 40Ar/39Ar and cosmic ray exposure ages of plagioclase-rich lithic fragments from Apollo 17 regolith, 78461

    Science.gov (United States)

    Das, J. P.; Baldwin, S. L.; Delano, J. W.

    2016-01-01

    Argon isotopic data is used to assess the potential of low-mass samples collected by sample return missions on planetary objects (e.g., Moon, Mars, asteroids), to reveal planetary surface processes. We report the first 40Ar/39Ar ages and 38Ar cosmic ray exposure (CRE) ages, determined for eleven submillimeter-sized (ranging from 0.06 to 1.2 mg) plagioclase-rich lithic fragments from Apollo 17 regolith sample 78461 collected at the base of the Sculptured Hills. Total fusion analysis was used to outgas argon from the lithic fragments. Three different approaches were used to determine 40Ar/39Ar ages and illustrate the sensitivity of age determination to the choice of trapped (40Ar/36Ar)t. 40Ar/39Ar ages range from ~4.0 to 4.4 Ga with one exception (Plag#10). Surface CRE ages, based on 38Ar, range from ~1 to 24 Ma. The relatively young CRE ages suggest recent re-working of the upper few centimeters of the regolith. The CRE ages may result from the effect of downslope movement of materials to the base of the Sculptured Hills from higher elevations. The apparent 40Ar/39Ar age for Plag#10 is >5 Ga and yielded the oldest CRE age (i.e., ~24 Ma). We interpret this data to indicate the presence of parentless 40Ar in Plag#10, originating in the lunar atmosphere and implanted in lunar regolith by solar wind. Based on a chemical mixing model, plagioclase compositions, and 40Ar/39Ar ages, we conclude that lithic fragments originated from Mg-suite of highland rocks, and none were derived from the mare region.

  4. Argon in hornblende, biotite and muscovite in geologic cooling - Ar-40/Ar-39-investigations

    International Nuclear Information System (INIS)

    The results of the Ar-40/Ar-39 studies are discussed under the aspect of whether the age data of the minerals indicate a cooling process. The author hopes that isotope dating of minerals with different closing temperatures will describe the temperature/time history of an area in the temperature range of 600 to 2000C. The findings are analyzed under three aspects: How much do they contribute to the initial methodological question, what do they contribute to the regional geology of the areas investigated, and in what respects do they extent the present knowledge of the geochronological analysis, i.e. its techniques and interpretation. (orig.)

  5. Ar-Ar Dating of Martian Chassignites, NWA2737 and Chassigny, and Nakhlite MIL03346

    Science.gov (United States)

    Bogard, D. D.; Garrison, D. H.

    2006-01-01

    Until recently only three nakhlites and one chassignite had been identified among martian meteorites. These four exhibit very similar radiometric ages and cosmic ray exposure (CRE) ages, indicating that they may have derived from a common location on Mars and were ejected into space by a single impact. This situation is quite different from that of martian shergottites, which exhibit a range of radiometric ages and CRE ages (1). Recently, several new nakhlites and a new martian dunite (NWA2737) have been recognized. Here we report our results of Ar-39-Ar-40 dating for the MIL03346 nakhlite and the NWA2737 "chassignite", along with new results on Chassigny.

  6. Vaporization of the Ar+Ni system

    International Nuclear Information System (INIS)

    Using the 4π multidetector INDRA, collisions between 36Ar and 58Ni have been investigated over a broad bombarding energy range, from 32 to 95 AMeV. The onset for complete vaporization of the system into neutrons, H and He isotopes as well as the evolution with energy of the isotopic composition of the vaporization events were determined. Binary dissipative collisions are found to be the dominant mechanism producing the vaporization events. A statistical sequential decay of the two partners is a possible explanation for the vaporization events observed. (author) 18 refs.; 3 figs

  7. SUMER-IRIS Observations of AR11875

    Science.gov (United States)

    Schmit, Donald; Innes, Davina

    2014-05-01

    We present results of the first joint observing campaign of IRIS and SOHO/SUMER. While the IRIS datasets provide information on the chromosphere and transition region, SUMER provides complementary diagnostics on the corona. On 2013-10-24, we observed an active region, AR11875, and the surrounding plage for approximately 4 hours using rapid-cadence observing programs. These datasets include spectra from a small C -class flare which occurs in conjunction with an Ellerman-bomb type event. Our analysis focusses on how the high spatial resolution and slit jaw imaging capabilities of IRIS shed light on the unresolved structure of transient events in the SUMER catalog.

  8. The Spectroscopic study of 33Ar

    International Nuclear Information System (INIS)

    The proton-rich nucleus 33Ar has been produced at the low-energy facility SPIRAL at GANIL. Spectroscopic studies of gamma and p emission of this nucleus were performed with the 'Silicon Cube' detection system. The analysis of proton and gamma singles and coincidence spectra allowed us to establish a complete decay scheme of this nucleus. The comparison of the Gamow-Teller strength distribution deduced from our experiment and the theoretical one obtained with the Shell Model permitted the determination of a quenching factor for the Gamow-Teller strength.

  9. Dicty_cDB: FC-AR10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR10 (Link to dictyBase) - - - Contig-U15065-1 FC-AR10P (Li...nk to Original site) FC-AR10F 417 FC-AR10Z 438 FC-AR10P 855 - - Show FC-AR10 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR10Q.Seq.d/ Representative seq. ID FC-AR...10P (Link to Original site) Representative DNA sequence >FC-AR10 (FC-AR10Q) /CSM/FC/FC-AR/FC-AR...DILSYI*k*kk*k*kpi*i*i*ik Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR10 (FC-AR

  10. Dicty_cDB: FC-AR05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR05 (Link to dictyBase) - G24049 DDB0188590 Contig-U15127-1 FC-AR...05Z (Link to Original site) - - FC-AR05Z 510 - - - - Show FC-AR05 Library FC (Link to library) Clone ID FC-AR...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR05Q.Se...q.d/ Representative seq. ID FC-AR05Z (Link to Original site) Representative DNA sequence >FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR...C-AS24Q) /CSM/FC/FC-AS/FC-AS24Q.Seq.d/ 381 e-105 FC-AR05 (FC-AR05Q) /CSM/FC/FC-AR/FC-AR05Q.Seq.d/ 381 e-105

  11. Dicty_cDB: FC-AR16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR16 (Link to dictyBase) - - - Contig-U15457-1 FC-AR16E (Li...nk to Original site) - - - - - - FC-AR16E 387 Show FC-AR16 Library FC (Link to library) Clone ID FC-AR16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR16Q.Seq.d/ Representative seq. ID FC-AR...16E (Link to Original site) Representative DNA sequence >FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq....26 0.0 VFG822 (VFG822Q) /CSM/VF/VFG8-A/VFG822Q.Seq.d/ 726 0.0 FC-AR16 (FC-AR16Q) /CSM/FC/FC-AR/FC-AR16Q.Seq.

  12. Dicty_cDB: FC-AR17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR17 (Link to dictyBase) - - - Contig-U15982-1 FC-AR17P (Li...nk to Original site) FC-AR17F 264 FC-AR17Z 543 FC-AR17P 807 - - Show FC-AR17 Library FC (Link to library) Clone ID FC-AR...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR17Q.Seq.d/ Representative seq. ID FC-AR...17P (Link to Original site) Representative DNA sequence >FC-AR17 (FC-AR17Q) /CSM/FC/FC-AR/FC-AR...gy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR17 (FC-AR

  13. Dicty_cDB: FC-AR01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR01 (Link to dictyBase) - - - Contig-U15659-1 FC-AR01Z (Li...nk to Original site) - - FC-AR01Z 467 - - - - Show FC-AR01 Library FC (Link to library) Clone ID FC-AR01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR01Q.Seq.d/ Representative seq. ID FC-AR...01Z (Link to Original site) Representative DNA sequence >FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq....es producing significant alignments: (bits) Value FC-AR01 (FC-AR01Q) /CSM/FC/FC-AR/FC-AR01Q.Seq.d/ 910 0.0 S

  14. Dicty_cDB: FC-AR23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR23 (Link to dictyBase) - - - Contig-U15115-1 FC-AR23Z (Li...nk to Original site) - - FC-AR23Z 557 - - - - Show FC-AR23 Library FC (Link to library) Clone ID FC-AR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR23Q.Seq.d/ Representative seq. ID FC-AR...23Z (Link to Original site) Representative DNA sequence >FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR23Q.Seq....vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR23 (FC-AR23Q) /CSM/FC/FC-AR/FC-AR

  15. Efeito de ciclos de umidade relativa e temperatura do ar na resistência de juntas colodas com lâminas de Eucalyptus grandis W. Hill ex Maiden, Eucalyptus saligna Smith e chapas de fibra de densidade média (MDF Air relative humidity and temperature cycle effects on the resistence of glued joints between bords of Eucalyptus grandis, Eucalyptus saligna and medium density fiberbord (MDF

    Directory of Open Access Journals (Sweden)

    Benedito Rocha Vital

    2005-10-01

    Full Text Available Este trabalho teve como objetivo avaliar o efeito de ciclos de umidade relativa e temperatura do ar na resistência da linha de cola, em juntas coladas entre lâminas de madeira de Eucalyptus grandis, Eucalyptus saligna e lâminas de chapa de fibras de média densidade (MDF cujas densidades foram iguais a 0,60, 0,66, e 0,72g/cm³, respectivamente. Foram empregados adesivos de poliacetato de média viscosidade e uréia-formaldeído nas gramaturas de 150,0g/m² e 180,0g/m², respectivamente, em face simples. O teor médio de umidade no momento da colagem foi igual a 14%. Foram observadas diferenças significativas tanto na resistência da linha de cola quanto na percentagem de falha na madeira provocada pela composição das amostras, etapa de equilíbrio e tipo de adesivo. Os valores mais elevados de resistência foram observados nas juntas coladas com madeira de Eucalyptus saligna após a primeira etapa de equilíbrio, enquanto os menores valores ocorreram nas juntas combinando lâminas de eucalipto e MDF. Considerando apenas as lâminas de madeira, os valores mais elevados de falha na madeira foram observados nas juntas coladas entre lâminas de Eucalyptus grandis. Nas amostras compostas de madeira de eucalipto e lâminas de MDF, a porcentagem de falha foi total e o rompimento ocorreu exclusivamente no interior da chapa de MDF. Observou-se interação significativa entre a composição das amostras lâminas e o tipo de adesivo, em que os valores mais altos de resistência ocorreram nas juntas coladas com madeira de Eucalyptus saligna e adesivo à base de uréia-formaldeído.The objectives of this work was to evaluate the effect of air relative humidity and air temperature cycles on glue line resistance of glued veneer joints of Eucalyptus grandis, Eucalyptus saligna and medium density fiberboard (MDF. Densities of Eucalyptus grandis, Eucalyptus saligna wood and MDF were equal to 0,60, 0.66, e 0.72g/cm³ respectively. Medium viscosity

  16. Burning and browsing effects on willow growth in interior Alaska

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The dominant species in mature forests of interior Alaska is either white spruce (Picea glauca} or black spruce (P. mariana), with wood shrubs present at lower...

  17. The Interior of Numerical Ranges of Op erators

    Institute of Scientific and Technical Information of China (English)

    DOU Yan-ni; LI Chen-xin; LI Rong; DU Hong-ke

    2015-01-01

    In this note, some properties of the interior of numerical ranges of operators are established, and an alternative proof of Embry’s theorem associated with the interior of a numerical ranges of an operator is given(see [3]).

  18. Avian populations and habitat use in interior Alaska taiga

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Avian community structure, habitat occupancy levels, and species habitat use patterns were examined in the woody habitats of interior Alaska taiga. Some birds...

  19. A constructive Galois connection between closure and interior

    OpenAIRE

    Ciraulo, Francesco; Sambin, Giovanni

    2011-01-01

    We construct a Galois connection between closure and interior operators on a given set. All arguments are intuitionistically valid. Our construction is an intuitionistic version of the classical correspondence between closure and interior operators via complement.

  20. New high-precision 40Ar/39Ar ages on Oligocene volcanic rocks of northwestern Kenya

    Science.gov (United States)

    Brown, Francis H.; Jicha, Brian R.

    2016-02-01

    New, high-precision 40Ar/39Ar ages from volcanic rocks in northwestern Kenya are provided for some areas of exposure in this remote area. We report seven 40Ar/39Ar ages generated from single crystal total fusion experiments on alkali feldspar separated from volcanic rocks in the Mogila, Songot, and Lokwanamur Ranges and the Gatome valley. A rhyolite from the lower part of the sequence in the Mogila Range yielded ages of 32.31 ± 0.06 Ma and 32.33 ± 0.07 Ma, and a rhyolite near the top of that sequence yielded 31.67 ± 0.04 Ma. A single sample from the Songot Range yielded an age of 32.49 ± 0.07 Ma, slightly older than the rocks collected from Mogila. In both ranges the early Oligocene rhyolites are underlain by basalts, as is also the case in the Labur Range. Ages of 25.95 ± 0.03 Ma, 25.91 ± 0.04 Ma, and 27.15 ± 0.03 Ma were measured on alkali feldspar from rhyolites from the Lokwanamur Range, and the nearby Gatome valley. All of these rocks are part of an episode of widespread volcanism in northwestern Kenya in the mid-to late Oligocene that is not currently known from the Ethiopian Rift Valley.

  1. Contributions to the 37Ar background by research reactor operations

    International Nuclear Information System (INIS)

    Radioargon has been identified as a useful nuclide for verifying compliance with the Comprehensive Nuclear-Test-Ban Treaty. Use of 37Ar to identify a nuclear explosion requires quantification of contributions to the 37Ar background at a potential measurement site. A method of estimating 37Ar release activities using isotopes of radioxenon and radioargon has been developed in this paper. Numerical solutions to the system of equations describing air-activation in a reactor were used to determine ratios of release activities for 135Xe/133Xe, 133mXe/131mXe, and 37Ar /41Ar as function of irradiation time and off-gas residence time prior to measurement and release. Published radioactive noble gas effluent data for the High Flux Isotope Reactor, HFIR (ORNL) from the year 1996 to 2010 were compiled as a test data set to predict the 37Ar release on a yearly basis. An average 37Ar release rate of 1.86 x 1010 Bq per year was calculated. The estimated release rate was used as a source term for atmospheric transport to run a test case for 37Ar release over a typical HFIR operation cycle. Results showed that ground-level concentrations of 37Ar did not exceed the minimum detectable concentration for a 37Ar field measurement system beyond the immediate vicinity of the release point. (author)

  2. Interior View of Drafting Room in ERB

    Science.gov (United States)

    1942-01-01

    Interior view of Drafting Room in Engine Research Building showing men at work at the Aircraft Engine Research Laboratory. This building was considered the research heart of NACA Lewis. It was built by the Sam W. Emerson Company and was completed in 1942. It is a multipurpose flexible space covering more than 4.25 acres and can be changed according to research priorities. The Aircraft Engine Research Center, Cleveland Ohio, is now known as the John H. Glenn Research Center at Lewis Field.

  3. Interior Structure and Tidal Response of Mercury

    Science.gov (United States)

    Steinke, Teresa; Sohl, Frank; Hussmann, Hauke; Knapmeyer, Martin; Wagner, Frank Walter

    2013-04-01

    Recent determinations of Mercury's mean density, polar moment of inertia factor, and the inertia of its solid outer shell provide strong constraints on the radius of its liquid core. We present an ensemble of spherically symmetric interior structure models that all satisfy the observational constraints. The models consist of a pure iron solid inner core, a liquid Fe-FeS outer core, a peridotite mantle and a crust predominantly composed of plagioclase. The sulfur content in the outer core, the iron and magnesium content of the mantle, and the crustal thickness vary throughout the ensemble. Comparison of observed and predicted moments of inertia yields admissible ranges for the outer core radius and the mantle density. From this model ensemble we derive geophysical observables that would allow further constraining the interior structure of Mercury in future experiments. The moment of inertia constraints allow for both forsterite and fayalite rich mantle compositions. Variations of mantle density trade off with crustal thickness and core composition. This non-uniqueness could be resolved using seismic travel time observations: since the P wave velocity of a fayalite mantle is significantly lower than that of the plagioclase-rich crust, a shadow zone arises as a clear discriminant between the two end-member compositions. The planet's response to solar tidal forcing strongly depends on its interior structure and rheological properties and can be parameterized in terms of the surface body tide Love numbers k2 and h2, respectively. We employ the frequency-dependent Maxwell rheology to calculate the body tide Love numbers for the main tidal period (87.97 days) using the density, rigidity and viscosity profiles of our structural models. We obtain values between 0.38 and 0.65 for k2 and between 0.70 and 1.12 for h2, respectively, thereby indicating the substantial tidal response of Mercury's interior. Furthermore we find that, via viscosity and rigidity, both k2 and h2 are

  4. Interior Models of Uranus and Neptune

    OpenAIRE

    Helled, Ravit; Anderson, John D.; Podolak, Morris; Schubert, Gerald

    2010-01-01

    'Empirical' models (pressure vs. density) of Uranus and Neptune interiors constrained by the gravitational coefficients J_2, J_4, the planetary radii and masses, and Voyager solid-body rotation periods are presented. The empirical pressure-density profiles are then interpreted in terms of physical equations of state of hydrogen, helium, ice (H_2O), and rock (SiO_2) to test the physical plausibility of the models. The compositions of Uranus and Neptune are found to be similar with somewhat dif...

  5. Perspectives on the Interior of the Sun

    Indian Academy of Sciences (India)

    S. Μ. Chitre

    2000-09-01

    The interior of the Sun is not directly accessible to observations. Nonetheless, it is possible to infer the physical conditions inside the Sun with the help of structure equations governing its equilibrium and with the powerful observational tools provided by the neutrino fluxes and oscillation frequencies. The helioseismic data show that the internal constitution of the Sun can be adequately represented by a standard solar model. It turns out that a cooler solar core is not a viable solution for the measured deficit of neutrino fluxes, and the resolution of the solar neutrino puzzle should be sought in the realm of particle physics.

  6. Effects of Light in Interior Landscape Design

    OpenAIRE

    TUNA, Aysun; YAZGAN, Murat Ertuğrul; ALİASGHARİ KHABBAZİ, Parisa

    2015-01-01

    Light, especially sunlight, plays an important role spiritually and materially in our lives today. In the interior design, artificial light is used since the sunlight is not enough for all dimensions of the space and the activities are limited to the morning hours. All plants need for light as an energy source of Photosynthesis. In the lack of light, nutrient material decreases gradually and plant dies. Plants have an inclination to face to the source of light and only in such a case they bec...

  7. 77 FR 45650 - Interior Fire Program Assessment 2012

    Science.gov (United States)

    2012-08-01

    ... Office of the Secretary Interior Fire Program Assessment 2012 AGENCY: Office of Wildland Fire, Interior... Assessment 2012; and (2) potential options being considered as a result of the Interior Fire Program Assessment 2012. DATES: See the SUPPLEMENTARY INFORMATION section of this notice for consultation...

  8. 24 CFR 3285.803 - Interior close-up.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Interior close-up. 3285.803 Section... DEVELOPMENT MODEL MANUFACTURED HOME INSTALLATION STANDARDS Exterior and Interior Close-Up § 3285.803 Interior close-up. (a) All shipping blocking, strapping, or bracing must be removed from appliances, windows,...

  9. Interior design students win two IDEC Student Design Competition awards

    OpenAIRE

    Watson-Bloch, Cathy

    2005-01-01

    Interior Design students in the School of Architecture + Design at Virginia Tech won two of the four awards presented in the 2004-2005 Interior Design Educators Council (IDEC) Student Design Competition. Winners were selected at the International IDEC Conference in Savannah, Ga. with Virginia Tech Interior Design students winning second place and honorable mention.

  10. 49 CFR 38.97 - Interior circulation, handrails and stanchions.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Interior circulation, handrails and stanchions. 38....97 Interior circulation, handrails and stanchions. (a) Where provided, handrails or stanchions within... an accessible entrance. The diameter or width of the gripping surface of interior handrails...

  11. 49 CFR 38.115 - Interior circulation, handrails and stanchions.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Interior circulation, handrails and stanchions. 38... § 38.115 Interior circulation, handrails and stanchions. (a) Where provided, handrails or stanchions... an accessible entrance. The diameter or width of the gripping surface of interior handrails...

  12. Connecting boundary and interior - "Gauss's law" for graphs

    OpenAIRE

    Chan, Ching King; Szeto, Kwok Yip

    2011-01-01

    The Gauss's law, in an abstract sense, is a theorem that relates quantities on the boundary (flux) to the interior (charge) of a surface. An identity for soap froths were proved with the same boundary-interior relation. In this article, we try to construct a definition of flux for other graphs, such that a similar boundary-interior relation can be satisfied.

  13. 49 CFR 238.435 - Interior fittings and surfaces.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Interior fittings and surfaces. 238.435 Section... II Passenger Equipment § 238.435 Interior fittings and surfaces. (a) Each seat back and seat.... (d)(1) Other interior fittings shall be attached to the passenger car body with sufficient...

  14. Asymmetric interiors for small black holes

    CERN Document Server

    Kabat, Daniel

    2016-01-01

    We develop the representation of infalling observers and bulk fields in the CFT as a way to understand the black hole interior in AdS. We first discuss properties of CFT states which are dual to black holes. Then we show that in the presence of a Killing horizon bulk fields can be decomposed into pieces we call ingoing and outgoing. The ingoing field admits a simple operator representation in the CFT, even inside a small black hole at late times, which leads to a simple CFT description of infalling geodesics. This means classical infalling observers will experience the classical geometry in the interior. The outgoing piece of the field is more subtle. In an eternal two-sided geometry it can be represented as an operator on the left CFT. In a stable one-sided geometry it can be described using entanglement via the PR construction. But in an evaporating black hole trans-horizon entanglement changes at the Page time, which means that for old black holes the PR construction fails and the outgoing field does not s...

  15. Department of the Interior Climate Science Centers

    Science.gov (United States)

    Jones, Sonya A.

    2011-01-01

    What is a Climate Science Center? On September 14, 2009, the Secretary of the Interior signed a Secretarial Order (No. 3289) entitled, "Addressing the Impacts of Climate Change on America's Water, Land, and Other Natural and Cultural Resources." The Order effectively established the U.S. Department of the Interior (DOI) Climate Science Centers (CSCs), which will integrate DOI science and management expertise with similar contributions from our partners to provide information to support adaptation and mitigation efforts on both public and private lands, across the United States and internationally.The Southeast CSC, hosted by NC State University (NCSU), will collaborate with a number of other universities, State and Federal agencies, and nongovernmental organizations (NGOs) with interest and expertise in climate science. The primary partner for the Southeast CSC will be the Landscape Conservation Cooperatives (LCCs) in the Southeast, including the Appalachian, Gulf Coastal Plains and Ozarks, Gulf Coast Prairie, Peninsular Florida, and the South Atlantic. CSC collaborations are focused on common science priorities, addressing priority partner needs, minimizing redundancies in science, sharing scientific findings, and expanding understanding of climate change impacts in the Southeast.

  16. Conditional stability for a single interior measurement

    International Nuclear Information System (INIS)

    An inverse problem to identify unknown coefficients of a partial differential equation by a single interior measurement is considered. The equation considered in this paper is a strongly elliptic second order scalar equation which can have complex coefficients in a bounded domain with C2 boundary. We are given a single interior measurement. This means that we know a given solution of the forward equation in this domain. The equation includes some model equations arising from acoustics, viscoelasticity and hydrology. We assume that the coefficients are piecewise analytic. Our major result is the local Hölder stability estimate for identifying the unknown coefficients. If the unknown coefficient is a complex coefficient in the principal part of the equation, we assumed a condition which we name admissibility assumption for the real part and imaginary part of the difference of two complex coefficients. This admissibility assumption is automatically satisfied if the complex coefficients are real valued. For identifying either the real coefficient in the principal part or the coefficient of the 0th order of the equation, the major result implies global uniqueness for the identification. (paper)

  17. Identification and analysis of ARS function of six plant MARs

    Institute of Scientific and Technical Information of China (English)

    LI Hong; YANG Yutao; ZHANG Kewei; ZHENG Chengchao

    2004-01-01

    Six plant MARs isolated from tobacco and Arabdiposis were investigated for their ARS activity in yeast.The results showed that among the six plant MARs, only TM1 and AM4 had strong ARS activity which was almost the same as that of ARS from yeast chromosome. In order to further identify the core region of the two MARs for the ARS activity, a series of subclones were created by PCR strategy,and the corresponding subclones were designated as TM1-1,TM1-2, TM1-3, AM4-1, AM4-2 and AM4-3, respectively. Our studies revealed that TM1-3 and AM4-3 not only had higher ARS activity, but also displayed higher transformation frequency, plasmid stability and growth rate compared to their intact MARs, TM1 and AM4. These data present an important clue for further elucidating the relationship between MAR and ARS.

  18. Plasma AR and abiraterone-resistant prostate cancer.

    Science.gov (United States)

    Romanel, Alessandro; Gasi Tandefelt, Delila; Conteduca, Vincenza; Jayaram, Anuradha; Casiraghi, Nicola; Wetterskog, Daniel; Salvi, Samanta; Amadori, Dino; Zafeiriou, Zafeiris; Rescigno, Pasquale; Bianchini, Diletta; Gurioli, Giorgia; Casadio, Valentina; Carreira, Suzanne; Goodall, Jane; Wingate, Anna; Ferraldeschi, Roberta; Tunariu, Nina; Flohr, Penny; De Giorgi, Ugo; de Bono, Johann S; Demichelis, Francesca; Attard, Gerhardt

    2015-11-01

    Androgen receptor (AR) gene aberrations are rare in prostate cancer before primary hormone treatment but emerge with castration resistance. To determine AR gene status using a minimally invasive assay that could have broad clinical utility, we developed a targeted next-generation sequencing approach amenable to plasma DNA, covering all AR coding bases and genomic regions that are highly informative in prostate cancer. We sequenced 274 plasma samples from 97 castration-resistant prostate cancer patients treated with abiraterone at two institutions. We controlled for normal DNA in patients' circulation and detected a sufficiently high tumor DNA fraction to quantify AR copy number state in 217 samples (80 patients). Detection of AR copy number gain and point mutations in plasma were inversely correlated, supported further by the enrichment of nonsynonymous versus synonymous mutations in AR copy number normal as opposed to AR gain samples. Whereas AR copy number was unchanged from before treatment to progression and no mutant AR alleles showed signal for acquired gain, we observed emergence of T878A or L702H AR amino acid changes in 13% of tumors at progression on abiraterone. Patients with AR gain or T878A or L702H before abiraterone (45%) were 4.9 and 7.8 times less likely to have a ≥50 or ≥90% decline in prostate-specific antigen (PSA), respectively, and had a significantly worse overall [hazard ratio (HR), 7.33; 95% confidence interval (CI), 3.51 to 15.34; P = 1.3 × 10(-9)) and progression-free (HR, 3.73; 95% CI, 2.17 to 6.41; P = 5.6 × 10(-7)) survival. Evaluation of plasma AR by next-generation sequencing could identify cancers with primary resistance to abiraterone. PMID:26537258

  19. Behaviour of AR glass fibre for building structural applications

    OpenAIRE

    Miravete, A.; Mieres, J. M.; Calvo, I; Comino, P.; Chiminelli, A.; Cuatrero, J.; Tolosana, N.

    2005-01-01

    The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be...

  20. Opera ar drama... Aleksejus Kartavovas Vilniuje

    OpenAIRE

    Bakutytė, Vida

    2007-01-01

    Straipsnio objektas – vienas iš reikšmingų laikotarpių Lietuvos profesionalaus teatro meno, ypač muzikinio, raidoje. Ši tema mažai tyrinėta muzikos ir teatro istorikų. Keturis sezonus (1887–1891) Vilniaus miesto teatrui vadovavęs talentingas teatro organizatorius Aleksejus Kartavovas iškėlė Vilniaus sceną į pirmaujančiųjų gretas, suaktyvino operos raidą kokybės linkme. Publikacijos tikslas – atskleisti aplinkybes, padėjusias ar trukdžiusias įgyvendinti A. Kartavovo numatytus planus, išryškint...

  1. Sensibility of different wheat varieties (strains) to Ar+ implantation

    International Nuclear Information System (INIS)

    The sensibility of different wheat varieties (strains) to Ar+ implantation was studied. The results showed that the survival rate of 21 wheat varieties (strains) at the dose of 6 x 1016 Ar+/cm2 could be divided into five groups: surplus sensitive varieties (strains), sensitive varieties (strains), transitional varieties (strains), obtuse varieties (strains) and surplus obtuse varieties (strains). The sensibility of wheat varieties (strains) to Ar+ injection is high-moisture-fertility wheat varieties (strains) > medium-moisture-fertility wheat varieties (strains) > dry land wheat varieties (strains). The study has provided theoretical basis in induced mutation medial lethal dose of different wheat varieties (strains) to Ar+ implantation. (authors)

  2. Practical reactor production of {sup 41}Ar from argon clathrate

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J.R. E-mail: jmercer@pharmacy.ualberta.ca; Duke, M.J.M.; McQuarrie, S.A

    2000-06-01

    The radionuclide {sup 41}Ar has many ideal properties as a gas flow tracer. However, the modest cross-section of {sup 40}Ar for thermal neutron activation makes preparation of suitable activities of {sup 41}Ar technically difficult particularly for low flux reactors. Argon can however be trapped in a molecular complex called a clathrate that can then be irradiated. We prepared argon clathrate and explored its irradiation and stability characteristics. Argon clathrate can be used to provide gigabecquerel quantities of {sup 41}Ar even with low power reactors.

  3. Estudo exploratorio da qualidade do ar em escolas de educacao basica, Coimbra, Portugal

    Directory of Open Access Journals (Sweden)

    Ana Maria Conceicao Ferreira

    2013-12-01

    Full Text Available OBJETIVO : Analisar a qualidade do ar em escolas de educação básica e suas condições estruturais e funcionais. MÉTODOS : Foi avaliada a qualidade do ar de 51 escolas (81 salas de aula de educação básica da cidade de Coimbra, Portugal, tanto na parte interior das salas como na exterior, durante as quatro estações do ano, de 2010 a 2011. Foram avaliadas a temperatura (Tº, umidade relativa (Hr, concentrações de monóxido de carbono (CO, dióxido de carbono (CO 2 , ozona (O 3 , dióxido de nitrogênio (NO 2 , dióxido de enxofre (SO 2 , compostos orgânicos voláteis (COV, formaldeído e material particulado (PM 10 , de novembro de 2010 a fevereiro de 2011 (outono/inverno e de março de 2011 a junho de 2011 (primavera/verão. Procedeu-se ao preenchimento de uma grelha de caracterização das condições estruturais e funcionais das escolas. Aplicaram-se os testes estatísticos t- Student para amostras emparelhadas e o teste t de Wilcoxon. RESULTADOS : Em 47 escolas, as concentrações médias de CO 2 encontravam-se acima da concentração máxima de referência (984 ppm mencionada na legislação portuguesa. Os valores máximos de concentração encontrados no interior das salas foram críticos, principalmente no outono/inverno (5.320 ppm. As concentrações médias de COV e de PM 10 no interior ultrapassaram a concentração máxima de referência legislada em algumas escolas. Não foram detetados valores relevantes (risco de CO, formaldeído, NO 2 , SO 2 e O 3 . CONCLUSÕES : Houve maior concentração de poluentes no interior das salas, comparativamente com o exterior. A inadequada ventilação está associada à elevada concentração de CO 2 nas salas de aula.

  4. Hyperdeformed band in the 36Ar nucleus?

    International Nuclear Information System (INIS)

    Complete text of publication follows. The exotic shapes of atomic nuclei has attracted much attention recently both from the experimental and from the theoretical sides. E.g. the superdeformed (SD) shape in N = Z nuclei were observed experimentally during the last decade. In particular the SD band of the 36Ar nucleus was detected in 2000 [1]. Following the experimental observation a considerable theoretical effort has been concentrated on this band. In [2] e.g. the possible binary clusterizations of this state was studied systematically. Similar studies have been done also for the ground, and the hyperdeformed band. The latter one had been predicted from alphacluster model calculations [3]. The possible binary cluster-configurations are important not only for the better understanding of the structure of the shape isomers, but also from the viewpoint of predicting the favoured reaction channels to populate these states. This is the straightforward consequence of the close relation between the clusterization and reaction channels. (In fact, a cluster-configuration is defined by the reaction channel in which it can be observed.) One of the interesting conclusions of the work [2] was, that the hyperdeformed (HD) state of the 36Ar nucleus could be populated in the 24Mg+12C and 20Ne+16O reactions. A recent analysis of the 24Mg+12C elastic scattering [4] revealed the fact that the cross section can be described only by supposing resonances on top of the potential scattering. This very careful analysis incorporated phase-shift study, as well as Regge-pole and energy-dependent resonance calculations. The existence of five resonances have been proved, which have angular momenta 2, 4, 6, 7, 8. These states together with the resonances from the 20Ne+16O reactions seem to establish a rotational band, as shown in the upper part of Fig. 1. Its moment of inertia is in a very good agreement with that of the HD shape predicted from alpha-cluster model [3]. The similarity of the

  5. Ar-39 - Ar-40 Evidence for an Approximately 4.26 Ga Impact Heating Event on the LL Parent Body

    Science.gov (United States)

    Dixon, E. T.; Bogard, D. D.; Rubin, A. E.

    2003-01-01

    Miller Range 99301 is a type 6, unbrecciated LL chondrite. MIL 99301 is of interest because some compositional and petrographic features suggest it experienced rather high shock grades, whereas other features suggest it is relatively unshocked. Inconsistent shock indicators could be explained if MIL 99301 was shocked but then partly annealed by heat produced by impacts on the parent body. The hypothesis that MIL 99301 experienced high temperature metamorphism (type 6) followed by a later shock event that heated, but did not melt, the constituent feldspar can be evaluated using (39)Ar-(40)Ar chronology. This is because (39)Ar-(40)Ar ages of shocked ordinary chondrites are generally <4.2 Ga, whereas (39)Ar-(40)Ar ages of unshocked meteorites are generally older, and between 4.52 - 4.38 Ga.

  6. Estudo das pressões no interior dos balonetes de tubos traqueais

    Directory of Open Access Journals (Sweden)

    Aranha André Galante Alencar

    2003-01-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: Como não é rotineiro o controle da pressão no interior dos balonetes de tubos traqueais, e não há descrição detalhada na literatura de como mantê-la abaixo dos 30 cmH2O sem utilização de manômetro, decidiu-se verificar as pressões no interior de balonetes de tubos traqueais em pacientes sob intubação traqueal na unidade de terapia intensiva e no cento cirúrgico, testando manobra para manter a pressão no balonete abaixo de 30 cmH2O, mas em níveis mínimos necessários para ciclagem do ventilador sem perda do volume corrente. MÉTODO: Foram estudadas as pressões no interior de balonetes de tubos traqueais de 50 pacientes sob intubação traqueal na unidade de terapia intensiva (Grupo I e 72 pacientes sob intubação traqueal no centro cirúrgico (Grupo II. Testou-se uma manobra para obter a pressão mínima no interior do balonete do tubo traqueal, necessária para adequada ventilação, sem vazamento de ar. Registrou-se a pressão inicial (P1 no interior dos balonetes dos tubos traqueais utilizando-se manômetro digital graduado em centímetros de água, acoplado a seringa de 15 ml. Aspirou-se secreção da orofaringe. Com o meato acústico externo do examinador próximo da boca do paciente entre 10 e 20 cm, conectou-se o manômetro ao balonete, que foi esvaziado lentamente, até se ouvir ruído em sopro, pelo vazamento do volume corrente no período inspiratório da ventilação artificial. Neste momento, encheu-se lentamente o balonete até o desaparecimento do ruído. Anotou-se a pressão final (P2 do balonete e o volume de ar que restou na seringa do manômetro (V. RESULTADOS: As médias das pressões P1 nos grupos I e II foram 85,3 e 56,2 cmH2O, respectivamente. As médias de pressões P2 nos grupos I e II foram 26,7 e 15,5 cmH2O respectivamente. Após a manobra testada, o desvio padrão baixou de 56,3 para 8,2 no grupo I, e de 48 para 6,7 no grupo II. No grupo I, a manobra reduziu o volume e a

  7. Reactivation episodes of the romeral fault system in the northwestern part of central andes, colombia, through 39ar-40ar and k-ar results

    OpenAIRE

    VINASCO VALLEJO, CESAR JAVIER; Cordani, Umberto

    2013-01-01

    Direct dating of reactivation of the San Jerónimo Fault (SJF), easternmost limit of the Romeral fault system (RFS), is presented through 39Ar-40Ar and K-Ar results in neo-formed micas and mylonitic bands of strongly hidrothermalized gabbros. Published cooling and crystallization ages from sin-tectonic magmatic rocks exposed in the western fl ank of the Central Cordillera have suggest that tectonic evolution of the paleo-fault system began since Triassic and Lower Jurassic before the installat...

  8. Geochronological stages of magmatism of Sorsk copper-molybdenum-porphyry are district, Kuznetsk Alatau (K-Ar, Ar-Ar and Rb-Sr methods)

    International Nuclear Information System (INIS)

    Studies on biotite, amphibole and feldspar rocks were conducted through K-Ar, 39Ar-40Ar and Rb-Sr methods for evaluation of geochronological stages of magmatism development of the Sorsk copper-molybdenum-porphyry ore district. It is shown that general duration of magmatism development at the Sorsk district exceeds 100 mln years with intervals between individual magmatic pulses about 30 mln years. Dating by magmatites, related to ore-bearing porphyry complex and ore-metasotamic formations, is within the interval of 380-400 mln years. 13 refs.; 2 figs

  9. Ab Initio Potential Curve for ArH+%ArH+势能曲线的从头计算

    Institute of Scientific and Technical Information of China (English)

    王胜龙; 屈军艳; 郭锐; 赵新生

    2001-01-01

    The molecular parameters of ArH+ have been calculated with different quantum chemistry methods and basis sets.Based on the data from QCISD/Aug cc pVTZ ab initio calculation for different configurations of ArH+ and the experimental data,an accurate potential curve for ArH+ has been constructed.The molecular properties,such as dissociation energy,equilibrium bond length,and vibrational energy levels,can be accurately reproduced.

  10. Particle irradiation and electron work function: Fe single crystal bombarded with Ar+ ions

    Science.gov (United States)

    Horváth, Ákos; Nagy, Norbert; Schiller, Robert

    2016-07-01

    Accelerated Ar+ ions of 30 keV energy were used to mimic the effect of fast neutrons on Fe single crystal. Both Monte-Carlo calculations and X-ray Photoelectron Spectroscopy (XPS) measurements indicated that the fast ions did not alter the surface causing damage only at several nm depth. The change in the electrode potential, characteristic also to corrosion processes, was determined by the Kelvin method of work function measurement in order to avoid any post-irradiation process. Irradiation with fluences between 5×1014 and 6×1015 cm-2 decreased the electrode potential of the sample by about 60 mV in qualitative agreement with earlier results about the work functions of Fe single crystal and polycrystalline sample. Thus ion irradiation turns the interior of the single crystal into a disordered, polycrystalline substance increasing the crystal's readiness to be corroded.

  11. The Neutron Star Interior Composition Explorer (NICER)

    Science.gov (United States)

    Wilson-Hodge, Colleen A.; Gendreau, K.; Arzoumanian, Z.

    2014-01-01

    The Neutron Star Interior Composition Explorer (NICER) is an approved NASA Explorer Mission of Opportunity dedicated to the study of the extraordinary gravitational, electromagnetic, and nuclear-physics environments embodied by neutron stars. Scheduled to be launched in 2016 as an International Space Station payload, NICER will explore the exotic states of matter, using rotation-resolved spectroscopy of the thermal and non-thermal emissions of neutron stars in the soft (0.2-12 keV) X-ray band. Grazing-incidence "concentrator" optics coupled with silicon drift detectors, actively pointed for a full hemisphere of sky coverage, will provide photon-counting spectroscopy and timing registered to GPS time and position, with high throughput and relatively low background. The NICER project plans to implement a Guest Observer Program, which includes competitively selected user targets after the first year of flight operations. I will describe NICER and discuss ideas for potential Be/X-ray binary science.

  12. Wall grid structure for interior scene synthesis

    KAUST Repository

    Xu, Wenzhuo

    2015-02-01

    We present a system for automatically synthesizing a diverse set of semantically valid, and well-arranged 3D interior scenes for a given empty room shape. Unlike existing work on layout synthesis, that typically knows potentially needed 3D models and optimizes their location through cost functions, our technique performs the retrieval and placement of 3D models by discovering the relationships between the room space and the models\\' categories. This is enabled by a new analytical structure, called Wall Grid Structure, which jointly considers the categories and locations of 3D models. Our technique greatly reduces the amount of user intervention and provides users with suggestions and inspirations. We demonstrate the applicability of our approach on three types of scenarios: conference rooms, living rooms and bedrooms.

  13. Magnetic investigations for studying planetary interiors

    Directory of Open Access Journals (Sweden)

    A. De Santis

    1994-06-01

    Full Text Available Most of the magnetic methods used for investigating planetary interiors are based on the reasonable hypothesis that the mechanism for the origin of the field is an Earth-like hydromagnetic dynamo: in this case the planet has an electrically conducting fluid shell within it as in the case of the Earth's core. The present paper describes several techniques of planetary magnetic investigation which give important clues on the internal constitution of planets. Some considerations on the possible mechanisms for maintaining a dynamo and simple concepts with the help of a few non-dimensional numbers are also introduced and discussed. Then some fundamental relationships are given in order to relate the planetary magnetism to other physical parameters, such as angular rotation, core dimensions etc. It finally summarizes some results available for the planets of the Solar System.

  14. On the interior of (quantum) black holes

    International Nuclear Information System (INIS)

    Different approaches to quantum gravity conclude that black holes may possess an inner horizon, in addition to the (quantum corrected) outer ‘Schwarzschild’ horizon. In this Letter we assume the existence of this inner horizon and explain the physical process that might lead to the tunneling of particles through it. It is shown that the tunneling would produce a flux of particles with a spectrum that deviates from the pure thermal one. Under the appropriate approximation the extremely high temperature of this horizon is calculated for an improved quantum black hole. It is argued that the flux of particles tunneled through the horizons affects the dynamics of the black hole interior leading to an endogenous instability

  15. 40Ar-39Ar age of carbonatite-alkaline magmatism in Sung Valley, Maghalaya, India

    Indian Academy of Sciences (India)

    Jyotiranjan S Ray; Kanchan Pande

    2001-09-01

    40Ar-39Ar analyses of one alkali pyroxenite whole rock and two phlogopite separates of calcite carbonatites from the Sung Valley carbonatite-alkaline complex, which is believed to be a part of the Rajmahal-Bengal-Sylhet (RBS) ood basalt province, yielded indistinguishable plateau ages of 108.8 ± 2.0 Ma, 106:4 ± 1.3 Ma and 107.5 ± 1.4 Ma, respectively. The weighted mean of these ages, 107.2 ± 0.8 Ma, is the time of emplacement of this complex. This implies that Sung Valley complex and probably other such complexes in the Assam-Meghalaya Plateau postdate the main ood basalt event (i.e., the eruption of tholeiites) in the RBS province by ∼10 Ma.

  16. Acoustic resonance spectroscopy (ARS): ARS300 operations manual, software version 2.01

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-07-25

    Acoustic Resonance Spectroscopy (ARS) is a nondestructive evaluation technology developed at the Los Alamos National Laboratory. The ARS technique is a fast, safe, and nonintrusive technique that is particularly useful when a large number of objects need to be tested. Any physical object, whether solid, hollow, or fluid filled, has many modes of vibration. These modes of vibration, commonly referred to as the natural resonant modes or resonant frequencies, are determined by the object`s shape, size, and physical properties, such as elastic moduli, speed of sound, and density. If the object is mechanically excited at frequencies corresponding to its characteristic natural vibrational modes, a resonance effect can be observed when small excitation energies produce large amplitude vibrations in the object. At other excitation frequencies, i.e., vibrational response of the object is minimal.

  17. Support for the Astronomically Calibrated 40Ar/39Ar Age of Fish Canyon Sanidine

    DEFF Research Database (Denmark)

    Rivera, Tiffany; Storey, Michael; Zeeden, Christian;

    2011-01-01

    Fish Canyon sanidine (FCs) is the neutron fluence monitor most widely used in Cenozoic argon geochronology. Recommend published ages for FCs have been determined through various intercalibration techniques, but have varied by up to 2% over the last three decades. The robust quality of the...... astronomical timescale, with precision better than 0.1% for the last 10 million years for directly tuned sections, suggests intercalibration with K-bearing minerals intercalated in astronomically tuned stratigraphic sections as the best way to proceed with addressing the true age of FCs. Recently, Kuiper, et...... al. (2008) determined an astronomically calibrated 40Ar/39Ar age of 28.201 0.046 Ma (2), relative to the indirect astronomically tuned Moroccan Melilla Basin Messâdit section. Here, we provide independent verification for the Kuiper, et al. (2008) FCs age using sanidines extracted from the A1 tephra...

  18. 40Ar/39Ar Age of the Lathrop Wells Volcanic Center, Yucca Mountain, Nevada.

    Science.gov (United States)

    Turrin, B D; Champion, D; Fleck, R J

    1991-08-01

    Paleomagnetic and (40)Ar/(39)Ar analyses from the Lathrop Wells volcanic center, Nevada, indicate that two eruptive events have occurred there. The ages (136 +/- 8 and 141 +/- 9 thousand years ago) for these two events are analytically indistinguishable. The small angular difference (4.7 degrees ) between the paleomagnetic directions from these two events suggests they differ in age by only about 100 years. These ages are consistent with the chronology of the surficial geological units in the Yucca Mountain area. These results contradict earlier interpretations of the cinder-cone geomorphology and soil-profile data that suggest that at least five temporally discrete eruptive events occurred at Lathrop Wells approximately 20,000 years ago. PMID:17772371

  19. 40Ar/39Ar dating and paleo-magnetism of traps from Ethiopia, Deccan and Siberia

    International Nuclear Information System (INIS)

    Recent studies have shown that major flood basalt provinces have been emplaced as short events (∼ 1 Myr), more or less synchronous with climatic crises and mass extinctions. We present new geochronologic (40Ar/39Ar) and magneto-stratigraphic results for the Ethiopian traps, one of the last remaining flood basalts for which little of such data were available. The ages obtained in a 2000 m thick section are indistinguishable. Moreover, magneto-stratigraphy reveals a simple 3-chron reverse-normal-reverse sequence. Although magnetic chrons cannot be yet unambiguously identified, there is more likelihood for the normal sub-chron in the main basaltic pile to correspond to 11N, supporting a brief duration (less than 1.5 Ma). The Ethiopian traps erupted near 30 Ma at or near the time of the cold and dry climate, major Antarctic ice sheet advance, and the largest sea-level drop in the Tertiary. Bhandari et al. (GRL, 1995) have discovered inter-traps sediments with a triple iridium anomaly in a series of seven basaltic lava flows in the Kutch area of the North Western Deccan traps of India. Plagioclases from three flows above the iridium bearing sediments yield 39Ar/40Ar plateau ages near 65.0 Ma: these flows have unambiguously reversed magnetic polarity interpreted as chron 29R. As a preliminary summary, evidence of the KTB asteroid impact is confirmed in the Deccan traps, showing that they are coeval events in a general sense (in a Ma long window) though clearly with vastly different time constants. This is compatible with paleontologic evidence of two scales of extinctions, one quasi-instantaneous and the other on the order of 105 to 106 yrs. Clearly, the impact cannot have caused trap eruptions. On the other hand, the exact age and significance of the lower flows more altered remains to be analyzed further as they pertained to the much debated question of duration of Deccan trap volcanism. (author)

  20. 40 Ar/ 39 Ar radiometric dating to constrain the volcanic stratigraphy: The Mt. Etna methodological case.

    OpenAIRE

    De Beni, E.; Istituto Nazionale di Geofisica e Vulcanologia, Sezione Catania, Catania, Italia; Groppelli, G.; Istituto per la Dinamica dei Processi Ambientali–Sezione di Milano, Consiglio Nazionale delle Ricerche, via Mangiagalli 34, 20133 Milano, Italy

    2010-01-01

    Although ~50 radiometric age analyses have been performed on Etna, and there are many historical references, these are not enough to temporally constrain the geo- logical evolution of the volcano. In particular, a new stratigraphic framework based on lithostratigraphic and unconformity-bounded units has pointed out the presence of some stratigraphic uncertainty that can be resolved only with radiometric dating. For this reason, a dating project applying the 40 Ar/ ...

  1. 40Ar/39Ar geochronology and paleomagnetism of Independence volcano, Absaroka volcanic supergroup, Beartooth mountains, Montana

    Science.gov (United States)

    Harlan, S.S.; Snee, L.W.; Geissman, J.W.

    1996-01-01

    Independence volcano is a major volcanic complex in the lower part of the Absaroka Volcanic Supergroup (AVS) of Montana and Wyoming. Recently reported Rb-Sr mineral dates from the complex give apparent ages of 91 and 84 Ma, whereas field relationships and the physical and compositional similarity of the rocks with other dated parts of the AVS indicate an Early to Middle Eocene age for eruption and deposition. To resolve the conflict between age assignments based on stratigraphic correlations and Rb-Sr dates, we report new paleomagnetic data and 40Ar/39Ar dates for Independence volcano. Paleomagnetic data for the stock and an and andesite plug that cuts the stock are well grouped, of reverse polarity, and yield a virtual geomagnetic pole that is essentially identical to Late Cretaceous and Tertiary reference poles. The reverse polarity indicates that the magnetization of these rocks is probably younger than the Cretaceous normal superchron, or less than about 83.5 Ma. Hornblende from a volcanic breccia near the base of the volcanic pile gives a 40Ar/39Ar age of 51.57 Ma, whereas biotites from a dacite sill and a granodiorite stock that forms the core of the volcano give dates that range from 49.96 to 48.50 Ma. These dates record the age of eruption and intrusion of these rocks and clearly show that the age of Independence volcano is Early to Middle Eocene, consistent with stratigraphic relations. We suggest that the Rb-Sr mineral dates from the Independence stock and related intrusions are unreliable.

  2. Arís 2.1: Adapting Arís for Object Oriented Language

    OpenAIRE

    Rahman, Fahrurrozi

    2014-01-01

    In the software development area, software verification is important such that it can guarantee the software fulfills its requirements. Despite its importance, verifying software is difficult to achieve. Additional knowledge and effort are needed to write specification especially if the software is complex and big in size. Nevertheless, there are some software that already have verified specifications. This project will focus on extending Arís (Analogical Reasoning for reuse of Im...

  3. Dicty_cDB: FC-AR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR21 (Link to dictyBase) - - - Contig-U16455-1 FC-AR21Z (Li...nk to Original site) - - FC-AR21Z 528 - - - - Show FC-AR21 Library FC (Link to library) Clone ID FC-AR21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR21Q.Seq.d/ Representative seq. ID FC-AR...21Z (Link to Original site) Representative DNA sequence >FC-AR21 (FC-AR21Q) /CSM/FC/FC-AR/FC-AR21Q.Seq....omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AR21 (FC-AR

  4. Spatial autocorrelation method using AR model; Kukan jiko sokanho eno AR model no tekiyo

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, H.; Obuchi, T.; Saito, T. [Iwate University, Iwate (Japan). Faculty of Engineering

    1996-05-01

    Examination was made about the applicability of the AR model to the spatial autocorrelation (SAC) method, which analyzes the surface wave phase velocity in a microtremor, for the estimation of the underground structure. In this examination, microtremor data recorded in Morioka City, Iwate Prefecture, was used. In the SAC method, a spatial autocorrelation function with the frequency as a variable is determined from microtremor data observed by circular arrays. Then, the Bessel function is adapted to the spatial autocorrelation coefficient with the distance between seismographs as a variable for the determination of the phase velocity. The result of the AR model application in this study and the results of the conventional BPF and FFT method were compared. It was then found that the phase velocities obtained by the BPF and FFT methods were more dispersed than the same obtained by the AR model. The dispersion in the BPF method is attributed to the bandwidth used in the band-pass filter and, in the FFT method, to the impact of the bandwidth on the smoothing of the cross spectrum. 2 refs., 7 figs.

  5. RECONSTRUCTION OF AR DEPTH PROFILES FROM PIXE MEASUREMENTS

    NARCIS (Netherlands)

    OSIPOWICZ, T; LIEW, SC; LOH, KK; ORLIC, [No Value; TANG, SM; WEBER, T

    1994-01-01

    We report on the application of an iterative maximum likelihood algorithm [1] to the reconstruction of depth profiles from PIXE measurements. PIXE spectra of 450 and 800 keV Ar implanted Al samples were taken at 1.5 and 1.3 MeV He+ energy and at angles ranging from 18 to 83-degrees. The measured Ar

  6. Experimental introduction of excess Ar40 into a granitic melt

    Science.gov (United States)

    Fyfe, W.S.; Lanphere, M.A.; Dalrymple, G.B.

    1969-01-01

    Samples of a Precambrian granite were melted in sealed capsules to produce a radiogenic Ar40 atmosphere over the melt. The amount of Ar40 incorporated in the quenched charge was then determined. Under these experimental conditions the amount of argon dissolved in the quenched melt was appreciable and could be an important source of error in potassiumargon dating. ?? 1969 Springer-Verlag.

  7. Aspects of What Makes or Breaks a Museum AR Experience

    DEFF Research Database (Denmark)

    Madsen, Claus B.; Madsen, Jacob Boesen; Morrison, Ann

    2012-01-01

    The paper critically evaluates central aspects of an iPad AR application developed for a museum context. The application is designed for children aged 8 to 12 and mixes AR and mini-game elements to convey dramatized historical events. The game has been deployed for roughly 3 months and the findin...

  8. In Vitro Activity of AR-709 against Streptococcus pneumoniae▿

    OpenAIRE

    Jansen, W.T.M.; Verel, A.; Verhoef, J.; Milatovic, D.

    2008-01-01

    We investigated the in vitro activity of AR-709, a novel diaminopyrimidine antibiotic currently in development for treatment of community-acquired upper and lower respiratory tract infections, against 151 Streptococcus pneumoniae strains from various European countries. AR-709 showed excellent activity against both drug-susceptible and multidrug-resistant pneumococci.

  9. Polycyclic orogeny in Central Ogcheon metamorphic belt, Korea: evidence from 40Ar/39Ar hornblende ages

    International Nuclear Information System (INIS)

    Full text: The Ogcheon fold-thrust belt is one of the key Phanerozoic belts for delineating the regional correlation in East Asia including mainland China and Japan. This NE-trending belt consists of the Ogcheon metamorphic belt (OMB) in the southwest and the Taebaeksan sedimentary zone in the northeast. The OMB comprises Late (?) Proterozoic to Paleozoic metasedimentary and metavolcanic sequences intruded by Mesozoic granitoids. The age of initial intracontinental rifting is constrained to be earlier than 756 Ma by the U-Pb zircon age of a felsic metavolcanic rock (Lee et al., 1998, Precamb. Res. 89, 47-57). Polyphase tectonism in the OMB is characterised by the Middle Paleozoic Ogcheon orogeny responsible for the ductile stacking of thrust nappes and the Triassic Songrim orogeny occurring at shallower depths under the brittle-ductile transitional regime (Cluzel et al., 1990, Tectonophysics, 183, 41-56). Peak metamorphic conditions of the former are in the range of 5-8 kbar and 520-590 deg C, whereas those of the latter are 1-3 kbar and 350-500 deg C (Min and Cho, 1998, Lithos, 43, 31-51). Major ambiguity in the polycyclic model of the OMB results from the lack of isotopic age data. In order to determine the age of peak metamorphism, we analysed hornblende crystals of quartzose amphibole schists in central OMB, using the 40Ar/39Ar dating technique. Mineral assemblages of amphibole schists are represented by calcic amphiboles + plagioclase + epidote ± garnet + quartz + titanite + Fe-Ti oxide (magnetite or ilmenite). Amphibole separates commonly display discordant age spectra. Nevertheless, amphiboles of five analysed samples yield 40Ar/39Ar intercept dates ranging from 432±4 Ma to 499±10 Ma. Three of them yield plateau dates of 440-492 Ma, defined by more than three contiguous steps accounting for >50% of the total 39ArK released. Two of these plateau dates (465±4 Ma and 492±4 Ma) are from hornblende fractions of different grain size in a garnet

  10. 40Ar/39Ar geochronology of the El Teniente porphyry copper deposit

    International Nuclear Information System (INIS)

    breccias. Phyllic alteration primarily occurs as quartz-sericite haloes of quartz-sulfide-sulfate veinlets within the perimeter of the orebody, and slightly overprints potassic alteration. Propylitic alteration occurs largely peripheral to ore-grade rock. The relatively restricted development of phyllic alteration and the occurrence of the central breccia conflict with the classic porphyry copper model of Lowell and Gilbert (1970), but El Teniente may be regarded as a 'variation on a theme' of the classic model, as suggested by Gustafson and Hunt (1975). The exceedingly large size of the El Teniente deposit, coupled with its apparently young mineralization age prompted us to initiate a systematic 40Ar/39Ar study whose goals are to determine the age(s) of the hydrothermal event(s) that produced such a remarkable copper concentration and ultimately to estimate the duration of the hydrothermal activity at El Teniente. This is particularly relevant to an understanding of the processes that formed super-giant high-grade copper deposits in the Chilean Andes and elsewhere. We report here 32 total fusion 40Ar/39Ar ages from sericite and biotite from different lithologic units of El Teniente and five step-heating 40Ar-39Ar ages of samples previously dated using conventional K-Ar methods (Cuadra, 1986) (au)

  11. Ar-40/Ar-39 age constraints for the Jaramillo Normal Subchron and the Matuyama-Brunhes geomagnetic boundary

    Science.gov (United States)

    Izett, Glen A.; Obradovich, John D.

    1994-02-01

    Our mid-Pleistocene Ar-40/Ar-39 age recalibration of the geomagnetic polarity timescale is nearly in accord with the oxygen isotope, climate record calibration of the astronomical timescale proposed by Johnson (1982) and Shackleton et al. (1990). Ar-40/Ar-39 ages of a normally magnetized rhyolite dome in the Valles caldera, northern Mexico, yielded a weighted-mean age of 1.004 +/- 0.019 Ma. A K-Ar age of 0.909 +/- 0.019 Ma for this rock by Doell and Dalrymple (1966) was the linchpin for the recognition and calibration of the Jaramillo Normal Subchron (JNS). Other Ar-40/Ar-39 ages from the Valles caldera and Ar-40/Ar-39 ages of Ivory Coast tektites indicate that the JNS began at about 1.11 Ma and ended before 0.92 Ma, probably near 0.97 Ma. The Matuyama-Brunhes boundary occurred between 0.79 Ma and 0.76 Ma on the basis of Ar-40/Ar-39 sanidine ages from (1) three reversely magnetized rhyolite domes of the Valles caldera (0.793 +/- 0.018 Ma, 0.794 +/- 0.007 Ma, and 0.812 +/- 0.023 Ma) and pumice (0.789 +/- 0.006 Ma) from the reversely magnetized Oldest Toba Tuff of Sumatra and (2) pumice (0.764 +/- 0.005 Ma and 0.757 +/- 0.009 Ma) from the lower and upper units of the normally magnetized Bishop Tuff. The age of the boundary may be close to 0.77 Ma as deduced from rates of sedimentation in ancient Lake Bonneville, Utah.

  12. Eruption age of an approximately 100,000-year-old basalt from Ar-40/Ar-39 analysis of partially degassed xenoliths

    Science.gov (United States)

    Gillespie, A. R.; Huneke, J. C.; Wasserburg, G. J.

    1984-01-01

    Eleven samples from five partially degassed Mesozoic granitic xenoliths and two late Pleistocene host basalt samples from Sawmill Canyon in Sierra Nevada, California, have been analyzed using stepwise Ar-40/Ar-39 dating techniques. The petrography and analytic techniques are described and the results are presented. Isotopic compositions of Ar released from the xenoliths in several extraction steps at temperatures below about 900 C were colinear in Ar-36/Ar-40 versus Ar-39/Ar-40 diagrams and defined isochrons, giving a mean age of degassing of 119,000 + or - 7000 yr. Ar-40 extracted at higher temperatures included ancient radiogenic Ar-40 that never diffused from the xenoliths during immersion in the magma. This Ar-40 caused an increase in the apparent age for the high-temperature extractions. The high precision of the eruption age determined by this method is comparable to that obtained elsewhere by conventional K/Ar dating of sanidine.

  13. Touch interface for markless AR based on Kinect

    Science.gov (United States)

    Hsieh, Ching-Tang; Kuo, Tai-Ku; Wang, Hui-Chun; Wu, Yeh-Kuang; Chang, Liung-Chun

    2014-01-01

    We develop an augmented reality (AR) environment with hidden-marker via touch interface using Kinect device, and then also set up a touch painting game with the AR environment. This environment is similar to that of the touch screen interface which allows user to paint picture on a tabletop with his fingers, and it is designed with depth image information from Kinect device setting up above a tabletop. We incorporate support vector machine (SVM) to classify painted pictures which correspond to the inner data and call out its AR into the tabletop in color images information from Kinect device. Because users can utilize this similar touch interface to control AR, we achieve a marker-less AR and interactive environment.

  14. Synthesis, structural characterization, and spectroscopy of the cadmium-cadmium bonded molecular species Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2).

    Science.gov (United States)

    Zhu, Zhongliang; Fischer, Roland C; Fettinger, James C; Rivard, Eric; Brynda, Marcin; Power, Philip P

    2006-11-29

    The synthesis and first structural characterization of a cadmium-cadmium bonded molecular compound Ar'CdCdAr' (Ar' = C6H3-2,6-(C6H3-2,6-Pri2)2) are reported. The existence of the Cd-Cd bond was established by 113Cd NMR spectroscopy and X-ray diffraction (Cd-Cd = 2.6257(5) A). Like its group 12 analogue Ar'ZnZnAr', DFT calculations showed that Ar'CdCdAr' had significant p-character in the Cd-Cd sigma-bonding HOMO. PMID:17117840

  15. Proton resonance spectroscopy in 36Ar

    International Nuclear Information System (INIS)

    Excitation functions for proton elastic scattering and for proton-induced reactions on 35Cl were measured with the KN Van de Graaff accelerator and associated high resolution system at TUNL. Differential cross sections for 35Cl(p,p0), (p,p1), (p,p2), (p, α0), and (p, α1) were measured in the range Ep = 0.6 to 4.0 MeV. The data were measured at five angles with an overall resolution of about 350 eV. The measured excitation functions were analyzed with a multi-level, multi-channel R-matrix formalism for approximately 200 levels. Resonance parameters were extracted. The resonance parameters included resonance energy, total angular momentum, parity, partial elastic and reaction widths, channel spin or orbital angular momentum mixing ratios, and for some resonances the relative signs of width amplitudes. A number of resonances have strong level-level interference effects. Comparison of these data with the Porter-Thomas distribution resulted in good agreement of almost all channels which had a statistically significant number of resonances. These comparisons indicate that nearly all the proton and alpha strength in 36Ar for this energy range was seen in the present study. The s-wave proton strength function ratio for s = 1 and s = 2 resonances was found to be consistent with previous measurements for 4N nuclei

  16. Mercury's interior from MESSENGER geodetic measurements

    Science.gov (United States)

    Genova, Antonio; Mazarico, Erwan; Goossens, Sander; Lemoine, Frank G.; Neumann, Gregory A.; Smith, David E.; Zuber, Maria T.; Solomon, Sean C.

    2016-04-01

    The MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft completed more than 4 years of operations in orbit about Mercury. One of the main mission goals was the determination of the interior structure of Mercury enabled by geodetic observations of the topography, gravity field, rotation, and tides by the Mercury Laser Altimeter (MLA) and radio science system. MLA acquired over 25 million individual measurements of Mercury's shape that are mostly limited to the northern hemisphere because of MESSENGER's eccentric orbit. However, the lack of laser altimetry in the southern hemisphere has been partly compensated by ˜400 occultations of spacecraft radio signals. X-band radio tracking data collected by the NASA Deep Space Network (DSN) allowed the determination of Mercury's gravity field to spherical harmonic degree and order 100, the planet's obliquity, and the Love number k2. The combination of altimetry and radio measurements provides a powerful tool for the investigation of Mercury's orientation and tides, which enable a better understanding of the interior structure of the planet. The MLA measurements have been assembled into a digital elevation model (DEM) of the northern hemisphere. We then used individual altimetric measurements from the spacecraft for orbit determination, together with the radio tracking, over a continuous span of time using a batch least-squares filter. All observations were combined to recover directly the gravity field coefficients, obliquity, librations, and tides by minimizing the discrepancies between the computed observables and actual measurements. We will present the estimated 100×100 gravity field model, the obliquity, the Love number k2, and, for the first time, the tidal phase lag φ and the amplitude of the longitudinal libration from radio and altimetry data. The k2 phase provides information on Mercury's dissipation and mantle viscosity and allows a determination of the Q factor. A refinement of

  17. Paleomagnetic and 40Ar/39Ar geochronologic data from late Proterozoic mafic dikes and sills, Montana and Wyoming

    Science.gov (United States)

    Harlan, Stephen S.; Geissman, John William; Snee, Lawrence W.

    1997-01-01

    Paleomagnetic and 40Ar/39Ar results from mafic dikes and sills in northwestern Wyoming and western Montana yield similar virtual geomagnetic poles and isotopic dates. In combination with paleomagnetic and geochronologic data from elsewhere in the western Cordillera, these data provide evidence for a regional mafic magnetic event at 780 to 770 Ma that affected a large area of western North America.

  18. 40Ar/39Ar ages of adularia from the Golden Cross, Neavesville, and Komata epithermal deposits, Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar ages of adularia from three epithermal vein deposits in the Hauraki Goldfield constrain when these deposits formed. Adularia from veins at Neavesville has 40Ar/39Ar plateau and isochron ages of 6.89 ± 0.02 and 6.86 ± 0.02 Ma, respectively, similar to the 40Ar/39Ar plateau and isochron ages of adularia from veins at Golden Cross of 6.96 ± 0.04 and 6.93 ± 0.03 Ma, respectively. In contrast, Komata mineralisation formed at 5.99 ± 0.02 to 6.07 ± 0.03 Ma, based on the 40Ar/39Ar isochron and plateau ages of the adularia in these veins, similar to the previously reported 6.0 Ma age of mineralisation at Waihi/Favona. These preliminary data suggest that mineralisation in the Hauraki Goldfields occurred episodically. (author). 19 refs., 3 figs., 1 tab

  19. On Full Disclosure and Transparent Data Flow from 40Ar/39Ar Geochronology Measurements to Data Reduction to Online Repositories

    Science.gov (United States)

    Koppers, A. A. P.

    2015-12-01

    Arguably 40Ar/39Ar geochronology is one of the most versatile techniques available to Earth scientists today for the dating of rocks and minerals and determining the rates of geological processes on Earth and in our solar system. Over the last four decades large quantities of high (and lower) quality 40Ar/39Ar data have been produced using many different generations of mass spectrometry instrumentation. This wealth of data is only as useful as its description and availability of metadata allows. Many online data sets or compilations available in the science literature only carry the resulting product, an age and a related uncertainty in millions of years, for example. These data points are far from desirable as these don't allow recalculation against modern-day age standards, decay constants and other parameters essential in 40Ar/39Ar geochronology. Over time these data will become less useful to the research community and eventually these will be put by the wayside. In this presentation I will emphasize the need for full disclosure of all data and metadata involved in 40Ar/39Ar geochronology. I will give examples of how a complex data flow can be kept transparent from sample preparation to measurement to data reduction and eventually the uploading into online data repositories. Without the full disclosure of our data and a transparent data flow, it is evident that we cannot live up to one of the governing doctrines in the sciences, namely reproducibility of our scientific experiments and findings.

  20. Dicty_cDB: FC-AR11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR11 (Link to dictyBase) - - - Contig-U14938-1 FC-AR11E (Li...nk to Original site) - - - - - - FC-AR11E 918 Show FC-AR11 Library FC (Link to library) Clone ID FC-AR11 (Li... 8.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: mitochondrial 4.0 %: endoplasmic reticulum >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR11Q.Seq.d/ Representative seq. ID FC-AR...11E (Link to Original site) Representative DNA sequence >FC-AR11 (FC-AR11Q) /CSM/FC/FC-AR/FC-AR11Q.Seq.

  1. Dicty_cDB: FC-AR19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR19 (Link to dictyBase) - - - Contig-U16521-1 FC-AR19Z (Li...nk to Original site) - - FC-AR19Z 565 - - - - Show FC-AR19 Library FC (Link to library) Clone ID FC-AR19 (Li... 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR19 is .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR19Q.Seq.d/ Representative seq. ID FC-AR...19Z (Link to Original site) Representative DNA sequence >FC-AR19 (FC-AR19Q) /CSM/FC/FC-AR/FC-AR19Q.Seq.

  2. Dicty_cDB: FC-AR15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR15 (Link to dictyBase) - - - Contig-U16022-1 FC-AR15E (Li...nk to Original site) - - - - - - FC-AR15E 390 Show FC-AR15 Library FC (Link to library) Clone ID FC-AR15 (Li..., including cell wall 4.0 %: vacuolar 4.0 %: mitochondrial >> prediction for FC-AR15 is cyt 5' .../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR15Q.Seq.d/ Representative seq. ID FC-AR...15E (Link to Original site) Representative DNA sequence >FC-AR15 (FC-AR15Q) /CSM/FC/FC-AR/FC-AR15Q.Seq.

  3. Dicty_cDB: FC-AR07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR07 (Link to dictyBase) - - - Contig-U16276-1 FC-AR07Z (Li...nk to Original site) - - FC-AR07Z 604 - - - - Show FC-AR07 Library FC (Link to library) Clone ID FC-AR07 (Li...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: cytoplasmic 36.0 %: nuclear 8.0 %: cytoskeletal 8.0 %: mitochondrial >> prediction for FC-AR.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR07Q.Seq.d/ Representative seq. ID FC-AR...07Z (Link to Original site) Representative DNA sequence >FC-AR07 (FC-AR07Q) /CSM/FC/FC-AR/FC-AR07Q.Seq.

  4. Dicty_cDB: FC-AR24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR24 (Link to dictyBase) - G24050 DDB0191443 Contig-U16141-1 FC-AR...24E (Link to Original site) - - - - - - FC-AR24E 785 Show FC-AR24 Library FC (Link to library) Clone ID FC-AR...sicles of secretory system 4.0 %: cytoskeletal 4.0 %: vacuolar >> prediction for FC-AR...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR24Q.Se...q.d/ Representative seq. ID FC-AR24E (Link to Original site) Representative DNA sequence >FC-AR24 (FC-AR24Q) /CSM/FC/FC-AR/FC-AR

  5. Dicty_cDB: FC-AR13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR13 (Link to dictyBase) - - - Contig-U16456-1 FC-AR13Z (Li...nk to Original site) - - FC-AR13Z 550 - - - - Show FC-AR13 Library FC (Link to library) Clone ID FC-AR13 (Li... 8.0 %: mitochondrial 4.0 %: extracellular, including cell wall >> prediction for FC-AR13 is nuc 5' e.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR13Q.Seq.d/ Representative seq. ID FC-AR...13Z (Link to Original site) Representative DNA sequence >FC-AR13 (FC-AR13Q) /CSM/FC/FC-AR/FC-AR13Q.Seq.

  6. Role of expression techniques in interior architecture education

    OpenAIRE

    Özker, Serpil

    2014-01-01

    The Interior Architecture education is examined based on "sketching and presentation" within the framework of "design" by looking into the application patterns, materials used, education, processes and results of these two methods and by providing relevant examples. In the study discusses the knowledge of design, universities providing education, interior architecture presentation process, perspective and focuses on the role of expression techniques in the interior Architecture education. In ...

  7. Marketing and selling techniques for interior design services

    OpenAIRE

    Çetinkaya, Kaan

    1995-01-01

    Ankara : Department of Interior Architecture and Environmental Design and Institute of Fine Arts of Bilkent University, 1995. Thesis (Master's) -- Bilkent University, 1995. Includes bibliographical references leaves 76-79. Throughout the thesis marketing and selling techniques for interior design services are examined. The emergence of marketing professional services and the reasons that create the needs for marketing interior design services are stated. Methods of analyzing client n...

  8. ``Smoking From The Same Pipe": Developement of an 40Ar/39Ar Datting Intercalibration PIpette System (Invited)

    Science.gov (United States)

    Turrin, B. D.; Swisher, C. C.; Deino, A.; Hemming, S. R.; Hodges, K.; Renne, P. R.

    2010-12-01

    The precision and accuracy of Ar isotope ratio measurements is one of the main limiting factors in the uncertainties of an 40Ar/39Ar age. Currently, it is relatively common to measure Ar isotopic ratios to a precision of 1-2‰ or better on an intralaboratory basis. This level of analytical precision equates to a comparable level of precision (1-3‰) in the calculated age, depending on the extent of atmospheric Ar contamination, importance of nucleogenic interference corrections, and other factors. However, it has become clear that improving the precision of mass spectrometry is not the only bottleneck towards improving the accuracy and precision of 40Ar/39Ar dating in general. Rather, the most urgent issue is interlaboratory reproducibility. This became obvious in a recent EARTHTIME initiative undertaken to intercalibrate two commonly used 40Ar/39Ar standards [the Fish Canyon sanidine (FCs) and the Alder Creek sanidine (ACs)]. This effort revealed variations amongst laboratories (at the 1-2% level), an order of magnitude greater than the internal analytical precisions. To address these issues, we have proposed (to NSF) to construct two identical pipette systems loaded to identical starting pressures and with identical isotopic compositions. One pipette system will travel between participating 40Ar/39Ar labs and the second system will not travel and serve as the “Master” system to test for any fractionation or undocumented depletion of the traveling pipette system. In order to ensure delivery of uniform amounts of homogenous gas, the pipette system will be computer-controlled with preprogrammed routines and lockouts to prevent compromising the reservoirs. The pipette systems will deliver three gas samples with different isotopic ratios at two different pressures/concentrations. One pipette bulb will be of atmospheric isotopic composition, and the other two pipette bulbs will have 40Ar*/39ArK ratios corresponding to co-irradiated ACs and FCs fixed by their

  9. Interior of black holes and information recovery

    Science.gov (United States)

    Kawai, Hikaru; Yokokura, Yuki

    2016-02-01

    We analyze time evolution of a spherically symmetric collapsing matter from a point of view that black holes evaporate by nature. We first consider a spherical thin shell that falls in the metric of an evaporating Schwarzschild black hole of which the radius a (t ) decreases in time. The important point is that the shell can never reach a (t ) but it approaches a (t )-a (t )d/a (t ) d t . This situation holds at any radius because the motion of a shell in a spherically symmetric system is not affected by the outside. In this way, we find that the collapsing matter evaporates without forming a horizon. Nevertheless, a Hawking-like radiation is created in the metric, and the object looks the same as a conventional black hole from the outside. We then discuss how the information of the matter is recovered. We also consider a black hole that is adiabatically grown in the heat bath and obtain the interior metric. We show that it is the self-consistent solution of Gμ ν=8 π G ⟨Tμ ν⟩ and that the four-dimensional Weyl anomaly induces the radiation and a strong angular pressure. Finally, we analyze the internal structures of the charged and the slowly rotating black holes.

  10. Borehole locations on seven interior salt domes

    International Nuclear Information System (INIS)

    This report is designed as an inventory of all wells known to have been drilled within a five-mile radius of each of seven salt domes within the Interior Salt Basin in east Texas, northern Louisiana and Mississippi. There are 72 boreholes that entered salt above an elevation of -3000 feet mean sea level. For these, details of location, drilling dates, depth of casing and cement, elevation of top of caprock and salt, etc., are given on tables in the appendix. Of the seven domes, Oakwood has the largest number of boreholes, thirty-eight (including two sidetracked wells) that enter the salt stock above -3000 feet mean sea level; another dome in northeast Texas, Keechi, has eight; in northern Louisiana, Rayburn's has four and Vacherie has five; in southern Mississippi, Cypress Creek has seven, Lampton has one, and Richton has nine. In addition, all wells known outside the supra-domal area, but within a five-mile radius of the center of the 7 domes are separately catalogued

  11. Full Waveform Inversion of Solar Interior Flows

    CERN Document Server

    Hanasoge, Shravan M

    2014-01-01

    The inference of flows of material in the interior of the Sun is a subject of major interest in helioseismology. Here we apply techniques of Full Waveform Inversion (FWI) to synthetic data to test flow inversions. In this idealized setup, we do not model seismic realization noise, training the focus entirely on the problem of whether a chosen supergranulation flow model can be seismically recovered. We define the misfit functional as a sum of L_2 norm deviations in travel times between prediction and observation, as measured using short-distance f and p_1 filtered and large-distance unfiltered $p$ modes. FWI allows for the introduction of measurements of choice and iteratively improving the background model, while monitoring the evolution of the misfit in all desired categories. Although the misfit is seen to uniformly reduce in all categories, convergence to the true model is very slow, possibly because it is trapped in a local minimum. The primary source of error is inaccurate depth localization, which, owi...

  12. Magnetism and the interior of the moon

    Science.gov (United States)

    Dyal, P.; Parkin, C. W.; Daily, W. D.

    1974-01-01

    During the time period 1961-1972, 11 magnetometers were sent to the moon. The primary purpose of this paper is to review the results of lunar magnetometer data analysis, with emphasis on the lunar interior. Magnetic fields have been measured on the lunar surface at the Apollo 12, 14, 15, and 16 landing sites. The remanent field values at these sites are 38, 103 (maximum), 3, and 327 gammas (maximum), respectively. Simultaneous magnetic field and solar plasma pressure measurements show that the Apollo 12 and 16 remanent fields are compressed during times of high plasma dynamic pressure. Apollo 15 and 16 subsatellite magnetometers have mapped in detail the field above portions of the lunar surface and have placed an upper limit on the global permanent dipole moment. Satellite and surface measurements show strong evidence that the lunar crust is magnetized over much of the lunar globe. Magnetic fields are stronger in highland regions than in mare regions and stronger on the lunar far side than on the near side. The largest magnetic anomaly measured to date is between the craters Van de Graaff and Aitken on the lunar far side.

  13. New 40Ar/39Ar dates of adularia from epithermal deposits in the Hauraki Goldfield, New Zealand

    International Nuclear Information System (INIS)

    New 40Ar/39Ar dates of vein and wall rock adularia from seven epithermal deposits and one porphyry copper prospect help constrain the ages of mineralisation in the Hauraki Goldfield. Vein adularia from the Paritu region yielded a single 40Ar/39Ar plateau date of 16.315 ± 0.066 Ma. Five 40Ar/39Ar plateau dates of three samples of vein adularia from the Opitonui deposit overlap within error to yield a preferred age of 13.149 ± 0.016 Ma. Two samples of vein adularia from the Night Reef at the Broken Hills deposit yield exceptionally flat 40Ar/39Ar plateaus, and all date overlap within error to provide an age of 7.121 ± 0.010 Ma. Two 40Ar/39Ar plateau dates of one sample of vein adularia from the Wharekirauponga deposit overlap within error to provide an age of 6.318 ± 0.061 Ma. Four 40Ar/39Ar plateau dates of three samples of vein adularia from the Maratoto deposit overlap within error to provide an age of 6.411 ± 0.022 Ma. Two samples of adularia from altered wall rock at the Sovereign deposit yield three 40Ar/39Ar plateau dates that range from 6.547 ± 0.021 Ma to 6.806 ± 0.028 Ma. This suggest that mineralisation formed around 6.6 Ma, but the results are complicated because the adularia contains minor illite that post-dates adularia formation. Results from the Karangahake deposit are complex. Two samples of vein adularia yield three 40Ar/39Ar plateau dates that range from 6.116 ± 0.116 Ma to 6.901 ± 0.101 Ma, wheras one sample of wall rock adularia that contains minor late illite yields two 40Ar/39Ar plateau dates that overlap within error to provide a date of 5.734 ± 0.041. The range of dates indicates that more work is necessary to understand the history of mineralisation at this deposit. Two samples of vein adularia from the Tui deposit yield four 40Ar/39Ar plateau dates that overlap within error to provide an age of 5.714 ± 0.017 Ma. These results confirm previous work that indicates that the ages of epithermal deposit young southward in the Hauraki

  14. Recombination measurements at low energies with Ar16+ and Ar18+ ions in a dense, cold electron target

    International Nuclear Information System (INIS)

    Recombination of multiply charged ions with electrons at very low relative energies has become a major topic of interest, due to the observation of rates which are enhanced beyond the expectations for radiative recombination. We present results for Ar16+ and Ar18+ ions from systematic measurements along the argon isonuclear sequence using a high density cold electron beam target (ne = 7 x 109 cm-3) at the UNILAC of GSI. The transverse and longitudinal temperatures of the electron beam were determined from DR resonance features observed with metastable Ar16+ (23S) ions. The rate at Erel = 0 for radiative recombination of completely stripped Ar18+ calculated with electron beam temperatures kTparallel = 0.002 eV, kTperpendicular = 0.2 eV amounts to α = 10-9 cm3 s-1. This is exceeded by nearly a factor of 10 by the rate measured in experiments with Ar18+ ions

  15. Evaluation of the IPCC Models (AR4 and AR5 in the Precipitation Simulation in the Northeast of Brazil

    Directory of Open Access Journals (Sweden)

    José Brabo Alves

    2016-04-01

    Full Text Available With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC, comparative studies are necessary between observations and the so-called historical run (C20 and future projections of the AR4 (A2 and AR5 (RCP8.5 experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5 in representing the anuall average and seasonal rainfall variation (summer and autumn in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  16. Evaluation of the IPCC Models (AR4 and AR5) in the Precipitation Simulation in the Northeast of Brazil

    Science.gov (United States)

    Alves, José; Vasconcelos Junior, Francisco; Chaves, Rosane; Silva, Emerson; Servain, Jacques; Costa, Alexandre; Sombra, Sérgio; Barbosa, Augusto; Dos Santos, Antonio

    2016-04-01

    With the simulations of the models used in the latest reports from the Intergovernmental Panel on Climate Change (IPCC), comparative studies are necessary between observations and the so-called historical run (C20) and future projections of the AR4 (A2) and AR5 (RCP8.5) experiments, in order to assess whether the AR5 models had a better performance in the representation of physical processes. This article compares the sensitivity of IPCC models (AR4 and AR5) in representing the anuall average and seasonal rainfall variation (summer and autumn) in three regions of the Northeast of Brazil between 1979 and 2000, using the CMAP - CPC (Merged Analysis of Precipitation) data as reference. The projections made by these models for the period 2040-2070 were also analyzed.

  17. Advanced Acoustic Blankets for Improved Aircraft Interior Noise Reduction Project

    Data.gov (United States)

    National Aeronautics and Space Administration — In this project advanced acoustic blankets for improved low frequency interior noise control in aircraft will be developed and demonstrated. The improved...

  18. Ar-Ar investigations on Quarternary volcanic sequences of Monte Vulture (Southern Italy)

    Science.gov (United States)

    Buettner, A.; Principe, C.; Villa, I. M.

    2003-04-01

    Volcanic sanidines and phlogopites from feldspathoid- or sanidine-bearing volcanic sequences of Monte Vulture (Southern Italy) were analysed using Ar-Ar stepwise heating. In all samples phlogopite and sanidine are internally inhomogeneous as observed in a plot of Cl/K ratio vs step-age. At least two phases that are degassed during different temperature steps can be distinguished, resulting in internal discordance. Hence, all samples are affected by impurities and have to be treated as heterochemical mixtures. These effects are strongest in phlogopite. The high uncertainty of the calculated ages mirrors the statistically significant age discordance. The calculation of average ages was focused on isochemical steps. Isochron calculations necessarily give less precise ages because of the excessive scatter of datapoints. Moreover, most coarse grained phlogopites could contain excess 40Ar (as suggested by non-atmospheric intercepts in isochron plots) which could be of mantle origin. The analysed phlogopites from carbonatitic and melilite-foiditolite rocks of the upper stratigraphical sequence of Monte Vulture are Mg-rich, which indicates a mantle provenance (Stoppa and Woolley, 1997). All calculated phlogopite ages have, therefore, to be considered with caution. One sample, PG5, contains both sanidine and matrix phlogopite. This offers the possibility to directly compare the analytical results and further decipher possible inconsistencies. Ages were calculated as the average of isochemical steps, and errors are indicated at the 95% confidence level. Sanidine gives a weighted average age of 752±13 ka in agreement with the phlogopite age of 801±88 ka. In comparison to these average step ages, an isochron over five sanidine-steps yields an age of 737±35 ka (MSWD=1.5) and an atmospheric intercept of 295±49. The eruptive time-span covered by the analysed samples is 75±20 ka, confirming that the eruption history of Monte Vulture has been organised in clusters of activity

  19. Toward a high-resolution 40Ar/39Ar geochronology of the Tatun Volcano Group, Taiwan

    Science.gov (United States)

    Mesko, G. T.; Song, S.; Chang, S.; Hemming, S. R.; Turrin, B. D.

    2010-12-01

    The Tatun Volcano Group [TVG] consists of five volcanic subgroups of which ~30 edifices have been identified, all in close proximity to the densely populated Taipei Basin to its south (Song et al., 2000, Journal of the Geological Society of China, in Chinese). Evidence of eruptions is in the form of mostly lava flows, with pyroclastic flows, and ash deposition (Tsai et al., 2010, TAO), consistent with vulcanian and plinian eruptions that are only minimally preserved because of the region’s high weathering rate (Belousov et al., 2010, Journal of Volcanology and Geothermal Research). The TVG is made up of calc-alkaline andesite, with few interspersed basaltic lava flows that bear geochemical signatures consistent with subduction volcanism, yet due to tectonic location Teng (1996, Geology) describes it as Ryukyu back-arc basin volcanism, and still others attribute volcanism here to post-collisional collapse of the Taiwan orogen (Wang et al., 1999, Tectonophysics and 2004, Journal of Petrology). Various TVG samples were previously K-Ar dated by Juang and Chen (1989, Bulletin of Central Geological Survey, in Chinese), Tsao (1994, Bulletin of Central Geological Survey, in Chinese), and 40Ar/39Ar whole rock analyses by Lee (1996, masters thesis, National Taiwan University) to suggest volcanism from 2.8-2.5Ma and then from 1.5-.22Ma after which volcanic events ceased. In contrast, radiocarbon dates obtained from charcoal in related sediment by Chen et al. (2010, TAO) and Belousov et al. (2010, Journal of Volcanology Geothermal Research) suggest volcanic activity was present at 20ka and 6ka respectively. The andesite samples are microcrystalline; therefore hand picked aliquots of groundmass from the hand magnetic fraction were subjected to several iterations of sonic rinse in glycine-based soap, then 4N HNO3, then quartz-distilled water in a preparation modified from Nicolaysen et al. (2000, EPSL). Samples were co-irradiated at the USGS facility in Denver using Alder

  20. A new approach to cosmogenic corrections in 40Ar/39Ar chronometry: Implications for the ages of Martian meteorites

    Science.gov (United States)

    Cassata, W. S.; Borg, L. E.

    2016-08-01

    Anomalously old 40Ar/39Ar ages are commonly obtained from Shergottites and are generally attributed to uncertainties regarding the isotopic composition of the trapped component and/or the presence of excess 40Ar. Old ages can also be obtained if inaccurate corrections for cosmogenic 36Ar are applied. Current methods for making the cosmogenic correction require simplifying assumptions regarding the spatial homogeneity of target elements for cosmogenic production and the distribution of cosmogenic nuclides relative to trapped and reactor-derived Ar isotopes. To mitigate uncertainties arising from these assumptions, a new cosmogenic correction approach utilizing the exposure age determined on an un-irradiated aliquot and step-wise production rate estimates that account for spatial variations in Ca and K is described. Data obtained from NWA 4468 and an unofficial pairing of NWA 2975, which yield anomalously old ages when corrected for cosmogenic 36Ar using conventional techniques, are used to illustrate the efficacy of this new approach. For these samples, anomalous age determinations are rectified solely by the improved cosmogenic correction technique described herein. Ages of 188 ± 17 and 184 ± 17 Ma are obtained for NWA 4468 and NWA 2975, respectively, both of which are indistinguishable from ages obtained by other radioisotopic systems. For other Shergottites that have multiple trapped components, have experienced diffusive loss of Ar, or contain excess Ar, more accurate cosmogenic corrections may aid in the interpretation of anomalous ages. The trapped 40Ar/36Ar ratios inferred from inverse isochron diagrams obtained from NWA 4468 and NWA 2975 are significantly lower than the Martian atmospheric value, and may represent upper mantle or crustal components.

  1. Ar Ar dating of authigenic K-feldspar: Quantitative modelling of radiogenic argon-loss through subgrain boundary networks

    Science.gov (United States)

    Mark, D. F.; Kelley, S. P.; Lee, M. R.; Parnell, J.; Sherlock, S. C.; Brown, D. J.

    2008-06-01

    We have analysed two distinct generations of authigenic K-feldspar in Fucoid Bed sandstones from An-t-Sron and Skiag Bridge, NW Highlands, Scotland, which have experienced post-growth heating to levels in excess of the predicted Ar-closure temperature. Authigenic K-feldspars show microtextural similarities to patch perthites; that is subgrains separated by dislocation-rich boundary networks that potentially act as fast diffusion pathways for radiogenic argon. The two generations of authigenic K-feldspar in the Fucoid Bed sandstones can be distinguished by different microtextural zones, bulk mineral compositions, fluid-inclusion populations, and inferred temperatures and chemistries of parent fluids. Ar-Ar age data obtained using high-resolution ultraviolet laser ablation, show that the first cementing generation is Ordovician and the second cementing generation is Silurian. Modelling of Ar diffusion using subgrain size as the effective diffusion dimension and a simplified tectono-thermal thrust model assuming transient heating of the Fucoid Beds is inconsistent with observed data. Removal of heat from the thrust zone through rapid flushing of heated fluids rather than transient heating can be invoked to explain the observed Ar-Ar ages for both generations of cement. Alternatively, Ar-diffusion modelling using overgrowth thickness as the effective diffusion dimension instead of subgrain size also yields models that are consistent with both the Fucoid Bed palaeothermal maxima and determined Ar-Ar age ages for the two generations of K-feldspar cement. Based on this alternate explanation, we propose a theoretical microtextural model that highlights fundamental differences between the microtextures of deuterically formed patch perthites and authigenic K-feldspars, explaining the apparent robustness of authigenic K-feldspar with respect to Ar-retention.

  2. Surface modification and biocompatible improvement of polystyrene film by Ar, O2 and Ar + O2 plasma

    International Nuclear Information System (INIS)

    Highlights: ► NVP is successfully grafted onto the different discharge gases (Ar, O2, and Ar + O2) plasma-treated PS film surface by Ar plasma induced graft polymerization. ► Compare with Ar and O2 plasma, the Ar + O2 plasma-treated film surface introduced large amounts of NVP, as known from ATR-FTIR and XPS results. ► According to SEM, the surface roughness increased at different levels after plasma treatment. Contact angle reveal that the hydrophilicity of the PS film surface was greatly improved. ► Cellular compatibility tests indicate that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. - Abstract: This paper reports the surface modification of different discharge gases (Ar, O2, and Ar + O2) plasma-treated polystyrene (PS) film by Ar plasma induced graft polymerization, with biocompatible monomer N-vinyl-2-pyrrolidone (NVP) is carried out to improve biocompatibility. The films are characterized by attenuated total reflectance Fourier transfer infrared (ATR-FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS) and scanning electron microscopy (SEM). Water contact angle measurement demonstrates the modified films possess a relatively hydrophilic surface. Furthermore, the films are also examined cell attachment and proliferation in vitro using mouse fibroblasts (L929 cells). The modified film surface shows a better cell distribution and growth than that of the pristine PS surface. From cell culture experiments, it is also observed that Ar + O2 plasma is more capable of increasing cell adhesion and proliferation. This method will provide a potential and effective solution for grafting useful component in future tissue-engineering applications.

  3. High-precision 40Ar/39Ar age for the Jehol Biota

    Science.gov (United States)

    Chang, S.; Zhang, H.; Renne, P. R.; Fang, Y.

    2008-12-01

    Abundant fossils of the terrestrial Jehol Biota, including plants, insects, dinosaurs, birds, mammals and freshwater invertebrates, were discovered from the Yixian Formation and the overlying Jiufotang Formation in Inner Mongolia, Hebei Province and Liaoning Province, northeastern China. Because of the exceptional preservation of fossils, the Jehol Biota is one of the most important Mesozoic fossil outcrops and referred to as a "Mesozoic Pompeii". The Jehol Biota has provided a rare opportunity to address questions about the origin of birds, the evolution of feathers and flight, the early diversification of angiosperms and the timing of the radiation of placental mammals. The Tuchengzi Formation, which lies unconformably just below the Yixian Formation and consists mainly of variegated sandstones, is less fossiliferous than the two overlying formations. However, dinosaur tracks, silicified wood and compressed plants are found in this formation. A systematic 40Ar/39Ar dating of the Yixian and the Jiufotang formations was undertaken to provide a framework for understanding the timing and duration of the Jehol Biota and evolutionary events represented within it. Furthermore, determining the absolute age of the Tuchengzi Formation provides information to interpret abundant dinosaur tracks within and provide better age constrains for the beginning of the Jehol Biota. Here we present robust high-precision 40Ar/39Ar data for six tuff samples and two basalt samples collected from the Tuchengzi, the Yixian and the Jiufotang formations near the classic outcrops in western Liaoning, NE China. We obtain an age of 139.5 ± 1.0 Ma for the uppermost Tuchengzi Formation, an age of 129.7 ± 0.5 Ma for a basaltic lava from the bottom of the Yixian Formation and an age of 122.1 ± 0.3 Ma for a tuff from the base of the overlying Jiufotang Formation. Our data indicate that the Yixian Formation was deposited during the Early Cretaceous, the Barremian to early Aptian, within a time span

  4. New 40Ar/39Ar Ages From Southwest Bolivia Refine the Timing of APVC Volcanism

    Science.gov (United States)

    Salisbury, M.; de Silva, S. L.; Jicha, B.; Singer, B.; Jiménez, N.; Ort, M.

    2008-12-01

    The Altiplano-Puna Volcanic Complex (APVC) of the Central Andes has produced prodigious silicic volcanism (at least 11,000 km3 of magma) over the last 10 Ma including some of the largest known ignimbrites on Earth. Despite excellent exposure, little previous work had been conducted on the timing and distribution of ignimbrite volcanism in the Lípez region of southwestern Bolivia, the heart of the APVC. To address this deficiency we have performed ~612 single crystal laser-fusion 40Ar/39Ar analyses from 39 pumice and bulk matrix samples collected from the main ignimbrite units within the Lípez region. Geochemistry of pumice and mineral samples, and paleomagnetic data are also being used to correlate individual ignimbrite units. Our new 40Ar/39Ar results establish new or refined eruption ages (with 2σ error) from the Vilama caldera at 8.41±0.02 Ma, Pastos Grandes caldera at 5.45±0.02 and 2.94±0.01 Ma, and Guacha caldera at 5.65±0.01, and 3.57±0.02 Ma. New ages were also determined for eruptions from the Panizos ignimbrite shield (6.86±0.03 Ma), Juvina ignimbrite shield (5.23±0.01 Ma), and the Laguna Colorado ignimbrite shield (2.21±0.05 and 1.95±0.03 Ma). The oldest ignimbrite we have found in the area is 10.33±0.64 Ma, a local unit beneath the Vilama ignimbrite. The youngest units have been identified west of the Guacha caldera with eruption ages of 1.70±0.6 Ma and 0.70±0.01 Ma. These results demonstrate that ignimbrite-producing eruptions in the Lípez region span the age of APVC volcanism previously established, with the largest eruptions occurring from long-lived, cyclic supervolcano caldera systems like Guacha and Pastos Grandes. The aggregate data from the APVC support the hypothesis that the APVC developed predominantly during distinct pulses of massive ignimbrite eruptions at ~8, 6, and 4 Ma and attest to episodic behavior of the magmatic system. Ignimbrites of geothermal presence and active local surface deformation suggest that the magma

  5. Expression of ER and AR in lung cancer

    Directory of Open Access Journals (Sweden)

    Shuling WANG

    2008-02-01

    Full Text Available Background and objective Epidemiology of lung cancer differs between sexes and it might be partially explained by different sex hormone levels in women and men. There are some epidemiological data indicating that gender is a significant, independent prognostic factor in lung cancer. The aim of this study is to determine expression of ER (estrogen receptor and AR (androgen receptor in lung cancer, and evaluate the relationship between their expression and clinical or pathologic characteristics. Methods Immunohistochemistry assay was used to detect expression of ER and AR. Results Positive expression of ER and AR were 14.3%(15/105 and 20%(21/105. Positive expression of ER had no relationship with age, gender, pathology, histological differentiation, TNM staging, size of tumor and lymph node metastasis. Although age, gender, pathology, histological differentiation and size of tumor had no effect on the expression of AR, positive rate of AR in staging III lung cancer was significantly higher than that in staging I lung cancer. The different AR expression was significant between N0 and N2 lymph node metastasis ( Chisquare= 4.7828,P=0.0287. Conclusion The expression of ER has no relationship with biological behavior. Positive expression of AR may be correlated with the progression and the lymph node metastasis of lung cancer.

  6. Molecular modeling of the effects of 40Ar recoil in illite particles on their K-Ar isotope dating

    Science.gov (United States)

    Szczerba, Marek; Derkowski, Arkadiusz; Kalinichev, Andrey G.; Środoń, Jan

    2015-06-01

    The radioactive decay of 40K to 40Ar is the basis of isotope age determination of micaceous clay minerals formed during diagenesis. The difference in K-Ar ages between fine and coarse grained illite particles has been interpreted using detrital-authigenic components system, its crystallization history or post-crystallization diffusion. Yet another mechanism should also be considered: natural 40Ar recoil. Whether this recoil mechanism can result in a significant enough loss of 40Ar to provide observable decrease of K-Ar age of the finest illite crystallites at diagenetic temperatures - is the primary objective of this study which is based on molecular dynamics (MD) computer simulations. All the simulations were performed for the same kinetic energy (initial velocity) of the 40Ar atom, but for varying recoil angles that cover the entire range of their possible values. The results show that 40Ar recoil can lead to various deformations of the illite structure, often accompanied by the displacement of OH groups or breaking of the Si-O bonds. Depending on the recoil angle, there are four possible final positions of the 40Ar atom with respect to the 2:1 layer at the end of the simulation: it can remain in the interlayer space or end up in the closest tetrahedral, octahedral or the opposite tetrahedral sheet. No simulation angles were found for which the 40Ar atom after recoil passes completely through the 2:1 layer. The energy barrier for 40Ar passing through the hexagonal cavity from the tetrahedral sheet into the interlayer was calculated to be 17 kcal/mol. This reaction is strongly exothermic, therefore there is almost no possibility for 40Ar to remain in the tetrahedral sheet of the 2:1 layer over geological time periods. It will either leave the crystal, if close enough to the edge, or return to the interlayer space. On the other hand, if 40Ar ends up in the octahedral sheet after recoil, a substantially higher energy barrier of 55 kcal/mol prevents it from leaving

  7. Visualizing interior and exterior jet aircraft noise

    Science.gov (United States)

    Moondra, Manmohan S.

    In today's competitive aerospace industry, the quest for quiet has drawn significant attention to both the interior and exterior design of an airplane. Understanding the noise generation mechanisms of a jet aircraft is a crucial first step toward developing the most cost-effective noise and vibrations abatement methods. In this investigation, the Helmholtz Equation Least Squares (HELS) based nearfield acoustic holography will be used to understand noise transmission caused by jet engine and turbulence into the fuselage of a jet aircraft cruising at 30,000 ft. Modern propulsive jet engines produce exterior noise sources with a high amplitude noise field and complicated characteristics, which makes them very difficult to characterize. In particular, there are turbulent eddies that are moving through the jet at high speeds along the jet boundary. These turbulent eddies in the shear layer produce a directional and frequency dependent noise. The original HELS approach assumes a spherical source at the origin and computes the acoustic field based on spherical emission from this source. This assumption of one source at the origin is not sufficient to characterize a complex source like a jet. As such, a modified HELS approach is introduced that will help improve the source characterization as it is not dependent on a single source at the origin but a number of virtual sources throughout the space. Custom microphones are created to take acoustic pressure measurements around the jet engine. These measured acoustic pressures are then taken as input to the modified HELS algorithm to visualize the noise pattern of a subsonic jet engine.

  8. Full waveform inversion of solar interior flows

    International Nuclear Information System (INIS)

    The inference of flows of material in the interior of the Sun is a subject of major interest in helioseismology. Here, we apply techniques of full waveform inversion (FWI) to synthetic data to test flow inversions. In this idealized setup, we do not model seismic realization noise, training the focus entirely on the problem of whether a chosen supergranulation flow model can be seismically recovered. We define the misfit functional as a sum of L 2 norm deviations in travel times between prediction and observation, as measured using short-distance filtered f and p 1 and large-distance unfiltered p modes. FWI allows for the introduction of measurements of choice and iteratively improving the background model, while monitoring the evolution of the misfit in all desired categories. Although the misfit is seen to uniformly reduce in all categories, convergence to the true model is very slow, possibly because it is trapped in a local minimum. The primary source of error is inaccurate depth localization, which, due to density stratification, leads to wrong ratios of horizontal and vertical flow velocities (cross talk). In the present formulation, the lack of sufficient temporal frequency and spatial resolution makes it difficult to accurately localize flow profiles at depth. We therefore suggest that the most efficient way to discover the global minimum is to perform a probabilistic forward search, involving calculating the misfit associated with a broad range of models (generated, for instance, by a Monte Carlo algorithm) and locating the deepest minimum. Such techniques possess the added advantage of being able to quantify model uncertainty as well as realization noise (data uncertainty).

  9. A Survey on Web-based AR Applications

    CERN Document Server

    Parhizkar, Behrang; Lashkari, Arash Habibi; Bartaripou, Mohammad Mehdi; Babae, Hossein Reza

    2011-01-01

    Due to the increase of interest in Augmented Reality (AR), the potential uses of AR are increasing also. It can benefit the user in various fields such as education, business, medicine, and other. Augmented Reality supports the real environment with synthetic environment to give more details and meaning to the objects in the real word. AR refers to a situation in which the goal is to supplement a user's perception of the real-world through the addition of virtual objects. This paper is an attempt to make a survey of web-based Augmented Reality applications and make a comparison among them.

  10. Wellness- joogatyöpajojen tuotekehitys: case ArsMondo

    OpenAIRE

    Koukonen, Heidi; Lintunen, Maiju

    2012-01-01

    Tässä opinnäytetyössä tutkitaan, miten ArsMondo Oy:n joogamatkoja voisi kehittää entistä asiakaslähtöisempään suuntaan tulevaisuudessa. Aihe valittiin, sillä se on erittäin mielenkiintoinen ja ajankohtainen aihe matkailun alalla. ArsMondo on suomalainen kulttuurialan yritys, joka räätälöi kulttuuri- ja liikuntamatkoja Italiaan. Työ rajattiin vain ArsMondo- yrityksen joogamatkoihin Italiassa. Teoreettisessa viitekehyksessä avataan jooga- wellness- matkailun käsite sekä kerrotaan wellness- ...

  11. Mass Spectrometric and Langmuir Probe Measurements in Inductively Coupled Plasmas in Ar, CHF3/Ar and CHF3/Ar/O2 Mixtures

    Science.gov (United States)

    Kim, J. S.; Rao, M. V. V. S.; Cappelli, M. A.; Sharma, S. P.; Meyyappan, M.; Arnold, Jim (Technical Monitor)

    2000-01-01

    Absolute fluxes and energy distributions of ions in inductively coupled plasmas of Ar, CHF3/Ar, and CHF3/Ar/O2 have been measured. These plasmas were generated in a Gaseous Electronics Conference (GEC) cell modified for inductive coupling at pressures 10-50 mTorr and 100-300 W of 13.56 MHz radio frequency (RF) power in various feedgas mixtures. In pure Ar plasmas, the Ar(+) flux increases linearly with pressure as well as RF-power. Total ion flux in CHF3 mixtures decreases with increase in pressure and also CHF3 concentration. Relative ion fluxes observed in the present studies are analyzed with the help of available cross sections for electron impact ionization and charge-exchange ion-molecule reactions. Measurements of plasma potential, electron and ion number densities, electron energy distribution function, and mean electron energy have also been made in the center of the plasma with a RF compensated Langmuir probe. Plasma potential values are compared with the mean ion energies determined from the measured ion energy distributions and are consistent. Electron temperature, plasma potential, and mean ion energy vary inversely with pressure, but increase with CHF3 content in the mixture.

  12. 40Ar-39Ar dating of Luna 16 and Luna 20 samples

    International Nuclear Information System (INIS)

    Two fragments of Luna 16 mare basalt and two Luna 20 samples (one metaclastic fragment and a group of five anorthositic particles) from the Royal Society allocation have been dated by using the 40Ar-39Ar technique. The Luna 16 ages confirm that mare lavas were extruded in Mare Fecunditatis 3.4 to 3.5 Ga ago. Similarly, the age of the Luna 20 metaclastic fragment provides further support for a 3.9 Ga age for the Crisium basin and for the widespread cataclysmic bombardment of the moon between 4.05 and 3.85 Ga. The presence of at least two isotopically distinct, non-radiogenic argon components in the Luna 20 anorthositic sample comprises an unequivocal age assignment but the simplest model leads to a plateau age of 4.40 +- 0.10 Ga and a minimum age of 4.30 +- 0.10 Ga. There are now several lunar highland samples which are significantly older than 4.0 Ga and which give rise to a secondary age grouping in the interval 4.2 to 4.3 Ga. Depending on whether highland ages were primarily reset during the excavation of a large number of medium-sized craters or a small number of large basins, this secondary grouping implies either a significant peak in the cratering rate at 4.0 Ga or statistical fluctuations in a monotonically decreasing cratering rate. (author)

  13. Geology and 40Ar/39Ar Geochronology of Akutan Volcano, Eastern Aleutian Islands

    Science.gov (United States)

    Coombs, M. L.; Jicha, B. R.

    2013-12-01

    40Ar/39Ar dating and new whole-rock geochemical analyses are used to establish an eruptive chronology for Akutan volcano, Akutan Island, in the eastern Aleutian island arc. Akutan Island (166° W, 54.1° N) is the site of long-lived volcanism and the entire island comprises volcanic rocks as old as 3.3 Ma (Richter et al., 1998, USGS Open-File 98-135). Our current focus is on the 225 km2 western half of the island, which is home to the Holocene active cone, Holocene to latest Pleistocene satellite vents, and underlying middle Pleistocene volcanic basement rocks. Eruptive products span the tholeiitic-calc-alkaline boundary, are medium-K, and range from basalt to dacite. Furnace incremental heating experiments on groundmass separates of 38 samples resulted in 29 40Ar/39Ar ages. The remainder did not yield radiogenic 40Ar contents and are likely Holocene in age. The oldest ages (1251×10 and 1385×12 ka) are from a wedge of flat-lying dissected lavas north of the Holocene cone; these likely represent the upper part of the volcanic basement that underlies the entire island. Above a major unconformity lie basaltic andesite to dacite lavas that range from 765× 4 to 522×8 ka. The eroded remnants of the source volcano for these flows appears to crop out as a series of variably hydrothermally altered breccias and domes 5 km east-northeast of the current summit. A 625 m-tall eroded basaltic center, Lava Peak, sits 6 km northwest of the summit; its deeply incised western flank exposes lava flows and a plug. Two flows are dated at 598×16 and 602×15 ka. A high ridge 1.5 km south of the summit is made of oxidized, mostly andesitic lavas 284-249 ka old; these are presumably the remnants of an eruptive center located near the current cone. Flat Top Peak, 3.5 km southwest of the summit, produced almost exclusively basalts and six dated lavas range from 155×8 to 98×18 ka. Lavas from Flat Top (1065 m asl) are deeply eroded suggesting extensive ice cover during marine isotope

  14. The challenge to explore the Brazilian interior basins; O desafio da exploracao das bacias interiores brasileiras

    Energy Technology Data Exchange (ETDEWEB)

    Bacoccoli, Giuseppe [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia; Guimaraes, Paulo Buarque [Organizacao da Industria do Petroleo (ONIP), Rio de Janeiro, RJ (Brazil)

    2004-07-01

    Due to the development of the fields, already discovered in the deep waters of the Southeastern Atlantic Margin, the Brazilian domestic production will shortly be equivalent to the consumption. Despite reaching this goal, the exploration of large interior basins is still considered a challenge. Surprisingly, after the discoveries in the Solimoes Basin, as well after the opening of the Brazilian Petroleum Sector in 1997, the present level of the exploration activities in these basins is far below the previous historical averages. The available data are still now considered too scarce, to perform a proper evaluation. Apparently, a vicious circle has been established: due to the a priori low attractiveness new data are not acquired and because the lack of new data the attractiveness cannot be modified nor improved. The Parnaiba Basin is usually mentioned as an example of this poor amount of data. A modest coverage of ancient 2D seismic lines, and obsolete aero magnetic survey and thirty one exploratory wells, mostly located without geophysical support, represents all the available data in this vast basin with an area over 600,000 sq km. Recent regional geologic interpretations in such interior basins, as in Solimoes, Parana and also Parnaiba, are pointing out the presence of remarkable intraplate tectonic events, successively reactivated along the geologic time. It is now intended that these events can play an important role in the control of the petroleum system and in focalizing the new exploration activities. However, efforts should be applied in the revision of some regulatory rules, in Brazil, in order to better stimulate the onshore exploration and particularly the exploration of the interior basins. As recommended by the new Brazilian Petroleum Law, part of the government takes shall be effectively applied to acquire more geologic and geophysical data in the onshore areas (author)

  15. Dicty_cDB: FC-AR08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR08 (Link to dictyBase) - - - Contig-U15118-1 FC-AR08Z (Li...nk to Original site) - - FC-AR08Z 542 - - - - Show FC-AR08 Library FC (Link to library) Clone ID FC-AR08 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR08Q.Seq.d/ Representative seq. ID FC-AR...08Z (Link to Original site) Representative DNA sequence >FC-AR08 (FC-AR08Q) /CSM/FC/FC-AR/FC-AR08Q.Seq....esfilgfmgyr tscrynrwssqlpirycs*knddasrsc*yslfkhlgllgkdchp*rsncllqrcfikch qrfrwcfs

  16. Dicty_cDB: FC-AR06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR06 (Link to dictyBase) - - - - FC-AR06Z (Link to Original site) - - FC-AR...06Z 316 - - - - Show FC-AR06 Library FC (Link to library) Clone ID FC-AR06 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...06Q.Seq.d/ Representative seq. ID FC-AR06Z (Link to Original s...ite) Representative DNA sequence >FC-AR06 (FC-AR06Q) /CSM/FC/FC-AR/FC-AR06Q.Seq.d/ XXXXXXXXXXTGATCCAAGAAAAGG

  17. Dicty_cDB: FC-AR18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR18 (Link to dictyBase) - G03231 DDB0229952 Contig-U16528-1 FC-AR...18E (Link to Original site) - - - - - - FC-AR18E 567 Show FC-AR18 Library FC (Link to library) Clone ID FC-AR...8-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR18Q.Se...q.d/ Representative seq. ID FC-AR18E (Link to Original site) Representative DNA sequence >FC-AR18 (FC-AR18Q) /CSM/FC/FC-AR/FC-AR...QNRALVAGPHSGVERHIINFKWIN LTPLKVNIQRGARINTLIAAIKAADLETKIAALSAVKKINARATKSNQTDFERFKANLIR RKLNKKVSGEVKKLVNIANRAA

  18. Dicty_cDB: FC-AR14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR14 (Link to dictyBase) - - - Contig-U16311-1 FC-AR14Z (Li...nk to Original site) - - FC-AR14Z 593 - - - - Show FC-AR14 Library FC (Link to library) Clone ID FC-AR14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR14Q.Seq.d/ Representative seq. ID FC-AR...14Z (Link to Original site) Representative DNA sequence >FC-AR14 (FC-AR14Q) /CSM/FC/FC-AR/FC-AR14Q.Seq....epsin, complete cds. 72 8e-09 1 BP130435 |BP130435.1 Nicotiana tabacum cDNA, clone: BY2401, primer: M13 forwar

  19. Dicty_cDB: FC-AR09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR09 (Link to dictyBase) - - - Contig-U15312-1 FC-AR09E (Li...nk to Original site) - - - - - - FC-AR09E 702 Show FC-AR09 Library FC (Link to library) Clone ID FC-AR09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR09Q.Seq.d/ Representative seq. ID FC-AR...09E (Link to Original site) Representative DNA sequence >FC-AR09 (FC-AR09Q) /CSM/FC/FC-AR/FC-AR09Q.Seq....elfikr*kerqvc*nrldsleg*r*srrk *rcw*ir*l*ygwhgyatndarygwygrygwygrygwygrygrhgryarwy

  20. Applications of 37Ar, 39Ar and 85Kr in hydrology, oceanography and atmospheric studies. Current state of the art

    International Nuclear Information System (INIS)

    Knowledge of the atmospheric concentrations of 37Ar, 39Ar and 85Kr is required to apply these isotopes in hydrology and oceanography; these concentrations are reported on in the paper. It is demonstrated in a general way, and for specific examples, how 39Ar and 85Kr results can be used for groundwater dating. The combination of these isotope results with 3H and 14C data is discussed. Subsurface production of 39Ar may limit its application in dating, but could yield information about underground processes, particularly if the results are combined with other isotope data such as 37Ar and 222Rn. Argon-39 is applied in oceanography as a steady state tracer and allows valuable conclusions to be reached on the formation and ventilation rates of deep ocean water. Examples from the deep North Atlantic and for a depth profile in the Pacific illustrate how conclusions on the mixing, ageing and flow rates can be drawn from 39Ar results. The origin of measured 37Ar activity values in tropospheric air is described, and selected time series are used to discuss atmospheric circulation processes. (author). 12 refs, 6 figs, 2 tabs

  1. Experimental study of NO2 reduction in N2/Ar and O2/Ar mixtures by pulsed corona discharge.

    Science.gov (United States)

    Zhu, Xinbo; Zheng, Chenghang; Gao, Xiang; Shen, Xu; Wang, Zhihua; Luo, Zhongyang; Cen, Kefa

    2014-11-01

    Non-thermal plasma technology has been regarded as a promising alternative technology for NOx removal. The understanding of NO2 reduction characteristics is extremely important since NO2 reduction could lower the total NO oxidation rate in the plasma atmosphere. In this study, NO2 reduction was experimentally investigated using a non-thermal plasma reactor driven by a pulsed power supply for different simulated gas compositions and operating parameters. The NO2 reduction was promoted by increasing the specific energy density (SED), and the highest conversion rates were 33.7%, 42.1% and 25.7% for Ar, N2/Ar and O2/Ar, respectively. For a given SED, the NO2 conversion rate had the order N2/Ar>Ar>O2/Ar. The highest energy yield of 3.31g/kWh was obtained in N2/Ar plasma and decreased with increasing SED; the same trends were also found in the other two gas compositions. The conversion rate decreased with increasing initial NO2 concentration. Furthermore, the presence of N2 or O2 led to different reaction pathways for NO2 conversion due to the formation of different dominating reactive radicals. PMID:25458679

  2. 40Ar/39Ar dating and geochemistry of tholeiitic magmatism related to the early opening of the Central Atlantic rift

    International Nuclear Information System (INIS)

    Tholeiitic effusive and intrusive magnetism from Iberia, Morocco, Algeria and Mali, realted to the early opening of the Central Atlantic rift, was dated by the 40Ar/39Ar step-heating method. Four plateau ags, rangin from 203.7±2.7 to 197.1±1.8 Ma, were obtained on plagioclase from dykes from theTaoudenni area (Mali) and two lava flows from Morocco. The Messejana dyke (Iberia), which previously yielded discrepant conventional K-Ar dates, did not furnish any 40Ar/39Ar plateau dates. However, there is a clear inverse relationship between apparent age and K/Ca atio for gas fractions from a plagioclase separate (proportional to the alteration degree) which, combined with dates obtained on amphibole, biotite and pyroxene, allows us to determine an age of around 200 Ma for this body. These data, and those obtained on the Foum Zguid (Morocco) and the Ksi Ksou (Algeria) dykes, give evidence of a brief magmatic event (between 206 and 195 Ma ago) which affected a large area ca. 2500 km long. Trace-element modelling shows that most of these formations originated from a homogeneous, enriched, source material. Such a brief magmatic episode related to the opening of a continental rift is in agreement with findings in other magmatic provinces (e.g. the Deccan traps and the Red Sea rift, precisely dated by the 40Ar/39Ar method as well). (orig.)

  3. Interior Design Supports Art Education: A Case Study

    Science.gov (United States)

    Clemons, Stephanie A.

    2006-01-01

    Interior design, as a field of study, is a rapidly growing area of interest--particularly for teenagers in the United States. Part of this interest stems from the proliferation of design-related reality shows available through television media. Some art educators and curriculum specialists in the nation perceive the study of interior spaces as a…

  4. Virtual Interior Design Based On VRML AND JAVA

    Science.gov (United States)

    Qi, Shaoliang

    Virtual reality has been involved in a wide range of academic and commercial applications. It can give users a natural feeling of the environment by creating realistic virtual worlds. In this paper, we use vrml and java to discuss the virtual interior design. EAI and JASI are used to realize the interaction between user and virtual interior scene.

  5. 14 CFR 91.613 - Materials for compartment interiors.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Materials for compartment interiors. 91.613 Section 91.613 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... compartment interiors. (a) No person may operate an airplane that conforms to an amended or supplemental...

  6. Mood perception of interior colors in a gym

    Science.gov (United States)

    Ohno, Haruyo; Koizumi, Naoko

    2002-06-01

    When people enter a gym, they feel more like exercising in some cases than other cases. The interior color of the space may be a contributing factor. This paper discusses how the interior color of a gym affects female subjects in their twenties and forties to fifties both physiologically and psychologically.

  7. Interior-Point Methods for Linear Programming: A Review

    Science.gov (United States)

    Singh, J. N.; Singh, D.

    2002-01-01

    The paper reviews some recent advances in interior-point methods for linear programming and indicates directions in which future progress can be made. Most of the interior-point methods belong to any of three categories: affine-scaling methods, potential reduction methods and central path methods. These methods are discussed together with…

  8. AMOUNT OF FOREST INTERIOR AT A 65 HECTARE SCALE

    Science.gov (United States)

    Forests provide economic and ecological value. High amounts of forest interior indicates a highly connected forest, which generally enhances those economic and ecological values. INT65 is the percent of forest that is classified as interior using a 65 ha scale.

  9. AMOUNT OF FUTURE FOREST INTERIOR AT A 2 HECTARE SCALE

    Science.gov (United States)

    Forests provide economic and ecological value. High amounts of forest interior indicates a highly connected forest, which generally enhances those economic and ecological values. INT2 is the percent of forest that is classified as interior using a 2 ha scale.

  10. AMOUNT OF FUTURE FOREST INTERIOR AT A 65 HECTARE SCALE

    Science.gov (United States)

    Forests provide economic and ecological value. High amounts of forest interior indicates a highly connected forest, which generally enhances those economic and ecological values. INT65 is the percent of forest that is classified as interior using a 65 ha scale.

  11. Interior Design Education within a Human Ecological Framework

    Science.gov (United States)

    Kaup, Migette L.; Anderson, Barbara G.; Honey, Peggy

    2007-01-01

    An education based in human ecology can greatly benefit interior designers as they work to understand and improve the human condition. Design programs housed in colleges focusing on human ecology can improve the interior design profession by taking advantage of their home base and emphasizing the human ecological framework in the design curricula.…

  12. 49 CFR 38.155 - Interior circulation, handrails and stanchions.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Interior circulation, handrails and stanchions. 38.155 Section 38.155 Transportation Office of the Secretary of Transportation AMERICANS WITH... § 38.155 Interior circulation, handrails and stanchions. (a) Handrails and stanchions shall be...

  13. 36 CFR 1192.155 - Interior circulation, handrails and stanchions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Interior circulation, handrails and stanchions. 1192.155 Section 1192.155 Parks, Forests, and Public Property ARCHITECTURAL AND... TRANSPORTATION VEHICLES Over-the-Road Buses and Systems § 1192.155 Interior circulation, handrails and...

  14. 49 CFR 238.233 - Interior fittings and surfaces.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Interior fittings and surfaces. 238.233 Section... I Passenger Equipment § 238.233 Interior fittings and surfaces. (a) Each seat in a passenger car... determined by the railroad: (1) Longitudinal: 8g; (2) Vertical: 4g; and (3) Lateral: 4g. (c) Other...

  15. 36 CFR 1192.115 - Interior circulation, handrails and stanchions.

    Science.gov (United States)

    2010-07-01

    ... process, to the extent permitted by 49 CFR part 231. ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Interior circulation... TRANSPORTATION VEHICLES Intercity Rail Cars and Systems § 1192.115 Interior circulation, handrails and...

  16. 36 CFR 1192.97 - Interior circulation, handrails and stanchions.

    Science.gov (United States)

    2010-07-01

    ... process, to the extent permitted by 49 CFR part 231. ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Interior circulation... TRANSPORTATION VEHICLES Commuter Rail Cars and Systems § 1192.97 Interior circulation, handrails and...

  17. DNA damages induced by Ar F laser

    International Nuclear Information System (INIS)

    The photo ablation process used in corneal refractive surgery by the Argon Fluoride (Ar F) laser emitting in ultraviolet C at 193 nm, exposes viable cells round the irradiated zone to sub ablative doses (< 400 joules.m -2). Despite that DNA absorption is higher at 193 nm than 254 nm, cytotoxicity of 193 nm laser radiation is lower than radiation emitted by 254 nm UV-C lamps. In situ, DNA could be protected of laser radiation by cellular components. Consequently, some authors consider that this radiation does not induce genotoxic effect whereas others suspect it to be mutagenic. These lasers are used for fifteen years but many questions remain concerning the long term effects on adjacent cells to irradiated area. The purpose of this study is to describe the effect of 193 nm laser radiation on DNA of stromal keratocytes which are responsible of the corneal structure. The 193 nm laser irradiation induces directly DNA breakage in keratocytes as it has been shown by the comet assay under alkaline conditions. Two hours post irradiation, damages caused by the highest exposure (150 J.m-2) are not repaired as it has been measured with the Olive Tail Moment (product of tail length and tail DNA content). They give partly evidence of induction of an apoptotic process in cells where DNA could be too damaged. In order to characterize specifically double strand breaks, a comparative analysis by immunofluorescence of the H2 Ax histone phosphorylation (H2 Ax) has been performed on irradiated keratocytes and unirradiated keratocytes. Results show a dose dependent increase of the number of H2 Ax positive cells. Consequences of unrepaired DNA lesions could be observed by the generation of micronuclei in cells. Results show again an increase of micronuclei in laser irradiated cells. Chromosomal aberrations have been pointed out by cytogenetic methods 30 mn after irradiation. These aberrations are dose dependent (from 10 to 150 J.m-2). The number of breakage decreases in the long run

  18. Active Noise Control of the Heavy Truck Interior Cab

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    In order to control the noise of the heavy truck interior cab effectively, the active noise control methods are employed. First, an interior noise field test for the heavy truck is performed, and frequencies of interior noise of this vehicle are analyzed. According to the spectrum analysis of acquired noise signal, it is found out that the main frequencies of interior noise are less than 800Hz. Then the least squares lattice (LSL) algorithm is used as signal processing algorithm of the controller and a closed-loop control DSP system, based on TMS 320VC5416, is developed. The residual signal at driver's ear is used as feedback signal. Lastly, the developed ANC system is loaded into the heavy truck cab, and controlling the noise at driver's ear for that truck at different driving speeds is attempted. The noise control test results indicate that the cab interior noise is reduced averagely by 0.9 dBA at different driving speeds.

  19. Qualitative and quantitative assessment of interior moisture buffering by enclosures

    DEFF Research Database (Denmark)

    Janssen, Hans; Roels, Staf

    2009-01-01

    The significance of interior humidity in attaining sustainable, durable, healthy and comfortable buildings is increasingly recognised. Given their significant interaction, interior humidity appraisals need a qualitative and/or quantitative assessment of interior moisture buffering. While the...... effective moisture penetration depth and effective capacitance models allow quantified assessment, their reliance on the ‘moisture penetration depth’ necessitates comprehensive material properties and hampers their application to multi-dimensional interior objects. On the other hand, while various recently...... suggested protocols for the simple and fast measurement of the moisture buffer potential of interior elements allow qualitative assessment, none of these are currently dependable for a wide range of moisture production regimes. In response to these flaws, this paper introduces the production...

  20. Hydrothermal fluids, argon isotopes and mineralization ages of the Fankou Pb-Zn deposit in south China: Insights from sphalerite 40Ar/39Ar progressive crushing

    Science.gov (United States)

    Jiang, Ying-De; Qiu, Hua-Ning; Xu, Yi-Gang

    2012-05-01

    Hydrothermal fluid geochemistry and mineralization timing are two important factors in the genesis of a hydrothermal deposit. 40Ar/39Ar analyses of fluid inclusions not only provide time constraints for the mineralization but also help to clarify the K-Ca-Cl-Ar characteristics for the ore-forming fluids. In this study, six sphalerite samples collected from the Fankou lead-zinc sulfide deposit are investigated by 40Ar/39Ar in vacuo crushing. Gases liberated from the early and late crushing steps exhibit distinct Ar isotopic compositions and 40Ar/39Ar apparent ages. Argon released in the early steps has much higher 40Ar and 38ArCl and lower 37ArCa contents than those in the late steps. The significant excess Ar (40ArE) extracted in the early crushing steps shows a strong correlation with 38ArCl with very high 40ArE/38ArCl ratios. In contrast, those of the late steps mainly consist of atmospheric Ar and K-correlated radiogenic Ar with a constant 40ArR/39ArK ratio and the atmospheric initial 40Ar/36Ar ratio. As a result, all samples yield similar declining age spectra: the fore segments with anomalously old apparent ages decline quickly in the early crushing steps and the rear ones are flat with concordant apparent ages in the late crushing steps. The data points of the early steps define linear correlations in plots of 40ArNA/39ArK vs. 38ArCl/39ArK and 38ArCl/40ArNA vs. 39ArK/40ArNA (NA for non-atmospheric) and most yield ages of 240-230 Ma. On the other hand, the data of the late steps always construct well-defined isochrons in the plots of 36ArA/40ArNA vs. 39ArK/40ArNA with consistent ages of ˜300 Ma. We interpret that gases released in the early steps were from the secondary fluid inclusions (SFIs) due to their distribution characteristics along cracks leading to be easily extracted, and those released in the later steps represented the contribution of the primary fluid inclusions (PFIs). The initial 40Ar/36Ar ratios of SFIs, much higher than the modern

  1. Numerical simualtion of underground 37Ar transportation to the ground

    International Nuclear Information System (INIS)

    Monitoring radioactive gas 37Ar is an important technique for the On-Site Inspection(OSI) of the Comprehensive Nuclear Test Ban Treaty (CTBT) verification regime. In order to establish a theoretical model that can be used to calculate the appearing time and radioactivity of 37Ar which transports to the ground after a nuclear explosion, the rock media in the test area is assumed to be a homogeneous porous media, without consideration of gas absorption by and release from the rock media. The seepage model in the porous media is used to calculate 37Ar transportation. Computational results give the time 37Ar leaks to the ground and the variation of its radioactivity with time. And we can analyze and consider the computational results when we have developed OSI noble gas monitoring systems and evaluated their effectiveness. (authors)

  2. H- Beam Stripping Loss at Background Partial Pressure of Ar

    Institute of Scientific and Technical Information of China (English)

    Hu Chundong; Wang Shaohu; Hu Liqun

    2005-01-01

    It has been observed that H- current could be improved by adding Ar to H2 plasma.But due to a slower pumping speed for Ar with the existing pumping scheme, the tank pressure will increase quickly during the length of a beam pulse. Since H- stripping loss depends on the tank pressure and gas species, part of the H- beam can be converted to H0 and then H0 can be converted into H+ with background H2 and Ar gas thickness. Therefore, the H- beam current,measured by a Faraday cup, situated at a distance L from GG (ground grid), will decrease because it will be converted into a H+ current. This gives a ratio of the Faraday cup net current to the H- beam current before stripping at background partial pressure of Ar.

  3. Ar2 - O2 RF plasma diagnostics by mass spectrometry

    International Nuclear Information System (INIS)

    An investigation on the nature, energy and fluxes of the dominant species from a rf 13.56 MHz argon-oxygen plasma was carried out using a quadrupolar mass spectrometer. The mass spectrometer is sampling the plasma species through the anode space charge, being placed on the grounded electrode - the chamber wall. The ion energy distributions of most important ions from plasma, Ar+, Ar++, ArH+, Ar2+, O2+, O+ are investigated using the mass spectrometer. The main results are as follows: i) the oxygen addition in the argon discharge leads to the plasma potential decreasing and therefore the potential difference on the sheath formed in front of the anode wall is diminished as compared with the discharge in pure argon; ii) the combination of two effects, the rf modulation of the sheath potential, and the charge exchange, as a dominant inelastic interaction process in the sheath, leads to pronounced and characteristic additional structures in the ion energy distributions. (authors)

  4. K-Ar ages of dikes in Northeast Japan

    International Nuclear Information System (INIS)

    Thirteen dike swarms in Northeast Japan were dated by the K-Ar method. The K-Ar ages in this study give some crucial constraints to the volcanostratigraphy and imply that the geological situation of some dike swarms estimated in the other studies should be reexaminned while other dike swarms showed the K-Ar ages concordant with the geological ages. Available K-Ar ages of the volcanic rocks from the present and other studies indicate that the volcanic front in Northeast Japan had a temporal position about 22-23Ma ago to the east of that in the Quaternary and that the volcanism appears to have been inactive from 17 to 21Ma ago. (author)

  5. Capillary flow in an interior corner

    Science.gov (United States)

    Weislogel, Mark M.; Lichter, Seth

    1998-10-01

    The design of fluids management processes in the low-gravity environment of space requires an accurate description of capillarity-controlled flow in containers. Here we consider the spontaneous redistribution of fluid along an interior corner of a container due to capillary forces. The analytical portion of the work presents an asymptotic formulation in the limit of a slender fluid column, slight surface curvature along the flow direction z, small inertia, and low gravity. The scaling introduced explicitly accounts for much of the variation of flow resistance due to geometry and so the effects of corner geometry can be distinguished from those of surface curvature. For the special cases of a constant height boundary condition and a constant flow condition, the similarity solutions yield that the length of the fluid column increases as t1/2 and t3/5, respectively. In the experimental portion of the work, measurements from a 2.2 s drop tower are reported. An extensive data set, collected over a previously unexplored range of flow parameters, includes estimates of repeatability and accuracy, the role of inertia and column slenderness, and the effects of corner angle, container geometry, and fluid properties. At short times, the fluid is governed by inertia (t[less, similar]tLc). Afterwards, an intermediate regime (tLc[less, similar]t[less, similar] tH) can be shown to be modelled by a constant-flow-like similarity solution. For t[gt-or-equal, slanted]tH it is found that there exists a location zH at which the interface height remains constant at a value h(zH, t)=H which can be shown to be well predicted. Comprehensive comparison is made between the analysis and measurements using the constant height boundary condition. As time increases, it is found that the constant height similarity solution describes the flow over a lengthening interval which extends from the origin to the invariant tip solution. For t[dbl greater-than sign]tH, the constant height solution

  6. Augmented Reality Computer-Aided Drawing (AR-CAD)

    OpenAIRE

    ECT Team, Purdue

    2007-01-01

    While Virtual Reality (VR) replaces the entire real world with virtual images, Augmented Reality (AR) superimposes virtual images on the real world. Augmented Reality (a most useful form of Mixed Reality (MR)) is a popular concept for using computers to overlay virtual information onto a view of the real world. In 2000, Phillip Dunston then at the University of Washington in Seattle and his research team presented the initial concept of AR CAD developed for supporting design and construction....

  7. Effect and mechanism of AR-6 in experimental rheumatoid arthritis.

    Science.gov (United States)

    Sun, Shi-xue; Li, Yun-man; Fang, Wei-rong; Cheng, Peng; Liu, Lifang; Li, Fengwen

    2010-06-01

    The root of Clematis chinensis Osbeck has been used widely in rheumatoid arthritis in Chinese traditional medicine and AR-6 is a triterpene saponin isolated from it. In this present study, we investigated in vivo effects of oral AR-6 in chronic rat adjuvant-induced arthritis (AA) and in vitro effect in macrophage and synoviocytes cells. Arthritic scores and serum inflammatory mediators were evaluated 19 days after AA induction by endermic injection of Freund's complete adjuvant in Sprague-Dawley(S-D) rats. Oral administration of AR-6 to arthritic rats resulted in a clear decrease of clinical signs compared to untreated controls. The synoviocyte and macrophage response ex vivo were then analyzed. Anti-arthritic effects of AR-6 correlated with significant decrease of NO and TNF-alpha produced by peritoneal macrophages, ex vivo and in vitro. AR-6 also significant decreased the proliferation of synoviocyte. These data indicate that AR-6 is a potential anti-inflammatory therapeutic and preventive agent. PMID:19842015

  8. 40Ar/39Ar Dating of the Brunhes-Matuyama Geomagnetic Field Reversal.

    Science.gov (United States)

    Baksi, A K; Hsu, V; McWilliams, M O; Farrar, E

    1992-04-17

    Magnetostratigraphic studies are widely used in conjunction with the geomagnetic polarity time scale (GPTS) to date events in the range 0 to 5 million years ago. A critical tie point on the GPTS is the potassium-argon age of the most recent (Brunhes-Matuyama) geomagnetic field reversal. Astronomical values for the forcing frequencies observed in the oxygen isotope record in Ocean Drilling Project site 677 suggest that the age of this last reversal is 780 ka (thousand years ago), whereas the potassium-argon-based estimate is 730 ka. Results from 4039; Ar incremental heating studies on a series of lavas from Maui that straddle the Brunhes-Matuyama reversal give an age of 783 + 11 ka, in agreement with the astronomically derived value. The astronomically based technique appears to be a viable tool for dating young sedimentary sequences. PMID:17743111

  9. Accurate and precise 40Ar/39Ar dating by high-resolution, multi-collection, mass spectrometry

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie

    -Instruments multi-collector Noblesse noble gas mass spectrometer configured with a faraday detector and three ion-counting electron multipliers. The instrument has the capability to measure several noble gas isotopes simultaneously and to change measurement configurations instantaneously by the use of QUAD lenses......New generation, high resolution, multi-collector noble gas mass spectrometers equipped with ion-counting electron multipliers provide opportunities for improved accuracy and precision in 40Ar/39Ar dating. Here we report analytical protocols and age cross-calibration studies using a NU...... (zoom optics). The Noblesse offer several advantages over previous generation noble gas mass spectrometers and is particularly suited for single crystal 40Ar/39Ar dating because of: (i) improved source sensitivity (ii) ion-counting electron multipliers, which have much lower signal to noise ratios than...

  10. Combined U-Th/He and 40Ar/39Ar geochronology of post-shield lavas from the Mauna Kea and Kohala volcanoes, Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Aciego, S.M.; Jourdan, F.; DePaolo, D.J.; Kennedy, B.M.; Renne, P.R.; Sims, K.W.W.

    2009-10-01

    Late Quaternary, post-shield lavas from the Mauna Kea and Kohala volcanoes on the Big Island of Hawaii have been dated using the {sup 40}Ar/{sup 39}Ar and U-Th/He methods. The objective of the study is to compare the recently demonstrated U-Th/He age method, which uses basaltic olivine phenocrysts, with {sup 40}Ar/{sup 39}Ar ages measured on groundmass from the same samples. As a corollary, the age data also increase the precision of the chronology of volcanism on the Big Island. For the U-Th/He ages, U, Th and He concentrations and isotopes were measured to account for U-series disequilibrium and initial He. Single analyses U-Th/He ages for Hamakua lavas from Mauna Kea are 87 {+-} 40 ka to 119 {+-} 23 ka (2{sigma} uncertainties), which are in general equal to or younger than {sup 40}Ar/{sup 39}Ar ages. Basalt from the Polulu sequence on Kohala gives a U-Th/He age of 354 {+-} 54 ka and a {sup 40}Ar/{sup 39}Ar age of 450 {+-} 40 ka. All of the U-Th/He ages, and all but one spurious {sup 40}Ar/{sup 39}Ar ages conform to the previously proposed stratigraphy and published {sup 14}C and K-Ar ages. The ages also compare favorably to U-Th whole rock-olivine ages calculated from {sup 238}U - {sup 230}Th disequilibria. The U-Th/He and {sup 40}Ar/{sup 39}Ar results agree best where there is a relatively large amount of radiogenic {sup 40}Ar (>10%), and where the {sup 40}Ar/{sup 36}Ar intercept calculated from the Ar isochron diagram is close to the atmospheric value. In two cases, it is not clear why U-Th/He and {sup 40}Ar/{sup 39}Ar ages do not agree within uncertainty. U-Th/He and {sup 40}Ar/{sup 39}Ar results diverge the most on a low-K transitional tholeiitic basalt with abundant olivine. For the most alkalic basalts with negligible olivine phenocrysts, U-Th/He ages were unattainable while {sup 40}Ar/{sup 39}Ar results provide good precision even on ages as low as 19 {+-} 4 ka. Hence, the strengths and weaknesses of the U-Th/He and {sup 40}Ar/{sup 39}Ar methods are

  11. 40Ar/39Ar age evidence for Altyn fault tectonic activities in western China

    Institute of Scientific and Technical Information of China (English)

    LIU Yongjiang; J. Genser; GE Xiaohong; F. Neubauer; G. Friedl; CHANG Lihua; REN Shoumai; R. Handler

    2003-01-01

    Four 40Ar/39Ar age groups of mica, hornblende and K-feldspar were obtained from Proterozoic and early Paleozoic metamorphic rocks in the Aksay-Dangjin Pass area, western China. The samples away from the middle shear zone of the Altyn fault belt yield two plateau age groups in the range of 461-445.2 Ma and 414.9-342.8 Ma, respectively. They represent the tectono-thermal events that had been recorded in the rocks that were displaced by the Altyn strike-slip fault in late Ordovician-early Silurian and Devonian, respectively. These two age groups should be related to the closures of Northern and Southern Qilian Oceans. The deformed granitic gneiss from the northern belt gives a plateau age group of 178.4-137.5 Ma, which is interpreted as the active age of the Altyn fault in the middle-late Jurassic- early Cretaceous and should be related to the accretion of Lhasa block to the north. The sample from the middle shear zone of the Altyn fault belt yields two plateau ages of 36.4 and 26.3 Ma, respectively, suggesting the strike-slip movement with strong metamorphism at greenschist facies along the Altyn fault in the late Eocene. This event occurred in the most areas of the northern Tibet Plateau and should be in response in the north to the collision between Indian and Eurasian continents. The present study demonstrates that the Altyn fault is characterized by multiple pulse-style activities under the tectonic setting of convergence between the Indian and Eurasian continents.

  12. Chronostratigraphy of Monte Vulture volcano (southern Italy): secondary mineral microtextures and 39Ar-40Ar systematics

    Science.gov (United States)

    Villa, Igor M.; Buettner, Annett

    2009-12-01

    The eruptive history of Monte Vulture has been the subject of several geochronological investigations during the past decades, which reliably dated only a small number of eruptions. Understanding the causes of sub-optimum data yield in the past requires an interdisciplinary approach. We re-analyzed samples from previous works and present new data on samples from the main volcano-stratigraphic units of Monte Vulture, so as to provide an improved, consistent chronostratigraphic database. Imaging of minerals by cathodoluminescence and backscattered electrons reveals that heterochemical, high-temperature deuteric reaction textures are ubiquitous. Such observations are common in metamorphic rocks but had not frequently been reported from volcanic rocks. In view of the mineralogical complexity, we base our chronological interpretation on isochemical steps, defined as steps for which the Cl/K and/or the Ca/K ratios are constant. Isochemical steps carry the isotopic signature of chemically homogeneous mineral phases and therefore allow a well-constrained age interpretation. Comparison of old and new 39Ar-40Ar data proves the reproducibility of age spectra and their shapes. This quantifies the analytical reliability of the irradiation and mass-spectrometric analyses. Anomalous age spectra are a reproducible property of some specific samples and correlate with mineralogical anomalies. The present data allow us to fine-tune the age of the volcanostratigraphic units of Monte Vulture during the known interval of main volcanic activity from ca. 740 to 610 ka. After a very long stasis, the volcanic activity in the Monte Vulture area resumed with diatremic eruptions, one of which (Lago Piccolo di Monticchio, the site of a palynological-paleoclimatological drilling) was dated at ca. 140 ka.

  13. Evolution of the northern Sierra Nevada metamorphic belt: Petrological, structural, and Ar/Ar constraints

    Energy Technology Data Exchange (ETDEWEB)

    Hacker, B.R. [Stanford Univ., CA (United States)

    1993-05-01

    The Sierra Nevada metamorphic belt constitutes an important record of the growth of continental crust from essentially oceanic materials. In the northern Sierra, the central part of the belt is made up of volcanoplutonic arcs and sediment-dominated units inferred to be accretionary wedges or closed ocean basins. The latter are broken formation and melange composed of radiolarian chert, lava, and volcanogenic and continental turbidites. Sedimentary detritus in the largest of these units can be plausibly linked to sources farther east in the Sierra, suggesting that deposition occurred near the eastern Sierran arc. Isoclinal folds, steeply dipping foliations, and steeply plunging down-dip lineations are characteristics structures. The westernmost unit is only feebly recrystallized, and deformation was accomplished principally by stress solution and local redeposition in veins. More easterly, inboard units are compositionally similar, but they recrystallized at pumpellyite-actinolite-and blueschist-facies conditions and deformed via solution-transfer and dislocation creep. Phengite silica contents, the degree of quartz veining, and the locations of pseudo-isograds support an eastward increase in metamorphic pressure and temperature. Metamorphic conditions during the growth of pumpellyite and actinolite ranged from {approximately}150-350 {degrees}C and 200-400 MPa, compatible with recrystallization and deformation in subduction zones or the deeper levels of magmatic arcs. Ar/Ar ages of volcanisclastic rocks and crosscutting plutons constrain the age of deformation and metamorphism in the western part of the region to 174-165 Ma. Deformation and recrystallization in more easterly units may have been coeval or begun as early as Triassic time. 58 refs., 14 figs., 4 tabs.

  14. Volcanic history and 40Ar/39Ar and 14C geochronology of Terceira Island, Azores, Portugal

    Science.gov (United States)

    Calvert, A.T.; Moore, R.B.; McGeehin, J.P.; Rodrigues da Silva, A.M.

    2006-01-01

    Seven new 40Ar/39Ar and 23 new radiocarbon ages of eruptive units, in support of new geologic mapping, improve the known chronology of Middle to Late Pleistocene and Holocene volcanic activity on the island of Terceira, Azores and define an east-to-west progression in stratovolcano growth. The argon ages indicate that Cinco Picos Volcano, the oldest on Terceira, completed its main subaerial cone building activity by about 370-380??ka. Collapse of the upper part of the stratovolcanic edifice to form a 7 ?? 9??km caldera occurred some time after 370??ka. Postcaldera eruptions of basalt from cinder cones on and near the caldera floor and trachytic pyroclastic flow and pumice fall deposits from younger volcanoes west of Cinco Picos have refilled much of the caldera. The southern portion of Guilherme Moniz Volcano, in the central part of the island, began erupting prior to 270??ka and produced trachyte domes, flows, and minor pyroclastic deposits until at least 111??ka. The northern part of Guilherme Moniz Caldera is less well exposed than the southern part, but reflects a similar age range. The northwest portion of the caldera was formed sometime after 44??ka. Several well-studied ignimbrites that blanket much of the island likely erupted from Guilherme Moniz Volcano. The Pico Alto Volcanic Center, a tightly spaced cluster of trachyte domes and short flows, is a younger part of Guilherme Moniz Volcano. Stratigraphic studies and our new radiocarbon ages suggest that most of the Pico Alto eruptions occurred during the period from about 9000 to 1000??years BP. Santa Barbara Volcano is the youngest stratovolcano on Terceira, began erupting prior to 29??ka, and has been active historically. ?? 2006.

  15. New methodologies at PF AR-NW12A: the implementation of high-pressure macromolecular crystallography

    Energy Technology Data Exchange (ETDEWEB)

    Chavas, Leonard Michel Gabriel, E-mail: leonard.chavas@kek.jp [PF/IMSS/KEK, 1-1 Oho, Tsukuba, Ibaraki 300-0801 (Japan); Nagae, Tadayuki [Nagoya University, Nagoya, Aichi 464-8603 (Japan); Nagoya University, Nagoya, Aichi 464-8603 (Japan); Yamada, Hiroyuki [Nagoya University, Nagoya, Aichi 464-8603 (Japan); Watanabe, Nobuhisa [Nagoya University, Nagoya, Aichi 464-8603 (Japan); Nagoya University, Furo-cho Chikusa-ku, Nagoya, Aichi 464-8603 (Japan); Yamada, Yusuke; Hiraki, Masahiko; Matsugaki, Naohiro [PF/IMSS/KEK, 1-1 Oho, Tsukuba, Ibaraki 300-0801 (Japan)

    2013-11-01

    The evolution of AR-NW12A into a multi-purpose end-station with optional high-pressure crystallography is described. The macromolecular crystallography (MX) beamline AR-NW12A is evolving from its original design of high-throughput crystallography to a multi-purpose end-station. Among the various options to be implemented, great efforts were made in making available high-pressure MX (HPMX) at the beamline. High-pressure molecular biophysics is a developing field that attracts the interest of a constantly growing scientific community. A plethora of activities can benefit from high pressure, and investigations have been performed on its applicability to study multimeric complex assemblies, compressibility of proteins and their crystals, macromolecules originating from extremophiles, or even the trapping of higher-energy conformers for molecules of biological interest. Recent studies using HPMX showed structural hydrostatic-pressure-induced changes in proteins. The conformational modifications could explain the enzymatic mechanism differences between proteins of the same family, living at different environmental pressures, as well as the initial steps in the pressure-denaturation process that have been attributed to water penetration into the protein interior. To facilitate further HPMX, while allowing access to various individualized set-ups and experiments, the AR-NW12A sample environment has been revisited. Altogether, the newly added implementations will bring a fresh breath of life to AR-NW12A and allow the MX community to experiment in a larger set of fields related to structural biology.

  16. Measurement, analysis, and prediction of aircraft interior noise

    Science.gov (United States)

    Howlett, J. T.; Williams, L. H.; Catherines, J. J.; Jha, S. K.

    1976-01-01

    Considerations of comfort of passengers and crew in light aircraft and helicopters indicate substantial benefits may be obtained by the reduction of interior noise levels. This paper discusses an ongoing research effort to reduce interior noise in such vehicles. Data from both field and laboratory studies for a light aircraft are presented. The laboratory data indicate that structural vibration is an efficient source of interior noise and should be considered in the reduction of interior noise. Flight data taken on a helicopter before and after installation of acoustic treatment demonstrate that over 30 dB of noise reduction can be obtained in certain portions of the spectra. However, subjective evaluations of the treated vehicle indicate that further reductions in interior noise are desirable. An existing interior noise prediction method which was developed for large jet transports was applied to study low-frequency noise in a light aircraft fuselage. The results indicate that improvements in the analytical model may be necessary for the prediction of interior noise of light aircraft.

  17. Transpressional tectonics and Carboniferous magmatism in the Limousin, Massif Central, France:structural and 40Ar/39Ar investigations.

    OpenAIRE

    Gébelin, Aude; Brunel, Maurice; Monié, Patrick; Faure, Michel; Arnaud, Nicolas

    2007-01-01

    New structural, microstructural, and 40Ar/39Ar data from the NW Massif Central (France) provide additional constraints on the timing and tectonic setting of late Variscan granite magmatism. Previous studies had emphasized the role of late orogenic extension in the emplacement of granite plutons in the Limousin region. In contrast, the new data set is consistent with syntectonic emplacement of magma in a dextral simple shear active from 350 to 300 Ma in a transpressional regime. As an alternat...

  18. Detailed Ar-40/Ar-39 dating of geologic events associated with the Mantos Blancos copper deposit, northern Chile

    OpenAIRE

    Oliveros, V.; Feraud, G.; L. Aguirre; Ramirez, L.; Fornari, Michel; Palacios, C.; Parada, M.

    2008-01-01

    The Ar-40/Ar-39 geochronological method was applied to date magmatic and hydrothermal alteration events in the Mantos Blancos mining district in the Coastal Cordillera of northern Chile, allowing the distinction of two separate mineralization events. The Late Jurassic Mantos Blancos orebody, hosted in Jurassic volcanic rocks, is a magmatic-hydrothermal breccia-style Cu deposit. Two superimposed mineralization events have been recently proposed. The first event is accompanied by a phyllic hydr...

  19. A Late Mesoproterozoic 40Ar/39Ar age for a melt breccia from the Keurusselkä impact structure, Finland

    Science.gov (United States)

    Schmieder, Martin; Jourdan, Fred; Moilanen, Jarmo; Buchner, Elmar; Öhman, Teemu

    2016-02-01

    Field investigations in the eroded central uplift of the ≤30 km Keurusselkä impact structure, Finland, revealed a thin, dark melt vein that intersects the autochthonous shatter cone-bearing target rocks near the homestead of Kirkkoranta, close to the center of the impact structure. The petrographic analysis of quartz in this melt breccia and the wall rock granite indicate weak shock metamorphic overprint not exceeding ~8-10 GPa. The mode of occurrence and composition of the melt breccia suggest its formation as some kind of pseudotachylitic breccia. 40Ar/39Ar dating of dark and clast-poor whole-rock chips yielded five concordant Late Mesoproterozoic miniplateau ages and one plateau age of 1151 ± 10 Ma [± 11 Ma] (2σ; MSWD = 0.11; P = 0.98), considered here as the statistically most robust age for the rock. The new 40Ar/39Ar age is incompatible with ~1.88 Ga Svecofennian tectonism and magmatism in south-central Finland and probably reflects the Keurusselkä impact, followed by impact-induced hydrothermal chloritization of the crater basement. In keeping with the crosscutting relationships in the outcrop and the possible influence of postimpact alteration, the Late Mesoproterozoic 40Ar/39Ar age of ~1150 Ma should be treated as a minimum age for the impact. The new 40Ar/39Ar results are consistent with paleomagnetic results that suggested a similar age for Keurusselkä, which is shown to be one of the oldest impact structures currently known in Europe and worldwide.

  20. 40Ar-39Ar age of a lava flow from the Bhimashankar Formation, Giravali Ghat, Deccan Traps

    Indian Academy of Sciences (India)

    Kanchan Pande; S K Pattanayak; K V Subbarao; P Navaneethakrishnan; T R Venkatesan

    2004-12-01

    We report here a 40Ar-39Ar age of 66.0 ± 0.9Ma (2 ) for a reversely magnetised tholeiitic lava flow from the Bhimashankar Formation (Fm.), Giravali Ghat, western Deccan province, India. This age is consistent with the view that the 1.8–2km thick bottom part of the exposed basalt flow sequence in the Western Ghats was extruded very close to 67.4 Ma.

  1. Interior's Climate Science Centers: Focus or Fail

    Science.gov (United States)

    Udall, B.

    2012-12-01

    After a whirlwind two years of impressive and critical infrastructure building, the Department of Interior's Climate Science Centers are now in a position to either succeed or fail. The CSCs have a number of difficult structural problems including too many constituencies relative to the available resources, an uneasy relationship among many of the constituencies including the DOI agencies themselves, a need to do science in a new, difficult and non-traditional way, and a short timeframe to produce useful products. The CSCs have built a broad and impressive network of scientists and stakeholders. These entities include science providers of the universities and the USGS, and decision makers from the states, tribes, DOI land managers and other federal agencies and NGOs. Rather than try to support all of these constituencies the CSCs would be better served by refocusing on a core mission of supporting DOI climate related decision making. The CSCs were designed to service the climate science needs of DOI agencies, many of which lost their scientific capabilities in the 1990s due to a well-intentioned but ultimately harmful re-organization at DOI involving the now defunct National Biological Survey. Many of these agencies would like to have their own scientists, have an uneasy relationship with the nominal DOI science provider, the USGS, and don't communicate effectively among themselves. The CSCs must not succumb to pursuing science in either the traditional mode of the USGS or in the traditional mode of the universities, or worse, both of them. These scientific partners will need to be flexible, learn how to collaborate and should expect to see fewer resources. Useful CSC processes and outputs should start with the recommendations of the 2009 NRC Report Informing Decisions in a Changing Climate: (1) begin with users' needs; (2) give priority to process over products; (3) link information producers and users; (4) build connections across disciplines and organizations

  2. Enceladus' Interior: A Liquid Circulation Model

    Science.gov (United States)

    Matson, Dennis L.; Johnson, Torrence; Lunine, Jonathan; Castillo-Rogez, Julie

    We are studying a model for Enceladus' interior in which the water, gas, dust and heat are supplied to the plumes by a relatively deeply circulating brine solution. Data indicates such a source for the erupting material. On the basis of ammonia in the plume gas Waite et al. [1] suggested that the jets might originate from a liquid water region under Enceladus' icy surface. Postberg et al. [2] noted that the presence of ". . . grains that are rich in sodium salts (0.5-2 percent by mass). . . can arise only if the plumes originate from liquid water." Waite et al. [1] also regard the some of the plume chemicals as evidence for interactions with an ice layer presumably overlying the liquid water reservoir. They suggest that this could be in the form of dissociation of clathrate hydrates [3]. Additionally, there is a large heat flow of more than 15 GW [4, 5] coming out of Enceladus' south polar region. We consider a model that brings heat and chemical species up to the surface from a reservoir or "ocean" located below the ice crust that may be many tens of kilometers thick. Water transits to the surface via vertical conduits. The Cassini INMS data suggest that the water has a relatively large gas content of order a few percent. As the water travels upward and the pressure is released, exolving gases form bubbles. Since the bubbly liquid is less dense than the ice, it moves upward. (This part of the model is a variant of the "Perrier Ocean" Europa model of Crawford and Stevenson [6]. A similar model was studied for Ganymede by Murchie and Head [7].) Postberg et al. [2] model the plume eruptions that result from the water, gases, salts, and other chemicals that our circulation model provides. In the near-surface reservoir feeding the plumes, bubbles reaching the surface of the water pop and throw a very fine spray. Some of these very small droplets of brine exit with the plume gas and provide the observed salt-rich dust particles [2]. Much of the water-borne heat is

  3. Ecohydrology of Interior Alaska boreal forest systems

    Science.gov (United States)

    Cable, J.; Bolton, W. R.

    2012-12-01

    The ecohydrology of boreal forest ecosystems of Interior Alaska is not well understood largely because of challenges posed by the presence of discontinuous permafrost. Near-surface permafrost results in storage-dominated systems with cold, poorly drained soils, and slow growing, low statured coniferous trees (Picea mariana) or CDE's. The transition to permafrost-free areas can occur over a few meters and is accompanied by a vegetation community dominated by large deciduous trees (Populus sp. and Betula sp.) or DDE's. Typically, areas with permafrost are on north facing slopes and valley bottoms, and areas without permafrost are south facing. In Alaska's boreal forest, the permafrost is very warm and vulnerable to the effects of climate change. Once permafrost begins to thaw, the vegetation community shifts from coniferous to deciduous dominated. Streamflow in watersheds with a larger permafrost distribution tends to be higher and more responsive to precipitation events than in watersheds with low permafrost distribution. In fact, precipitation events in the low permafrost areas do not infiltrate past the rooting zone of the deciduous trees (~5-40 cm). This suggests that the deciduous trees may remove water from the system via uptake and transpiration. We focus on how vegetation water use affects boreal forest hydrology in areas of discontinuous permafrost. Specifically, we ask: what are the patterns of vegetation water use in areas with and without permafrost? This study focuses on the CDE and DDE systems. Our research sites are established on low and high locations on each aspect (south facing DDE, north facing CDE) to capture the variability associated with the different hillside drainage properties. At each of the four sites during the growing season, we measured various aspects of plant water use dynamics, including water flux, water content, water sources, depth of water uptake in the soil, and water stress. We use a Bayesian framework to analyze the data. We

  4. Dicty_cDB: FC-AR20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AR20 (Link to dictyBase) - G03232 DDB0186972 Contig-U15983-1 FC-AR...20P (Link to Original site) FC-AR20F 321 FC-AR20Z 550 FC-AR20P 871 - - Show FC-AR20 Library FC (Link to librar....0 %: cytoplasmic 24.0 %: nuclear 8.0 %: vesicles of secretory system 4.0 %: cytoskeletal 4.0 %: mitochondri...ontig Contig-U15983-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AR/FC-AR...20Q.Seq.d/ Representative seq. ID FC-AR20P (Link to Original site) Representative DNA sequence >FC-AR20 (FC-AR

  5. Lunar Crater Interiors with High Circular Polarization Signatures

    Science.gov (United States)

    Weitz, C. M.; Campbell, B. A.; Morgan, G.

    2015-12-01

    We analyzed 12.6-cm Earth-based radar images of the Moon to search for older craters (pre-Copernican) that display high values of the circular polarization ratio (CPR) on their interior walls. These craters have highly eroded rims and ejecta, indicating that there must be a source exposed within the crater interior that is continuously creating a rougher surface. Of particular interest are craters between 10-25 km in diameter that occur in smooth plains in the highlands, where competent layers are not expected as they are for the mare. After identifying these high-CPR interiors in pre-Copernican craters, we studied LROC NAC and Kaguya TC images to search for possible albedo and layering on crater interior walls that might signal the presence of anomalous material. Our results indicate that high-CPR craters generally have boulder fields clustered around their upper interior walls. We divide the high-CPR craters into three types: (1) craters on the layered mare lava flows; (2) craters in the highlands that correlate to mapped locations of smooth plains; and (3) craters on the highlands that are not associated with smooth plains. Most of the high-CPR craters in the highlands are associated with Eratosthenian-period craters, and most of these are also on smooth plains, indicating that impact melt sheets are a likely source for the boulders exposed on their interior walls. Statistical analyses will be performed after incorporating multiple lunar datasets into GIS to quantify these preliminary interpretations. Figure 1. Example of high-CPR crater Zagut A located on smooth plains in the highlands. LROC images showing boulders on (a) northern crater interior wall and (b) southern crater interior wall. (c) Stronlgy enhanced values of CPR are observed for the interior of Zagut A.

  6. 40Ar/39Ar dating of alkaline and tholeiitic magmatism of Saudi Arabia related to the early Red Sea Rifting

    International Nuclear Information System (INIS)

    40Ar/39Ar plateau-ages at 27-28 Ma obtained on feeder dykes and one lava flow of the alkaline massif of Harrat Hadan are in agreement with the assumed age partly deduced from the conventional K/Ar data of the early activity of other alkaline volcanic massifs from Saudi Arabia. This magmatic activity is spatially distributed over a large area, along the western edge of the Arabian plate, and their N-S to NW-SE volcano-tectonic directions are similar to those of the future Red Sea Rift. Preliminary results obtained on tholeiitic lava flows, dykes and plutons gave 17 plateau-ages which, combined with 6 ages deduced from more disturbed age-spectra, display a main histogram peak from 24 to 21 Ma, much narrower than that obtained with conventional K/Ar ages on the same formations. Therefore, a strong tholeiitic activity affected a narrow linear area following the actual eastern Red Sea coast, over nearly 1700 km, during a brief period of time, and without showing any apparent migration. The main volcano-tectonic features of the future Red Sea are strongly outlined during this event. Such brief magmatic episodes related to continental rifts have also been documented by precise 40Ar/39Ar analyses on the British Tertiary Igneous Province, the Deccan traps and the eastern Central Atlantic. (orig.)

  7. Interior noise reduction in a large civil helicopter

    Science.gov (United States)

    Howlett, J. T.; Clevenson, S. A.; Rypf, J. A.; Snyder, W. J.

    1977-01-01

    The results of an evaluation of the effectiveness of current noise reduction technology in attaining acceptable levels of interior noise in a large (about 20,000 kg) passenger-carrying helicopter are presented. The helicopter studied is a modified CH-53A with a specially designed, acoustically treated passenger cabin. The acoustic treatment reduced the average A-weighted interior noise levels from 115 db to 87 db. The study suggests selected improvements in the acoustic treatment which could result in additional reduction in cabin noise levels. The resulting levels would be only slightly greater than the interior noise levels of current narrow-body jet transports.

  8. Decline of forest interior conditions in the conterminous United States

    OpenAIRE

    Kurt H. Riitters; James D. Wickham

    2012-01-01

    Forest fragmentation threatens the sustainability of forest interior environments, thereby endangering subordinate ecological attributes and functions. We analyzed the spatial patterns of forest loss and gain for the conterminous United States from 2001 to 2006 to determine whether forest interior environments were maintained at five spatial scales. A 1.1% net loss of total forest area translated to net losses of 3.2% to 10.5% of forest interior area over spatial scales of 4.41 ha to 5,310 ha...

  9. Smoothed Analysis of Interior-Point Algorithms: Termination

    OpenAIRE

    Spielman, Daniel A.; Teng, Shang-Hua

    2003-01-01

    We perform a smoothed analysis of the termination phase of an interior-point method. By combining this analysis with the smoothed analysis of Renegar's interior-point algorithm by Dunagan, Spielman and Teng, we show that the smoothed complexity of an interior-point algorithm for linear programming is $O (m^{3} \\log (m/\\sigma))$. In contrast, the best known bound on the worst-case complexity of linear programming is $O (m^{3} L)$, where $L$ could be as large as $m$. We include an introduction ...

  10. Algoritmo del elipsoide interior para programación lineal

    OpenAIRE

    Salamanca Fernández, Ángel; Juan Ruiz, Jesús

    1991-01-01

    En este artículo se desarrolla un algoritmo de puntos interiores para programación lineal a partir de consideraciones geométricas. En cada iteración del método se dispone de un punto interior al politopo. Con centro en dicho punto se obtiene un elipsoide interior a dicho politopo. La optimización de la función objetivo lineal sobre el elipsoide se obtiene mediante la solución de un problema de mínimos cuadrados. El punto resultante se adopta para la siguiente iteración. Se proponen dos método...

  11. The lunar interior. [compressional velocities of interior materials compared with lunar seismic results

    Science.gov (United States)

    Anderson, D. L.; Kovach, R. L.

    1972-01-01

    The compressional velocities are estimated for materials thought to be important in the lunar interior and compared with lunar seismic results. The lower lunar crust has velocities appropriate for basalts or anorthosites. Anorthosite is preferred if lunar basalts result from a small degree of partial melting. The high velocities associated with the uppermost mantle imply high densities and a change to a lighter assemblage at depths of the order of 120 km. Ca- and Al-rich minerals are important components of both the lower crust and the upper mantle. Most of the moon may have accreted from refractory material rich in Ca, Al, U, and the rare-earth elements. The important mineral of the upper mantle is garnet; possible accessory minerals are kyanite, spinel and rutile. If the seismic results stand up, the high-velocity layer in the moon is more likely to be a high-pressure form of anorthosite than eclogite, pyroxenite, or dunite.

  12. Evaluation of the Immunity Activity of Glycyrrhizin in AR Mice

    Directory of Open Access Journals (Sweden)

    Ai-Guo Zhou

    2012-01-01

    Full Text Available In this study, we evaluated effect of glycyrrhizin on immunity function in allergic rhinitis (AR mice. The AR mice model were induced by dripping ovalbumin in physiological saline (2 mg mL−1, 10 μL into the bilateral nasal cavities using a micropipette. After the AR model was induced, mice were randomly divided into six groups: the normal control, model, lycopene 20 mg kg−1 (as positive control drug group, and glycyrrhizin 10, 20, 30 mg kg−1 groups. After the sensitization day 14, lycopene (20 mg/kg BW and glycyrrhizin (10, 20 and 30 mg/kg BW were given orally for 20 days once a day. Mice in the normal control and model groups were given saline orally once a day for 20 days. Results showed that glycyrrhizin treatment could dose-dependently significantly reduce blood immunoglobulin E (IgE, interleukin-4 (IL-4, interleukin-5 (IL-5, interleukin-6 (IL-6, nitrous oxide (NO, tumor necrosis factor-alpha (TNF-α levels and nitrous oxide synthase (NOS activity and enhance blood immunoglobulin A (IgA, immunoglobulin G (IgG, immunoglobulin M (IgM, interleukin-2 (IL-2 and interleukin-12 (IL-12 levels in AR mice. Furthermore, glycyrrhizin treatment could dose-dependently significantly enhance acetylcholinesterase (AchE activity and reduce substance P (SP level in peripheral blood and nasal mucosa of AR mice. We conclude that glycyrrhizin can improve immunity function in AR mice, suggesting a potential drug for the prevention and therapy of AR.

  13. Optical Emission Spectroscopic Studies of ICP Ar Plasma

    Institute of Scientific and Technical Information of China (English)

    QI Xuelian; REN Chunsheng; ZHANG Jian; MA Tengcai

    2007-01-01

    The ion line of 434.8 nm and atom line of 419.8 nm of Ar plasma produced by an inductively coupled plasma (ICP) were measured by optical emission spectroscopy and the influences from the working gas pressure, radio-frequency (RF) power and different positions in the discharge chamber on the line intensities were investigated in this study. It was found that the intensity of Ar atom line increased firstly and then saturated with the increase of the pressure. The line intensity of Ar+, on the other hand, reached a maximum value and then decreased along with the pressure. The intensity of the line in an RF discharge also demonstrated a jumping mode and a hysteresis phenomenon with the RF power. When the RF power increased to 400 W, the discharge jumped from the E-mode to the H-mode where the line intensity of Ar atom demonstrated a sudden increase, while the intensity of Ar+ ion only changed slightly. If the RF power decreased from a high value, e.g., 1000 W, the discharge would jump from the H-mode back to the E-mode at a power of 300 W. At this time the intensities of Ar and Ar+ lines would also decrease sharply. It was also noticed in this paper that the intensity of the ion line depended on the detective location in the chamber, namely at the bottom of the chamber the line was more intense than that in the middle of the chamber, but less intense than at the top, which is considered to be related to the capacitance coupling ability of the ICP plasma in different discharge areas.

  14. Acoustic Resonance Spectroscopy (ARS) Munition Classification System enhancements. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Vela, O.A.; Huggard, J.C.

    1997-09-18

    Acoustic Resonance Spectroscopy (ARS) is a non-destructive evaluation technology developed at the Los Alamos National Laboratory (LANL). This technology has resulted in three generations of instrumentation, funded by the Defense Special Weapons Agency (DSWA), specifically designed for field identification of chemical weapon (CW) munitions. Each generation of ARS instrumentation was developed with a specific user in mind. The ARS1OO was built for use by the U.N. Inspection Teams going into Iraq immediately after the Persian Gulf War. The ARS200 was built for use in the US-Russia Bilateral Chemical Weapons Treaty (the primary users for this system are the US Onsite Inspection Agency (OSIA) and their Russian counterparts). The ARS300 was built with the requirements of the Organization for the Prohibition of Chemical Weapons (OPCW) in mind. Each successive system is an improved version of the previous system based on learning the weaknesses of each and, coincidentally, on the fact that more time was available to do a requirements analysis and the necessary engineering development. The ARS300 is at a level of development that warrants transferring the technology to a commercial vendor. Since LANL will supply the computer software to the selected vendor, it is possible for LANL to continue to improve the decision algorithms, add features where necessary, and adjust the user interface before the final transfer occurs. This paper describes the current system, ARS system enhancements, and software enhancements. Appendices contain the Operations Manual (software Version 3.01), and two earlier reports on enhancements.

  15. Mass spectrometric measurements in inductively coupled CF4/Ar plasmas

    International Nuclear Information System (INIS)

    Positive ion fluxes, mean ion energies and ion energy distribution functions in low pressure CF4/Ar plasmas have been measured. The experiments were conducted in a Gaseous Electronics Conference cell using an inductively coupled plasma device powered by a 13.56 MHz radiofrequency (rf) power source. The measurements were made at 200 and 300 W of input rf power and at 10, 20, 30 and 50 mTorr gas pressures for three gas mixtures: (i) 20% CF4 : 80% Ar, (ii) 50% CF4 : 50% Ar and (iii) 80% CF4 : 20% Ar. A Langmuir probe was also used to measure plasma parameters such as ne, ni+ and electron energy distribution functions (EEDF) which were subsequently used to reconcile the mass spectrometer data. CF3+ is the most dominant fluorocarbon ion product of the plasma, followed by CF2+ and CF+. Ar+ is also detected in significant amounts with its relative flux increasing with the increase in Ar content in the gas mixture. Significant amounts of etch products, SiFx+/COF+x (x = 0-3), of the quartz window were also detected. The fluorocarbon ions are produced by direct electron impact and by ion-molecule reactions between Ar+ and CF4 as well as between CF3+ and CF4. However, the concentrations of CF2+ and CF+ are much larger than that which can be possibly produced from these two processes. The available cross-section data suggest that the direct electron impact ionization of the fragment neutrals and negative ion production by electron attachment may be responsible for the increase in the concentrations of the minor ions. F- densities, estimated by using the measured EEDF and positive ion flux data and the available cross-section data, agree well with the published experimental data

  16. Ulcera cutanea provocada por hongos del genero Fusarium

    Directory of Open Access Journals (Sweden)

    Negroni Ricardo

    1997-01-01

    Full Text Available Se presenta el caso de un paciente oriundo y procedente del Paraguay, de 40 años de edad, portador de una ulceración crónica en cara externa del pie izquierdo, de 2 meses de evolución, debida a una hialohifomicosis por Fusarium oxysporum. Se destacan las características clínicas, métodos de diagnóstico y terapeútica de esta micosis, además de las diferentes etiologías a considerar en el diagnóstico diferencial de una úlcera en personas procedentes del área tropical o subtropical.

  17. Ar-40-Ar-39 Age of an Impact-Melt Lithology in Lunar Meteorite Dhofar 961

    Science.gov (United States)

    Cohen, Barbara; Frasl, Barbara; Jolliff, Brad; Korotev, Randy; Zeigler, Ryan

    2016-01-01

    The Dhofar 961 lunar meteorite was found in 2003 in Oman. It is texturally paired with Dhofar 925 and Dhofar 960 (though Dhofar 961 is more mafic and richer in incompatible elements). Several lines of reasoning point to the South Pole-Aitken Basin (SPA) basin as a plausible source (Figure 2): Mafic character of the melt-breccia lithic clasts consistent the interior of SPA, rules out feldspathic highlands. Compositional differences from Apollo impact-melt groups point to a provenance that is separated and perhaps far distant from the Procellarum KREEP Terrane SPA "hot spots" where Th concentrations reach 5 ppm and it has a broad "background" of about 2 ppm, similar to lithic clasts in Dhofar 961 subsamples If true, impact-melt lithologies in this meteorite may be unaffected by the Imbrium-forming event that is pervasively found in our Apollo sample collection, and instead record the early impact history of the Moon.

  18. Morphology and Disease Information from Waterfowl, Interior Alaska, 2010

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This data set includes data from five waterfowl species (northern pintail, American wigeon, lesser scaup, green-winged teal and mallard) that were captured in...

  19. Vehicle Interior Noise Prediction Using Energy Finite Element Analysis Project

    Data.gov (United States)

    National Aeronautics and Space Administration — It is proposed to develop and implement a computational technique based on Energy Finite Element Analysis (EFEA) for interior noise prediction of advanced aerospace...

  20. Hybrid Prediction Method for Aircraft Interior Noise Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This proposal discusses the development and application of new methods of structural-acoustic analysis in order to address existing problems in aircraft interior...

  1. Connecting horizon pixels and interior voxels of a black hole

    International Nuclear Information System (INIS)

    In this paper we discuss to what extent one can infer details of the interior structure of a black hole based on its horizon. Recalling that black hole thermal properties are connected to the non-classical nature of gravity, we circumvent the restrictions of the no-hair theorem by postulating that the black hole interior is singularity free due to violations of the usual energy conditions. Further these conditions allow one to establish a one-to-one, holographic projection between Planckian areal “bits” on the horizon and “voxels”, representing the gravitational degrees of freedom in the black hole interior. We illustrate the repercussions of this idea by discussing an example of the black hole interior consisting of a de Sitter core postulated to arise from the local graviton quantum vacuum energy. It is shown that the black hole entropy can emerge as the statistical entropy of a gas of voxels

  2. Morphology and Disease Information from Waterfowl, Interior Alaska, 2010

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This data set includes data from three waterfowl species (northern pintail, American wdgeon, lesser scaup, green-winged teal and mallard) that were captured in...

  3. Interior-Point Method for Nonlinear Nonconvex Optimization

    Czech Academy of Sciences Publication Activity Database

    Matonoha, Ctirad; Lukšan, Ladislav; Vlček, Jan

    Hamburg : TUHH, 2008. s. 20-20. [GAMM Workshop /8./. 11.09.2008-12.09.2008, Hamburg] Institutional research plan: CEZ:AV0Z10300504 Keywords : nonlinear programming * interior point methods * indefinite systems * regularization

  4. Amount of Future Forest Interior at a 2 Hectare Scale

    Data.gov (United States)

    U.S. Environmental Protection Agency — Forests provide economic and ecological value. High amounts of forest interior indicates a highly connected forest, which generally enhances those economic and...

  5. Dynamical measurements of the interior structure of exoplanets

    International Nuclear Information System (INIS)

    Giant gaseous planets often reside on orbits in sufficient proximity to their host stars for the planetary quadrupole gravitational field to become non-negligible. In presence of an additional planetary companion, a precise characterization of the system's orbital state can yield meaningful constraints on the transiting planet's interior structure. However, such methods can require a very specific type of system. This paper explores the dynamic range of applicability of these methods and shows that interior structure calculations are possible for a wide array of orbital architectures. The HAT-P-13 system is used as a case study, and the implications of perturbations arising from a third distant companion on the feasibility of an interior calculation are discussed. We find that the method discussed here is likely to be useful in studying other planetary systems, allowing the possibility of an expanded survey of the interiors of exoplanets.

  6. Vehicle Interior Noise Prediction Using Energy Finite Element Analysis Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Prediction and enhancement of vehicle interior noise due to high frequency excitation, based on computer simulation, allows the application of the technology at the...

  7. The Memory Palace:Telling the Story of the Interior

    OpenAIRE

    Hollis, Edward

    2012-01-01

    This book chapter originated as an invited keynote paper at the Interior Educators 'Interior Futures 'conference at Northumbria University in 2011. The paper was blind peer revwied for publication. The content of the paper represents a process of reflection on my practice as a writer and the designer of narrative structures and building stories, and in it, for the first time, I was able to articulate the relationship between the narrative structures of my first book 'The Secret Lives of Buil...

  8. Improvement of Interior Ballistic Performance Utilizing Particle Swarm Optimization

    OpenAIRE

    El Sadek, Hazem; Zhang, Xiaobing; Rashad, Mahmoud; Cheng, Cheng

    2014-01-01

    This paper investigates the interior ballistic propelling charge design using the optimization methods to select the optimum charge design and to improve the interior ballistic performance. The propelling charge consists of a mixture propellant of seven-perforated granular propellant and one-hole tubular propellant. The genetic algorithms and some other evolutionary algorithms have complex evolution operators such as crossover, mutation, encoding, and decoding. These evolution operators have ...

  9. First Record of Diamondback Moth (Lepidoptera: Plutellidae) from Interior Alaska

    Science.gov (United States)

    Populations of Plutella xylostella, the diamondback moth, and subsequent crop damage was detected during 2005 at three locations in interior Alaska (64°50’22N, 148°07’52W; 64°51’22N, 147°51’04W; 64°42’01N, 148°51’42W). This represents the first record of diamondback moth in interior Alaska. Due to...

  10. Isochronic K-Ar age and helium isotopes of hyperbasite dike, Mossel peninsula, New Frisland (Spitsbergen)

    International Nuclear Information System (INIS)

    The age of a series of ultrabasic rocks and minerals, forming a hyperbasite dike in Mossel peninsula, Spitsbergen, was estimated by the isochronous K-Ar method using 40Ar/36Ar-40K/36Ar coordinates. The age of three peridotite samples and one olivine sample is found to be 1870±52 Ma

  11. Potential and opportunities for 40Ar-39Ar geochronology and thermochronology research in India. PD-3-4

    International Nuclear Information System (INIS)

    Geochronology based on radiogenic isotopes has become an invaluable tool in earth sciences. Several radioactive parent-daughter systems of varying half-lives such as Rb-Sr, Sm-Nd, K-Ar have been traditionally used by researchers for determining the timing of geological and planetary processes. 40Ar-39Ar dating, a variant of the K-Ar system, is a well established and versatile method of determining the eruptive ages of volcanic rocks and the ∼150-500 deg C thermal histories of a variety of more slowly cooled igneous and metamorphic rocks. This technique has been the most popular tool for dating felsic and intermediate volcanic rocks. For slowly cooled rocks, the K-Ar system yields ages that generally reflect the time elapsed since cooling below the closure temperature for argon of the mineral being analyzed and therefore becomes an extremely powerful tool for thermochronologic studies of orogenic systems. In recent years application of laser microprobe heating has enhanced the capabilities of this technique. Conventional 40Ar-39Ar step-heating experiments are designed to determine the bulk closure ages of aggregates of minerals like hornblende, muscovite, and biotite. The use of multidomain diffusion (MDD) modeling of K-feldspar developed by Lovera et al.,1989, has today become a very powerful tool for thermochronologic studies which provide constraints on the unroofing history of orogenic belts. Recently several new areas of research have been explored, including total-fusion dating of mineral grains from volcanic and sedimentary samples, mapping of argon isotopic gradients in crystals, and selective dating of fabric-defining minerals in polydeformed specimens

  12. 43 CFR 35.39 - Appeal to the Secretary of the Interior.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Appeal to the Secretary of the Interior. 35.39 Section 35.39 Public Lands: Interior Office of the Secretary of the Interior ADMINISTRATIVE REMEDIES FOR FRAUDULENT CLAIMS AND STATEMENTS § 35.39 Appeal to the Secretary of the Interior. (a)...

  13. Heterogeneous lithospheric mantle metasomatism in the eastern North China Craton: He-Ar isotopes in peridotite xenoliths from Cenozoic basalts

    Science.gov (United States)

    Tang, Huayun; Matsumoto, Takuya; Zheng, Jianping; Czuppon, György; Yu, Chunmei; Miyakawa, Chie; Ping, Xianquan

    2014-02-01

    The abundances and isotopic compositions of Helium and Argon have been analyzed in a suite of fresh spinel peridotite xenoliths in Cenozoic basalts from the eastern North China Craton (NCC) by step-wise heating experiments, to investigate the nature of noble gas reservoirs in the subcontinental lithospheric mantle beneath this region. The xenoliths include one harzburgite collected from Hebi in the interior of the NCC, two lherzolites from Hannuoba at the northern margin of the craton, and three lherzolites from Shanwang and Nushan on the eastern margin. 3He/4He ratios in most of the xenoliths are similar to those of mid-ocean ridge basalts (MORB) or slightly lower (2-10.5 Ra, where Ra is the 3He/4He ratio of the atmosphere), suggesting mixing of MORB-like and radiogenic components. One olivine separate from Nushan has a helium value of 25.3 Ra, probably suggesting cosmogenic 3He addition. The 40Ar/36Ar ratios vary from atmospheric value (296) to 1625, significantly lower than the MORB value. Available data of the peridotite xenoliths indicate the He and Ar isotopic systematics of the mantle reservoirs beneath the NCC can be interpreted as mixtures of at least three end-members including MORB-like, radiogenic and atmospheric components. We suggest that the MORB-like noble gases were derived from the underlying asthenosphere during mantle upwelling, whereas the radiogenic and recycled components probably were incorporated into the lithospheric mantle during circum-craton subduction of oceanic crust. Available data suggest that the MORB-like fluids are better preserved in the interior of the NCC, whereas the radiogenic ones are more prevalent at the margins. The Paleo-Asian ocean subduction system probably was responsible for the enriched and recycled noble gas signatures on the northern margin of the craton, while the Pacific subduction system could account for the observed He-Ar isotopic signatures beneath the eastern part. Therefore, integration of helium and

  14. Scout-view assisted interior micro-CT

    Science.gov (United States)

    Sharma, Kriti Sen; Holzner, Christian; Vasilescu, Dragoş M.; Jin, Xin; Narayanan, Shree; Agah, Masoud; Hoffman, Eric A.; Yu, Hengyong; Wang, Ge

    2013-06-01

    Micro computed tomography (micro-CT) is a widely-used imaging technique. A challenge of micro-CT is to quantitatively reconstruct a sample larger than the field-of-view (FOV) of the detector. This scenario is characterized by truncated projections and associated image artifacts. However, for such truncated scans, a low resolution scout scan with an increased FOV is frequently acquired so as to position the sample properly. This study shows that the otherwise discarded scout scans can provide sufficient additional information to uniquely and stably reconstruct the interior region of interest. Two interior reconstruction methods are designed to utilize the multi-resolution data without significant computational overhead. While most previous studies used numerically truncated global projections as interior data, this study uses truly hybrid scans where global and interior scans were carried out at different resolutions. Additionally, owing to the lack of standard interior micro-CT phantoms, we designed and fabricated novel interior micro-CT phantoms for this study to provide means of validation for our algorithms. Finally, two characteristic samples from separate studies were scanned to show the effect of our reconstructions. The presented methods show significant improvements over existing reconstruction algorithms.

  15. Scout-view assisted interior micro-CT

    International Nuclear Information System (INIS)

    Micro computed tomography (micro-CT) is a widely-used imaging technique. A challenge of micro-CT is to quantitatively reconstruct a sample larger than the field-of-view (FOV) of the detector. This scenario is characterized by truncated projections and associated image artifacts. However, for such truncated scans, a low resolution scout scan with an increased FOV is frequently acquired so as to position the sample properly. This study shows that the otherwise discarded scout scans can provide sufficient additional information to uniquely and stably reconstruct the interior region of interest. Two interior reconstruction methods are designed to utilize the multi-resolution data without significant computational overhead. While most previous studies used numerically truncated global projections as interior data, this study uses truly hybrid scans where global and interior scans were carried out at different resolutions. Additionally, owing to the lack of standard interior micro-CT phantoms, we designed and fabricated novel interior micro-CT phantoms for this study to provide means of validation for our algorithms. Finally, two characteristic samples from separate studies were scanned to show the effect of our reconstructions. The presented methods show significant improvements over existing reconstruction algorithms. (paper)

  16. Interior microelectrolysis oxidation of polyester wastewater and its treatment technology

    International Nuclear Information System (INIS)

    This paper has investigated the effects of interior microelectrolysis pretreatment on polyester wastewater treatment and analyzed its mechanism on COD and surfactant removal. The efficiency of interior microelectrolysis is mainly influenced by solution pH, aeration and reaction time. Contaminants can be removed not only by redox reaction and flocculation in the result of ferrous and ferric hydroxides but also by electrophoresis under electric fields created by electron flow. pH confirms the chemical states of surfactants, Fe(II)/Fe(III) ratio and the redox potential, and thus influences the effects of electrophoresis, flocculation and redox action on contaminant removal. Anaerobic and aerobic batch tests were performed to study the degradation of polyester wastewater. The results imply that interior microelectrolysis and anaerobic pretreatment are lacking of effectiveness if applied individually in treating polyester wastewater in spite of their individual advantages. The interior microelectrolysis-anaerobic-aerobic process was investigated to treat polyester wastewater with comparison with interior microelectrolysis-aerobic process and anaerobic-aerobic process. High COD removal efficiencies have been gotten by the combination of interior microelectrolysis with anaerobic technology and aerobic technology. The results also imply that only biological treatment was less effective in polyester wastewater treatment.

  17. High-resolution Auger spectroscopy on 79 MeV Ar5+, 89 MeV Ar6+, and 136 MeV Ar7+ ions after excitation by helium

    International Nuclear Information System (INIS)

    In this thesis the atomic structure of highly excited Ar6+ and Ar7+ ions was studied. For this 79 MeV Ar5+, 89 MeV Ar6+, and 136 MeV Ar7+ ions of a heavy ion accelerator were excited by a He gas target to autoionizing states and the Auger electrons emitted in the decay were measured in highly-resolving state. The spectra were taken under an observational angle of zero degree relative to the beam axis in order to minimize the kinematical broadening of the Auger lines. (orig./HSI)

  18. Fission-fragment nuclear lasing of Ar/He/-Xe

    Science.gov (United States)

    De Young, R. J.; Shiu, Y. J.; Williams, M. D.

    1980-01-01

    Nuclear-pumped lasing of Ar-Xe and He-Xe has been demonstrated using (U-235)F6 fission-fragment excitation. Fission fragments were created by absorption of thermal neutrons in a combination of gaseous (U-235)F6 and laser-tube wall coatings formed from UF6 chemical reaction products. At a pressure of 600 torr Ar-(3%)Xe, lasing occurred at 2.65 microns in Xe. Up to 3 torr of gaseous (U-235)F6 was added to 600 torr Ar-Xe before serious laser quenching occurred. With 3 torr of (U-235)F6 added, 38% of the energy deposition came from gaseous UF6 and the remainder from the uranium wall coating. The neutron flux at lasing threshold was found to be 4 x 10 to the 15th n/sq cm sec.

  19. Modelling Ar II spectral emission from the ASTRAL helicon plasma

    Science.gov (United States)

    Munoz Burgos, Jorge; Boivin, Robert; Loch, Stuart; Kamar, Ola; Ballance, Connor; Pindzola, Mitch

    2008-11-01

    We describe our spectral modeling of ArII emission from the ASTRAL helicon plasma at Auburn University. Collisional-radiative theory is used to model the emitted spectrum, with account being taken for the density and temperature variation along the line of sight. This study has two main aims. Firstly to test the atomic data used in the model and secondly to identify spectral line ratios in the 200 nm - 1000 nm range that could be used as temperature diagnostics. Using the temperature at which Ar II emission starts to be seen we have been able to test recent ionization and recombination data. Using selected spectral lines we were then able to test the importance of the continuum-coupling effects included in the most recent Ar+ electron impact excitation data. Selected spectral line ratios have been identified that show a strong temperature variation and have potential as a temperature diagnostic.

  20. Factor Structure of CIWA-Ar in Alcohol Withdrawal.

    Science.gov (United States)

    Bakhla, Ajay Kumar; Khess, Christoday R J; Verma, Vijay; Hembram, Mahesh; Praharaj, Samir Kumar; Soren, Subhas

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance), and the third had two items (10.04% variance). Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors. PMID:24826372

  1. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    Directory of Open Access Journals (Sweden)

    Ajay Kumar Bakhla

    2014-01-01

    Full Text Available Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance, second factor also had four items (24.25% variance, and the third had two items (10.04% variance. Conclusions. Factor analysis reveals the existence of multidimensionality of alcohol withdrawal as measured with CIWA-Ar and we found three factors that can be named as delirious, autonomic and nonspecific factors.

  2. Etching characteristics and mechanisms of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas

    Science.gov (United States)

    Lim, Nomin; Efremov, Alexander; Yeom, Geun Young; Choi, Bok-Gil; Kwon, Kwang-Ho

    2014-11-01

    The etching characteristics and mechanism of Mo thin films in Cl2/Ar and CF4/Ar inductively coupled plasmas under the same operating conditions (pressure, 6 mTorr; input power, 700 W; bias power, 200 W) were investigated. For both gas mixtures, an increase in the Ar fraction or gas pressure at a fixed gas mixing ratio was found to cause a non-monotonic change in the Mo etching rates. The X-ray photoelectron spectroscopy (XPS) diagnostics indicated contamination of the etched surfaces by reaction products. The Cl2/Ar and CF4/Ar plasma parameters were also investigated using a combination of a zero-dimensional plasma model and plasma diagnostics using Langmuir probes. An analysis of the etching kinetics with the model-predicted fluxes of the plasma active species suggests that: 1) the Mo etching process occurs in the transitional regime of the ion-assisted chemical reaction, and 2) the non-monotonic Mo etching rate is probably associated with opposing changes in the fluxes of the reactive neutral species and ion energy.

  3. 40Ar/39Ar laser probe evidence concerning the age and associated hazards of the Lake Nyos Maar, Cameroon

    Science.gov (United States)

    Dalrymple, G.B.; Lockwood, J.P.

    1990-01-01

    The waters of Lake Nyos are impounded by a fragile natural dam composed of pyroclastic rocks ejected during the formation of the lake crater (maar). Lateral erosion of this dam has reduced its width from over 500 m to only 45 m. Published whole-rock K-Ar ages of about 100 ka on juvenile basalt from the dam suggests that erosion has been slow and that the dam poses no imminent threat. New apparent 40Ar/39Ar ages of 1.4 to 232 Ma on xenocrystic K-feldspar contained in the basalt show that the xenocrysts, whose source is the 528-Ma crystalline basement, are carriers of inherited radiogenic 40Ar and would cause the whole-rock K-Ar ages to be too old. The best estimate for the age of the maar is provided by a 14C age of 400 ?? 100 yr BP on charcoal from the base of the dam. This young age indicates that the dam is eroding at a relatively rapid rate; its failure, perhaps within a few decades, would result in a major flood and imperil thousands of people living downstream in Cameroon and eastern Nigeria. ?? 1990 Kluwer Academic Publishers.

  4. 40Ar-39Ar age of the Shergotty achondrite and implications for its post-shock thermal history

    International Nuclear Information System (INIS)

    Analyses of 40Ar-39Ar have been made on a whole rock sample and a maskelynite (feldspar) separate of the shocked Shergotty achondrite. The maskelynite gave a plateau age of 254 +- 10 Myr. The whole rock sample gave a complex release with apparent ages between 240 and 640 Myr. The slightly younger Rb-Sr isochron age of 165 Myr for Shergotty suggests that the maskelynite as well as the whole rock was incompletely degassed. Reasonable Ar diffusion characteristics for Shergotty for shock heating temperatures of 0C indicate D/a2 of 10-11 to 10-13sec-1. The time required to lose 95% of the 40Ar from the plagioclase would be approximately 103 to 104 yr. When this gas diffusion time is introduced into a thermal model of a cooling ejecta blanket of variable thickness, a post-shock cooling time of >= 103 yr and a burial depth of >= 300 m are indicated for Shergotty. These conclusions are not seriously affected by uncertainties in the thermal model. Most likely the shock event occurred approximately 165 Myr ago, but no earlier than 250 Myr ago, when the Shergotty parent object experienced a collision in the asteroid belt. As a result of that collision, feldspar was converted to maskelynite, the K-Ar and Rb-Sr ages were completely or nearly completely reset, and the Shergotty meteorite was heated to 0C and left to cool slowly inside the parent body. (author)

  5. A DNA polymerase mutation that suppresses the segregation bias of an ARS plasmid in Saccharomyces cerevisiae.

    OpenAIRE

    Houtteman, S W; Elder, R T

    1993-01-01

    Yeast autonomously replicating sequence (ARS) plasmids exhibit an unusual segregation pattern during mitosis. While the nucleus divides equally into mother and daughter cells, all copies of the ARS plasmid will often remain in the mother cell. A screen was designed to isolate mutations that suppress this segregation bias. A plasmid with a weak ARS (wARS) that displayed an extremely high segregation bias was constructed. When cells were grown under selection for the wARS plasmid, the resulting...

  6. Two-proton emission in the decay of 31Ar

    International Nuclear Information System (INIS)

    Several beta-delayed two-proton branches were observed in the decay of 31Ar, the most intense ones proceeding through the isobaric analogue state (IAS) in 31Cl. The mechanism of the two-proton emission is studied via the energy and angular distributions of the two protons. Simultaneous emission of the two protons fits the present data well, sequential decays might also describe them. Independent of the decay mechanism, a spin of 5/2 for the IAS is suggested. An improved limit on the direct two-proton emission from the ground state of 31Ar is presented. (orig.)

  7. Efeito dos incêndios florestais na qualidade do ar

    OpenAIRE

    Miranda, Ana Isabel

    1998-01-01

    Os incêndios florestais podem ser considerados como um processo de combustão natural em grande escala, que consome diversas espécies vegetais numa área geográfica específica Consequentemente, consistem numa fonte potencial de elevadas quantidades de poluentes para a atmosfera, sendo indispensável conhecer o seu impacto na qualidade do ar. O objectivo principal deste trabalho consiste no estudo do efeito das emissões dos incêndios florestais na qualidade do ar. Para tal, foram d...

  8. Axenfeld-Rieger syndrome (ARS): A review and case report.

    LENUS (Irish Health Repository)

    Waldron, Jennie M

    2011-08-29

    Axenfeld-Rieger syndrome (ARS) is a rare, autosomal dominant condition characterized by ocular, craniofacial, dental, and periumbilical abnormalities. Relatively little information exists on this syndrome within the dental literature despite the fact that midface hypoplasia and maxillary hypodontia are classical presenting features of this syndrome. This is a case report of a 7-year-old Caucasian female with ARS who presented with significant ocular and dental anomalies. She was also found to have osteopenia. Her dental condition is described, her immediate treatment is shown, and her long-term treatment needs are discussed.

  9. Effects of Ar+ ion implantation on tribological behaviour of UHMWPE

    International Nuclear Information System (INIS)

    Ultra-high molecular weight polyethylene (UHMWPE) was implanted with Ar+. The modified surfaces were characterized by OM, AFM and NTM and FT-IR. And, tribological behaviour of UHMWPE was evaluated using a tribometer. The results show that alterations in surface colour, morphology and microstructure of UHMWPE were induced by Ar+ implantation, and the mechanical properties in terms of microhardness and elastic modulus were improved. The wear properties of modified UHMWPE were enhanced significantly, both in dry friction and under deionized water lubrication. The degree of property improvement increased with the implantation dose, with increasing friction coefficient, though. (authors)

  10. Development of a low-level Ar-37 calibration standard

    CERN Document Server

    Williams, R M; Bowyer, T W; Day, A R; Fuller, E S; Haas, D A; Hayes, J C; Hoppe, E W; Humble, P H; Keillor, M E; LaFerriere, B D; Mace, E K; McIntyre, J I; Miley, H S; Myers, A W; Orrell, J L; Overman, C T; Panisko, M E; Seifert, A

    2016-01-01

    Argon-37 is an environmental signature of an underground nuclear explosion. Producing and quantifying low-level Ar-37 standards is an important step in the development of sensitive field measurement instruments. This paper describes progress at Pacific Northwest National Laboratory in developing a process to generate and quantify low-level Ar-37 standards, which can be used to calibrate sensitive field systems at activities consistent with soil background levels. This paper presents a discussion of the measurement analysis, along with assumptions and uncertainty estimates.

  11. Arándano rojo I (Vaccinium macrocarpon Ait.)

    OpenAIRE

    Garrido Conejero, M. Victoria; Pérez-Urria Carril, Elena

    2014-01-01

    El arándano rojo o arándano rojo americano (Vaccinium macrocarpon Ait.) es una fruta muy consumida y apreciada que ha ganado popularidad con los años debido en parte a su contenido en compuestos beneficiosos para la salud humana. En el trabajo se consideran aspectos botánicos, composición nutricional y contenido en compuestos fitoquímicos, datos históricos y culturales e información sobre el cultivo de esta especie vegetal y sus variedades. También se considera su importancia económica y algu...

  12. Adsorption of Ar on a nonuniform MgO surface

    Science.gov (United States)

    Hinman, D. C.; Halsey, G. D.

    1976-01-01

    Data are presented for the adsorption of Ar and N2 on a strongly heterogeneous MgO surface at 84 K and for Ar at a range of temperatures between 130 and 250 K. The high-temperature data are analyzed according to a model which separates the contributions to the potential into bulk and surface terms, providing a method for the determination of the surface area from parameters characteristic of the bulk material. A solid-gas energy parameter and parameters indicating the strength of the impurity sites are also evaluated.

  13. Multiphoton Double Ionization of Ar and Ne Close to Threshold

    International Nuclear Information System (INIS)

    In kinematically complete studies we explore double ionization (DI) of Ne and Ar in the threshold regime (I>3x1013 W/cm2) for 800 nm, 45 fs pulses. The basic differences are found in the two-electron momentum distributions - 'correlation' (CO) for Ne and 'anticorrelation' (ACO) for Ar - that can be partially explained theoretically within a 3D classical model including tunneling. Transverse electron momentum spectra provide insight into 'Coulomb focusing' and point to correlated nonclassical dynamics. Finally, DI threshold intensities, CO as well as ACO regimes are predicted for both targets.

  14. Web authentic and similar texts detection using AR digital signature

    OpenAIRE

    Πούλος, Μάριος; Σκιαδόπουλος, Σπύρος; Μπώκος, Γιώργος Δ.

    2010-01-01

    In this paper, we propose a new identification technique based on an AR model with a complexity of size O(n) times in web form, with the aim of creating a unique serial number for texts and to detect authentic or similar texts. For the implementation of this purpose, we used an Autoregressive Model (AR) 15 th order, and for the identification procedure, we employed the cross-correlation algorithm. Empirical investigation showed that the proposed method may be used as an accurate method for id...

  15. Medidas da umidade relativa do ar em um ambiente fechado

    OpenAIRE

    Costa Eden V.

    2003-01-01

    Umidade do ar e o vapor d'água presente na atmosfera. Neste trabalho medimos a umidade relativa do ar em um ambiente fechado onde a temperatura foi mantida constante. Nestas condições, a umidade cresce até o vapor d'água tornar-se saturado. Neste instante, a umidade é máxima. O aparato experimental utilizado consiste de recipiente fechado de vidro, higrômetro, termômetro e relógio. Trata-se, portanto, de um experimento simples, possível de ser realizado em um laboratório didático e capaz de p...

  16. Factor Structure of CIWA-Ar in Alcohol Withdrawal

    OpenAIRE

    Ajay Kumar Bakhla; Khess, Christoday R.J.; Vijay Verma; Mahesh Hembram; Samir Kumar Praharaj; Subhas Soren

    2014-01-01

    Objective. To identify the underlying factor structure of alcohol withdrawal syndrome, as measured with CIWA-Ar. Methods. Exploratory factor analysis was conducted on the items of CIWA-Ar. On 201 alcohol-dependent male patients seeking treatment for alcohol withdrawal at 36 hours of abstinence. Results. A three-factor solution was obtained that accounted for 68.74% of total variance. First factor had loading from four items (34.34% variance), second factor also had four items (24.25% variance...

  17. Petrografía y edad 40Ar/39Ar de leucogranitos peraluminosos al oeste de Valcheta: Macizo Nordpatagónico (Río Negro

    Directory of Open Access Journals (Sweden)

    Martín R. Gozalvez

    2009-04-01

    Full Text Available Entre la localidad rionegrina de Valcheta y la Estación Muster del ex ferrocarril Gral. Roca se localizan numerosos afloramientos de leucogranitos que en conjunto forman un cuerpo plutónico de bordes rectos y geometría elipsoidal, aquí denominado plutón Valcheta. El intrusivo mencionado forma parte del basamento ígneo-metamórfico del sector oriental del macizo nordpatagónico. El plutón Valcheta es un cuerpo leucogranítico, peraluminoso (A/CNK >1,1, de grano medio, levemente deformado en los bordes, compuesto por una facies leucogranítica con muscovita-biotita-granate y otra con muscovita-biotita. Las zonas de contacto con los esquistos de la Formación Nahuel Niyeu están cubiertas y en su interior presenta xenolitos de gneises y anfibolitas inyectados por material leucocrático. El estudio radimétrico 40Ar/39Ar en muscovita del plutón Valcheta resultó en una edad de 470 ± 1,8 Ma. Estos datos permiten descartar la correlación de rocas leucogranitcas aflorantes al noroeste de Valcheta con el Granito Flores de edad jurásica. El plutón Valcheta presenta diferencias macroscópicas, petrográficas, microestructurales y composicionales con los intrusivos ordovícicos del Complejo Plutónico Punta Sierra, aflorante sobre la costa atlántica rionegrina. En consecuencia, la extensión del magmatismo ordovícico del este del Macizo Nordpatagónico hasta las inmediaciones de Valcheta debe ser revisada. La morfología, mineralogía, rasgos microestructurales y geoquímica del plutón Valcheta se comparan favorablemente con los leucogranitos del Complejo Mina Gonzalito que forman los plutones Tapera y María Teresa. El pico metamórfico de dicho complejo, según dataciones U-Pb en circones, es del Ordovícico medio (472 ± 5 Ma. El plutón Valcheta es composicionalmente semejante a leucogranitos post-colisionales tipo S formados en una corteza engrosada.

  18. Characterization of the ars Gene Cluster from Extremely Arsenic-Resistant Microbacterium sp. Strain A33▿ †

    Science.gov (United States)

    Achour-Rokbani, Asma; Cordi, Audrey; Poupin, Pascal; Bauda, Pascale; Billard, Patrick

    2010-01-01

    The arsenic resistance gene cluster of Microbacterium sp. A33 contains a novel pair of genes (arsTX) encoding a thioredoxin system that are cotranscribed with an unusual arsRC2 fusion gene, ACR3, and arsC1 in an operon divergent from arsC3. The whole ars gene cluster is required to complement an Escherichia coli ars mutant. ArsRC2 negatively regulates the expression of the pentacistronic operon. ArsC1 and ArsC3 are related to thioredoxin-dependent arsenate reductases; however, ArsC3 lacks the two distal catalytic cysteine residues of this class of enzymes. PMID:19966021

  19. 40Ar/39Ar geochronology at the Instituto de Geociências, USP: instrumentation, analytical procedures, and calibration

    Directory of Open Access Journals (Sweden)

    PAULO M. VASCONCELOS

    2002-06-01

    Full Text Available Laser heating 40Ar/39Ar geochronology provides high analytical precision and accuracy, mum-scale spatial resolution, and statistically significant data sets for the study of geological and planetary processes. A newly commissioned 40Ar/39Ar laboratory at CPGeo/USP, São Paulo, Brazil, equips the Brazilian scientific community with a new powerful tool applicable to the study of geological and cosmochemical processes. Detailed information about laboratory layout, environmental conditions, and instrumentation provides the necessary parameters for the evaluation of the CPGeo/USP 40Ar/39Ar suitability to a diverse range of applications. Details about analytical procedures, including mineral separation, irradiation at the IPEN/CNEN reactor at USP, and mass spectrometric analysis enable potential researchers to design the necessary sampling and sample preparation program suitable to the objectives of their study. Finally, the results of calibration tests using Ca and K salts and glasses, international mineral standards, and in-house mineral standards show that the accuracy and precision obtained at the 40Ar/39Ar laboratory at CPGeo/USP are comparable to results obtained in the most respected laboratories internationally. The extensive calibration and standardization procedures undertaken ensure that the results of analytical studies carried out in our laboratories will gain immediate international credibility, enabling Brazilian students and scientists to conduct forefront research in earth and planetary sciences.A geocronologia de 40Ar/39Ar por aquecimento a laser permite alta precisão e acurácia analítica, tem resolução espacial em escala micrométrica, e fornece um número de dados estatisticamente significantes para o estudo de processos geológicos e planetários. Um recém construído laboratório de 40Ar/39Ar no CPGeo/USP, São Paulo, Brazil, mune a sociedade científica brasileira com uma técnica eficaz aplicável aos estudos geol

  20. Late Cretaceous remagnetization of Proterozoic mafic dikes, southern Highland Mountains, southwestern Montana: A paleomagnetic and 40Ar/39Ar study

    Science.gov (United States)

    Harlan, S.S.; Geissman, J.W.; Snee, L.W.; Reynolds, R.L.

    1996-01-01

    Paleomagnetic results from Early Proterozoic metabasite sills and Middle Proterozoic diabase dikes from the southern Highland Mountains of southwestern Montana give well-defined, dual-polarity magnetizations that are statistically identical to those from a small Late Cretaceous pluton that cuts the dikes. The concordance of paleomagnetic directions from rocks of three widely separated ages indicates that the Proterozoic rocks were remagnetized, probably during Late Cretaceous time. Paleomagnetic, rock magnetic, and petrographic observations from the metabasite and diabase samples indicate that remanence is carried primarily by low-Ti magnetite. Combining virtual geomagnetic poles from metabasite sills, diabase dikes, and the Late Cretaceous pluton, we obtain a paleomagnetic pole at 85.5??N, 310.7??E (K = 19.9, A95 = 9.1??, N = 14 sites) that is similar to a reference pole from the 74 Ma Adel Mountain Volcanics of western Montana. Biotite and hornblende 40Ar/39Ar isotopic dates from host basement geneiss and a hornblende from a remagnetized metabasite sill yield ages of ca. 1800 Ma; these dates probably record cooling of the southern Highland Mountains following high-grade metamorphism at 1.9-1.8 Ga. The gneiss and metabasite age spectra show virtually no evidence of disturbance, indicating that the basement rocks were never heated to temperatures sufficient to cause even partial resetting of their argon systems. Thus, the overprint magnetization of the Highland Mountains rocks is not a thermoremanent magnetization acquired during conductive cooling of nearby Late Cretaceous plutons. Remagnetization of the metabasite sills and diabase dikes was probably caused by localized thermochemical and thermoviscous effects during circulation of Late Cretaceous hydrothermal fluids related to epithermal mineralization. The absence of significant disturbance to the 40Ar/39Ar age spectrum from the remagnetized metabasite hornblende indicates that some secondary magnetizations may

  1. Thermal History of the Felsite Unit, Geysers Geothermal Field, From Thermal Modeling of 40Ar/39Ar Incremental Heating Data

    Energy Technology Data Exchange (ETDEWEB)

    T. M. Harrison (U of California); G. B. Dalrymple (Oregon State U); J. B. Hulen (U of Utah); M. A. Lanphere; M. Grove; O. M. Lovera

    1999-08-19

    An Ar-40/Ar-39 and U-Pb study was performed of the Geysers plutonic complex of the Geysers Geothermal Field in California. Sixty-nine ion microprobe spot analyses of zircons from four granite samples from the plutonic complex that underlies the Geysers geothermal field yielded Pb-207/Pb-206 vs. U-238/Pb-206 concordia ages ranging from 1.13 {+-} 0.04 Ma to 1.25 {+-} 0.04 Ma. The U-Pb ages coincide closely with Ar-40/Ar-39 age spectrum plateau and ''terminal'' ages from coexisting K-feldspars and with the eruption ages of overlying volcanic rocks. The data indicate that the granite crystallized at 1.18 Ma and had cooled below 350 C by {approximately}0.9-1.0 Ma. Interpretation of the feldspar Ar-40/Ar-39 age data using multi-diffusion domain theory indicates that post-emplacement rapid cooling was succeeded either by slower cooling from 350-300 C between 1.0 and 0.4 Ma or transitory reheating to 300-350 C at about 0.4-0.6 Ma. Heat flow calculations constrained with K-feldspar thermal histories and the pre sent elevated regional heal flow anomaly demonstrate that appreciable heat input from sources external to the known Geysers plutonic complex is required to maintain the geothermal system. This requirement is satisfied by either a large, underlying, convecting magma chamber (now solidified) emplaced at 1.2 Ma or episodic intrusion of smaller bodies from 1.2-0.6 Ma.

  2. 39Ar/40Ar dating of the trans-Himalayan calc-alkaline magmatism of southern Tibet

    International Nuclear Information System (INIS)

    The results are reported of an 39Ar-40Ar age determination investigation which show that the earlier basic plutons of the southern edge of the trans-Himalayan belt have ages of 90-110 Myr (Albian to Cenomanian), whereas the lavas of the upper unconformable series are clearly younger (60 Myr, Palaeocene). Comparing the present results with those obtained from the Ladakh and Kohistan magmatic belts further west it is concluded that a subduction zone has been active during the Cretaceous between India and Asia. (U.K.)

  3. ^(40)Ar/^(39)Ar constraints on the age and thermal history of the Urucum Neoproterozoic banded iron-formation, Brazil

    OpenAIRE

    Piacentini, Thiago; Vasconcelos, Paulo M.; Farley, Kenneth A.

    2013-01-01

    Urucum is one of the youngest banded iron-formations (BIFs) yet its exact age remains uncertain. ^(40)Ar/^(39)Ar geochronology on late-diagenetic to early metamorphic cryptomelane from the Urucum sequence reveals a minimum depositional age of 587 ± 7 Ma. Metamorphic braunite age spectra yield flat segments defining apparent ages of 547 ± 3 Ma to 513 ± 4 Ma, interpreted as recrystallization or cooling ages. Metamorphic muscovite grains from a meta-arkose interbedded with the BIF yield reproduc...

  4. Interior crises in quasiperiodically forced period-doubling systems

    International Nuclear Information System (INIS)

    As a representative model for quasiperiodically forced period-doubling systems, we consider the quasiperiodically forced logistic map, and investigate the dynamical mechanism for the interior crises. For small quasiperiodic forcing ε, a chaotic attractor abruptly widens via a 'standard' interior crisis when it collides with a smooth unstable torus. However, as ε passes a threshold value, the smooth unstable torus loses its accessibility from the interior of the basin of the attractor. For this case, we use the rational approximation to the quasiperiodic forcing, and find that a nonstandard interior crisis occurs for a nonchaotic attractor (smooth torus or strange nonchaotic attractor) as well as a chaotic attractor when it collides with an invariant 'ring-shaped' unstable set. Particularly, we note that a three-band smooth torus transforms into a single-band intermittent strange nonchaotic attractor through the nonstandard interior crisis. The intermittent strange nonchaotic attractor is also characterized in terms of the average interburst time and the local Lyapunov exponent

  5. Improvement of Interior Ballistic Performance Utilizing Particle Swarm Optimization

    Directory of Open Access Journals (Sweden)

    Hazem El Sadek

    2014-01-01

    Full Text Available This paper investigates the interior ballistic propelling charge design using the optimization methods to select the optimum charge design and to improve the interior ballistic performance. The propelling charge consists of a mixture propellant of seven-perforated granular propellant and one-hole tubular propellant. The genetic algorithms and some other evolutionary algorithms have complex evolution operators such as crossover, mutation, encoding, and decoding. These evolution operators have a bad performance represented in convergence speed and accuracy of the solution. Hence, the particle swarm optimization technique is developed. It is carried out in conjunction with interior ballistic lumped-parameter model with the mixture propellant. This technique is applied to both single-objective and multiobjective problems. In the single-objective problem, the optimization results are compared with genetic algorithm and the experimental results. The particle swarm optimization introduces a better performance of solution quality and convergence speed. In the multiobjective problem, the feasible region provides a set of available choices to the charge’s designer. Hence, a linear analysis method is adopted to give an appropriate set of the weight coefficients for the objective functions. The results of particle swarm optimization improved the interior ballistic performance and provided a modern direction for interior ballistic propelling charge design of guided projectile.

  6. Tensor Effect on Proton Bubble Structure of ~(46)Ar

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    We have calculated the proton density distribution of 46Ar for different pairing interactions with the Skyrme interactions SLy5 and SLy5+Tw (Tw is the tensor force, which was obtained by the G-matrix calculations and added perturbatively into the SLy5 interaction

  7. Pulsed electric field (PEF)research at USDA, ARS, ERRC

    Science.gov (United States)

    This article summarizes the effects of pulsed electric fields on the microbiological safety and quality aspects of various liquid food matrices, obtained at USDA, ARS, Eastern Regional Research Center under CRIS Project No. 1935-41420-013-00D, Processing Intervention Technologies for Enhancing the S...

  8. Magnetic Energy and Helicity Budgets in NOAA AR 11158

    CERN Document Server

    Tziotziou, Kostas; Liu, Yang

    2013-01-01

    In previous works we introduced a nonlinear force-free method that self-consistently calculates the instantaneous budgets of free magnetic energy and relative magnetic helicity in solar active regions (ARs). Calculation is expedient and practical, using only a single vector magnetogram per computation. We apply this method to a timeseries of 600 high-cadence vector magnetograms of the eruptive NOAA AR 11158 acquired by the Helioseismic and Magnetic Imager onboard the Solar Dynamics Observatory over a five-day observing interval. Besides testing our method extensively, we use it to interpret the dynamical evolution in the AR, including eruptions. We find that the AR builds large budgets of both free magnetic energy and relative magnetic helicity, sufficient to power many more eruptions than the ones it gave within the interval of interest. For each of these major eruptions, we find eruption-related decreases and subsequent free-energy and helicity budgets that are consistent with the observed eruption (flare a...

  9. Atom trap trace analysis of {sup 39}Ar

    Energy Technology Data Exchange (ETDEWEB)

    Welte, Joachim

    2011-12-14

    Detection of {sup 39}Ar in natural water samples can be employed for radiometric dating on a timescale of 50 to 1000 years before present. This experimental work comprises the setup of an atomic beam and trap apparatus that captures and detects {sup 39}Ar atoms by the laser-cooling technique ''Atom Trap Trace Analysis''. With this approach, the limitations of low-level counting, regarding sample size and measurement time, could be overcome. In the course of this work, the hyperfine structure spectrum of the cooling transition 1s{sub 5}-2p{sub 9} has been experimentally determined. A high intensity, optically collimated beam of slow metastable argon atoms has been set up and fluorescence detection of individual {sup 39}Ar atoms in a magneto-optical trap is realized. {sup 39}Ar count rates of 1 atom in about 4 hours have been achieved for atmospheric argon. Recent improvements further suggest that even higher count rates of 1 atom/hour are within reach.

  10. Expansion of the USDA ARS Aerial Application spray atomization models

    Science.gov (United States)

    An effort is underway to update the USDA ARS aerial spray nozzle models using new droplet sizing instrumen-tation and measurement techniques. As part of this effort, the applicable maximum airspeed is being increased from 72 to 80 m/s to provide guidance to applicators when using new high speed air...

  11. USDA-ARS and EMBRAPA Scientists Build Bridges With Strawberries

    Science.gov (United States)

    At the '3rd Simposio Nacional do Morango'and '2nd Encontro de Pequenas Frutas e Frutas Nativas do Mercosul' at Pelotas, Rio Grande Do Sul, Brazil, held 7 - 10 November 2006, I was invited to describe strawberry breeding in the United States and also my own USDA-ARS strawberry breeding program at Bel...

  12. Important authorship clarification for arXiv:1010.2709

    OpenAIRE

    Yaffe, Yoav

    2010-01-01

    Version 1 of this paper (arXiv:1010.2709v1) was submitted exclusively by Noa Lavi, without prior knowledge, let alone consent, by Yoav Yaffe. Yoav Yaffe is {\\em not} an author of any version of this paper, with the exception of the present clarification.

  13. Spectroscopy Study of Ar + CO2 Plasmas in ASTRAL.

    Science.gov (United States)

    Munoz, Jorge; Boivin, Robert; Kamar, Ola; Loch, Stuart; Ballance, Connor

    2006-10-01

    A spectroscopy study of the ASTRAL (Auburn Steady sTate Research fAciLity) helicon plasma source running Ar + CO2 gas mix is presented. ASTRAL produces Ar plasmas: ne = 10^10 to 10^13 cm-3, Te = 2 to 10 eV and Ti = 0.03 to 0.5 eV. A series of 7 large coils produce an axial magnetic field up to 1.3 kGauss. A fractional helix antenna is used to introduce rf power up to 2 kWatt. A spectrometer which features a 0.33 m Criss-Cross monochromator and a CCD camera is used for this study. Very different plasmas are produced following the relative importance of CO2 in the gas mixture. At low CO2 concentration, the plasmas are similar to those obtained with pure Ar with weak CO2, CO2^+, CO and CO^+ bands. The usual blue plasma core associated with intense Ar II transitions is observed with however a significant white glow coming from the outer plasma regions. At higher CO2 concentration, the plasma becomes essentially molecular and can be described as an intense white plasma column. Molecular dissociative processes associated with the production of strong C and O atomic lines are observed under specific plasma conditions. The atomic spectral lines are compared with ADAS modeling results. This study indicates the possible advantages of using a helicon source to control the CO2 plasma chemistry for industrial applications.

  14. Quantum vibrational dynamics of the Ar2ICl cluster

    Science.gov (United States)

    Valdés, Álvaro; Prosmiti, Rita

    2016-03-01

    Quantum mechanical multiconfiguration time-dependent Hartree (MCTDH) calculations are presented for the Ar2ICl cluster. The Hamiltonian operator is expressed in satellite coordinates, with its potential term being represented as a sum of the three-body ArICl ab initio parameterized interactions plus the Ar-Ar ones. The potential surface shows different type of low-lying minima (global and local), that influence the vibrational dynamics of the system. The vibrational ground state properties and specific vibrationally excited states are obtained from improved relaxation MCTDH calculations employing a large number of basis set functions, especially for the angular part, to achieve convergence. By analyzing the spatial density distributions of the vibrational states we are able to characterize the corresponding states to different isomers, such as tetrahedral, linear, bending type ones. The binding energy of each isomer is also computed, and they contribute to evaluate their relative stability, as well as the importance of the underlying multiple minima of the potential surface.

  15. Ars Fennica - isikliku ja poliitilise vahel / Janar Ala

    Index Scriptorium Estoniae

    Ala, Janar, 1979-

    2009-01-01

    2008. aasta Ars Fennica kunstiauhinna kandidaatide tööde näitus Kumu Kunstimuuseumis kuni 26. aprillini. Läti kunstniku Katrina Neiburga, soomlaste Seppo Renvalli, Maria Dunckeri ja Tea Mäkipää ning Mark Raidpere näitusel eksponeeritud töödest

  16. Immune epitope database analysis resource (IEDB-AR)

    DEFF Research Database (Denmark)

    Zhang, Qing; Wang, Peng; Kim, Yohan;

    2008-01-01

    We present a new release of the immune epitope database analysis resource (IEDB-AR, http://tools.immuneepitope.org), a repository of web-based tools for the prediction and analysis of immune epitopes. New functionalities have been added to most of the previously implemented tools, and a total of...

  17. Precision lifetime measurements of Ar II 4p doublet levels

    International Nuclear Information System (INIS)

    The lifetimes of the Ar II 4p doublet fine-structure levels 4p 2D05/2, 4p' 2F05/2 and 4p' 2F07/2 were measured by beam-dye laser spectroscopy. The experimental uncertainty was reduced to below 1%. (orig.)

  18. Global properties of the white dwarf pulsar AR Scorpii

    CERN Document Server

    Franzon, B

    2016-01-01

    In view of the new recent observation and measurement of the fast-rotating and highly-magnetized white dwarf AR Sco \\cite{Marsh:2016uhc}, we determine bounds for its radius, magnetic fields, moment of inertia and gravitational wave (GW) emission by using observations of the luminosity, as well the rotation frequency $\

  19. K-Ar geochronology of the southwestern Brooks Range, Alaska

    International Nuclear Information System (INIS)

    The southern Brooks Range schist belt is characterized by metasediments with subordinate metabasites and metafelsites. Blueschists occur within the schist belt from the Chandalar Quadrangle westward to the Baird Mountains Quadrangle. We report 76 new 40K-40Ar mineral ages from 47 metamorphic and igneous rocks in the southwestern Brooks Range. The pattern of radiometric ages provide evidence that the schist belt has, at least in part, undergone a Late Precambrian blueschist facies metamorphism. Silurian to Devonian carbonates and Middle Devonian felsic volcanics were later deposited on this Precambrian basement. Subsequent deformations produced the present pattern of isoclinal, recumbent folds, resulting in the interlayering of rocks of markedly different ages and lithologies. The entire schist terrane was metamorphosed to greenchist facies in Mesozoic time, probably as a result of Jurassic-Cretaceous northward overthrusting of oceanic crust and upper mantle, resulting in the resetting of most K-Ar mica ages to the mid-Cretaceous. A series of apparent 40K-40Ar ages intermediate between Late Precambrian and mid-Cretaceous are interpreted as indicating varying amounts of partial argon loss from older rocks during the Mesozoic metamorphism. Some glaucophanes contain excess radiogenic 40Ar. (auth)

  20. Nano-hardness estimation by means of Ar+ ion etching

    International Nuclear Information System (INIS)

    When the coatings are in nano-scale, the mechanical properties cannot be easily estimated by means of the conventional methods due to: tip shape, instrument resolution, roughness, and substrate effect. In this paper, we proposed a semi-empirical method to evaluate the mechanical properties of thin films based on the sputtering rate induced by bombardment of Ar+ ion. The Ar+ ion bombardment was induced by ion gun implemented in Auger electron spectroscopy (AES). This procedure has been applied on a series of coatings with different structure (carbon films) and a series of coating with a different density (ZnO thin films). The coatings were deposited on Silicon substrates by RF sputtering plasma. The results show that, as predicted by Insepov et al., there is a correlation between hardness and sputtering rate. Using reference materials and a simple power law equation the estimation of the nano-hardness using an Ar+ beam is possible. - Highlights: • ZnO film and Carbon films were grown on silicon using PVD. • The growth temperature was room temperature. • The hardness of the coatings was estimated by means of nanoindentation. • Evaluation of resistance of materials to the mechanical damage induced by an Ar+ ion gun (AES). • The hardness have been studied and a power law with the erosion rate has been found

  1. The ARS Culture Collection and Developments in Biotechnology

    Science.gov (United States)

    The ARS Culture Collection (NRRL) has played a prominent role in the development of biotechnology since its founding in 1940 when the Northern Regional Research Laboratory opened. Early discoveries included selection of production strains for penicillin, dextran blood extender, xanthan gum and the v...

  2. 75 FR 12163 - Class E Airspace; Mountain View, AR

    Science.gov (United States)

    2010-03-15

    ...; (2) is not a ``significant rule'' under DOT Regulatory Policies and Procedures (44 FR 11034; February...: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963 Comp., p. 389... Federal Aviation Administration 14 CFR Part 71 Class E Airspace; Mountain View, AR AGENCY:...

  3. Strong-field nonsequential double ionization of Ar and Ne

    International Nuclear Information System (INIS)

    We investigate the nonsequential double ionization (NSDI) of Ar and Ne based on quantitative rescattering theory (QRS). According to QRS theory, each elementary NSDI process can be calculated by multiplying the returning electron wave packet with appropriate differential electron-ion scattering cross sections. We include (e, 2e) and electron-impact excitation cross sections of Ar+ to obtain the correlated electron momentum spectra for the NSDI of Ar by few-cycle pulses to check the dependence of NSDI on the carrier-envelope phase. The results are compared to the ion momentum spectra from the recent experiment of Johnson et al. [Phys. Rev. A 83, 013412 (2011)]. Calculations have also been performed for Ar at another intensity to illustrate the intensity dependence of NSDI and to compare with the earlier data of Feuerstein et al. [Phys. Rev. Lett. 87, 043003 (2001)] and for Ne to illustrate the target dependence. We also address the presence of resonant capture processes in electron-ion collisions in the NSDI spectra.

  4. Near-contact Binaries IZ Monocerotis and AR Draconis

    Science.gov (United States)

    Yang, Yuan-Gui; Dai, Hai-Feng; Zhou, Zheng; Li, Qun

    2016-05-01

    We present multi-color photometric observations for two neglected near-contact binaries, IZ Mon (P=0\\_\\_AMP\\_\\_fd;77980) and AR Dra (P=0\\_\\_AMP\\_\\_fd;67584). By the aid of the updated W-D analysis code, the photometric solutions were deduced from the multi-color light curves (LCs). IZ Mon is a semi-detached binary with a mass ratio of q=0.388(+/- 0.002), while AR Dra is a detached star with a mass ratio of q=0.652(+/- 0.002). The asymmetric LCs of IZ Mon were modeled by a hot spot on the secondary’s surface, which may be attributed to mass transfer from the primary. Based on all collected eclipse times for two systems, we constructed their timing residual curves. The orbital period for IZ Mon may be continuously decreasing at a rate of {dP}/{dt}=-2.06(+/- 0.04) {days} {{yr}}-1, which may result from mass and angular momentum loss from the central system. For AR Dra, there exists a cyclic variation with a period of {P}3=104.9(+/- 2.9) {yr} due to light-time orbit effect via the presence of the third body, whose mass is more than 0.28(+/- 0.02) {M}⊙ . Finally, two near-contact binaries, IZ Mon and AR Dra, will evolve into contact binaries.

  5. Tirgošanās ar ietekmi

    OpenAIRE

    Skujiņa, Līva

    2016-01-01

    Bakalaura darba tēma ir „Tirgošanās ar ietekmi”. Par tirgošanos ar ietekmi Latvijā ir noteikta kriminālatbildība jau vairāk nekā desmit gadus, lai arī tiesu prakse attiecībā uz šo noziedzīgo nodarījumu nav izveidojusies. Bakalaura darba mērķis ir veikt Krimināllikuma 326.1 pantā ietvertā noziedzīgā nodarījuma sastāva teorētisko analīzi un izpētīt kvalifikācijas problēmjautājumus. Lai sasniegtu mērķi, autore aplūkoja tirgošanās ar ietekmi jēdzienu un tiesisko regulējumu Latvijas Republikā. Ti...

  6. He-, Ne-, and Ar-phosgene intermolecular potential energy surfaces

    DEFF Research Database (Denmark)

    Munteanu, Cristian R.; Henriksen, Christian; Felker, Peter M.; Fernández, Berta

    2013-01-01

    Using the CCSD(T) model, we evaluated the intermolecular potential energy surfaces of the He-, Ne-, and Ar-phosgene complexes. We considered a representative number of intermolecular geometries for which we calculated the corresponding interaction energies with the augmented (He complex) and doub...

  7. 75 FR 12162 - Class E Airspace; Manila, AR

    Science.gov (United States)

    2010-03-15

    ... Regulatory Policies and Procedures (44 FR 11034; February 26, 1979); and (3) does not warrant preparation of... read as follows: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959... Federal Aviation Administration 14 CFR Part 71 Class E Airspace; Manila, AR AGENCY: Federal...

  8. Big data computing: Building a vision for ARS information management

    Science.gov (United States)

    Improvements are needed within the ARS to increase scientific capacity and keep pace with new developments in computer technologies that support data acquisition and analysis. Enhancements in computing power and IT infrastructure are needed to provide scientists better access to high performance com...

  9. K-Ar ages of the Hattholmen anorthosite, northern Sweden

    International Nuclear Information System (INIS)

    Hornblendite together with anorthositic and pegmatitic dikes forms the bedrock of islet of Hattholmen (20 km south of the town of Umeaa, Sweden). These rocks have been analyses chemically. The K-Ar age of the anorthositic and pegmatite dikes is 1676 24 Ma and 1663 24Ma. (author)

  10. NanoSIMS50 analyses of Ar/18O2 plasma-treated Escherichia coli bacteria

    International Nuclear Information System (INIS)

    Reactive oxygen species (ROS) can be produced by electrical discharges and can be transported in uncharged regions by gas flows, in the so-called afterglows. These species are well known to have bactericidal effects but interaction mechanisms that occur with living micro-organisms remain misunderstood. In order to better understand these interactions, new analysis approaches are necessary. High-lateral-resolution secondary ion mass spectrometry (NanoSIMS) is one of the most promising ways of retrieving additional information on bacteria plasma inactivation mechanisms by combining isotopic imaging of plasma-treated bacteria and the use of 18O2 as process gas. Indeed, this technology combines a lateral resolution of a few tens of nanometres that is sufficient to image the interior of bacteria, and a high mass resolution allowing detection of isotopes present in low quantities (a few ppm or lower) within the bacteria. The present paper deals with Ar-18O2 (2%) plasma treatment, through low-pressure microwave late afterglows, of Escherichia coli bacteria and their elemental and isotopic imaging by NanoSIMS. E. coli bacteria have been exposed to this reactive medium for varying treatment duration while keeping all other parameters unchanged. Our main goal is to determine whether the quantity of 18O fixed in treated bacteria and the NanoSIMS50 lateral resolution are sufficient to give additional information on E. coli bacteria-plasma interaction. (paper)

  11. Near-IR Polarized Scattered Light Imagery of the DoAr 28 Transitional Disk

    CERN Document Server

    Rich, Evan A; Mayama, Satoshi; Brandt, Timothy D; Hashimoto, Jun; Kudo, Tomoyuki; Kusakabe, Nobuhiko; Espaillat, Catherine; Abe, Lyu; Akiyama, Eiji; Brandner, Wolfgang; Carson, Joseph C; Currie, Thayne; Egner, Sebastian; Feldt, Markus; Follette, Kate; Goto, Miwa; Grady, Carol A; Guyon, Olivier; Hayano, Yutaka; Hayashi, Masahiko; Hayashi, Saeko S; Henning, Thomas; Hodapp, Klaus W; Ishii, Miki; Iye, Masanori; Janson, Markus; Kandori, Ryo; Knapp, Gillian R; Kuzuhara, Masayuki; Kwon, Jungmi; Matsuo, Taro; McElwain, Michael W; Miyama, Shoken; Morino, Jun-Ichi; Moro-Martin, Amaya; Nishimura, Tetsuo; Pyo, Tae-Soo; Qi, Chunhua; Serabyn, Eugene; Suenaga, Takuya; Suto, Hiroshi; Suzuki, Ryuji; Takahashi, Yasuhiro H; Takami, Michihiro; Takato, Naruhisa; Terada, Hiroshi; Thalmann, Christian; Tomono, Daigo; Turner, Edwin L; Watanabe, Makoto; Yamada, Toru; Takami, Hideki; Usuda, Tomonori; Tamura, Motohide

    2015-01-01

    We present the first spatially resolved polarized scattered light H-band detection of the DoAr 28 transitional disk. Our two epochs of imagery detect the scattered light disk from our effective inner working angle of 0.10" (13 AU) out to 0.50" (65 AU). This inner working angle is interior to the location of the system's gap inferred by previous studies using SED modeling (15 AU). We detected a candidate point source companion 1.08" northwest of the system; however, our second epoch of imagery strongly suggests that this object is a background star. We constructed a grid of Monte Carlo Radiative Transfer models of the system, and our best fit models utilize a modestly inclined (50 deg), 0.01 Msun disk that has a partially depleted inner gap from the dust sublimation radius out to ~8 AU. Subtracting this best fit, axi-symmetric model from our polarized intensity data reveals evidence for two small asymmetries in the disk, which could be attributable to variety of mechanisms.

  12. Behaviour of AR glass fibre for building structural applications

    Directory of Open Access Journals (Sweden)

    Miravete, A.

    2005-12-01

    Full Text Available The AR glass reinforcement fibres were designed to resist the alkalis from the concrete. This is the main reason for its utilisation as a short-fibre-reinforcement of mortar and concrete for the last decades. Originally, the AR glass fibre sizing was not compatible with synthetic resins, so that this type of reinforcement was applied exclusively to mortar and concrete matrices. Recently, due to the developments of sizing, which are compatible with synthetic resins, the AR- glass fibres may be used as reinforcement of organic matrix composite materials, broadening the range of structural applications. The mechanical properties of AR glass fibre and organic matrix composite materials will be studied in this paper. First, the behaviour of this material under stress corrosion will be analysed. Their mass loss will be compared to E, C, and boron free glass fibres. Second, an experimental study dealing with 3P test bending and short beam ofAR glass fibre/polyester will de described with the goal of obtaining their Young modulus and tensile and interlaminar shear strengths. Finally, these experimental results will be compared to E glass fibre/polyester and several conclusions about their structural applications will be drawn.

    El vidrio AR y su presentación en forma de fibras de refuerzo, fue diseñado para ser inerte a los álcalis de los cementos. Por este motivo se viene utilizando desde hace varias décadas como refuerzo de morteros y hormigones en forma de fibra corta. El ensimaje que estas fibras de vidrio de refuerzo A R presentaba en su origen no era compatible con resinas de tipo sintéticas, por lo que el refuerzo era exclusivo para cementos y hormigones fuera cual fuera la aplicación, formato o proceso productivo. Recientemente, gracias al desarrollo específico de ensimajes especiales acordes a las fibras de vidrio AR ha aparecido la misma tipología de vidrio AR como refuerzo en forma de fibra continua compatible con resinas sint

  13. 40Ar/39Ar dating of Quaternary volcanic ashes by multi-collection noble gas mass spectrometry: protocols, precision and intercalibration

    DEFF Research Database (Denmark)

    Storey, Michael; Rivera, Tiffany; Flude, Stephanie;

    where potassium-bearing phenocrysts may contain relatively small amounts of radiogenic 40Ar. In 2005, the Quaternary Dating Laboratory, Roskilde University, installed a Nu-Instruments multi-collector Noblesse noble gas mass spectrometer, which is configured with a Faraday detector and three ion......The recent availability of commercial high-resolution, multi-collector, noble gas mass spectrometers equipped with ion-counting electron multipliers provides new opportunities for improved precision in 40Ar/39Ar dating. This is particularly true for single crystal dating of Quaternary aged samples...... for single crystal 40Ar/39Ar dating of Quaternary samples because of: (i) improved source sensitivity; (ii) ion-counting electron multipliers, which have low signal to noise ratios enabling precise measurement of very small 36Ar signals - resulting in accurate correction for atmospheric-derived 40Ar; (iii...

  14. Atmosphere-interior exchange on hot rocky exoplanets

    CERN Document Server

    Kite, Edwin S; Schaefer, Laura; Gaidos, Eric

    2016-01-01

    We provide estimates of atmospheric pressure and surface composition on short-period rocky exoplanets with dayside magma pools and silicate vapor atmospheres. Atmospheric pressure tends toward vapor-pressure equilibrium with surface magma, and magma-surface composition is set by the competing effects of fractional vaporization and surface-interior exchange. We use basic models to show how surface-interior exchange is controlled by the planet's temperature, mass, and initial composition. We assume that mantle rock undergoes bulk melting to form the magma pool, and that winds flow radially away from the substellar point. With these assumptions, we find that: (1) atmosphere-interior exchange is fast when the planet's bulk-silicate FeO concentration is low, and slow when FeO concentration is high; (2) magma pools are compositionally well-mixed for substellar temperatures $\\lesssim$ 2400 K, but compositionally variegated and rapidly variable for substellar temperatures $\\gtrsim$ 2400 K; (3) currents within the mag...

  15. Precision angle-resolved autoionization resonances in Ar and Ne

    Energy Technology Data Exchange (ETDEWEB)

    Berrah, N.; Langer, B.; Gorczyca, T.W. [Western Michigan Univ., Kalamazoo, MI (United States)] [and others

    1997-04-01

    Theoretical work has shown that the electron angular distribution and the shape of the autoionization resonances are crucial to the understanding of certain types of electron-electron correlation. Autoionization resonances in Ne (Ar) result from the decay of the excited discrete state Ne{sup *} 2s2p{sup 6} np (Ar{sup *} 3s3p{sup 6} np) into the continuum state Ne{sup +} 2s{sup 2}2p{sup 5} + e{sup {minus}} (ks,kd) (Ar{sup +} 3s{sup 2}3p{sup 5} + e{sup {minus}} (ks,kd)). Since the continuum can also be reached by direct photoionization, both paths add coherently, giving rise to interferences that produce the characteristic Beutler-Fano line shape. In this work, the authors report on quantitative angle-resolved electron spectrometry studies of (a) the Ne 2s{sup 2}2p{sup 6} {r_arrow} 2s2p{sup 6} np (n=3-5) autoionizing resonances and the 2s{sup 2}2p{sup 6} {r_arrow} 2p{sup 4}3s3p doubly excited resonance, (b) the Ar 3s{sup 2}3p{sup 6} {r_arrow} 3s3p{sup 6} np (n=4-9) autoionization resonances and extended R-matrix calculations of the angular-distribution parameters for both Ne and Ar measurements. Their results are compared with previous theoretical work by Taylor.

  16. A feature refinement approach for statistical interior CT reconstruction.

    Science.gov (United States)

    Hu, Zhanli; Zhang, Yunwan; Liu, Jianbo; Ma, Jianhua; Zheng, Hairong; Liang, Dong

    2016-07-21

    Interior tomography is clinically desired to reduce the radiation dose rendered to patients. In this work, a new statistical interior tomography approach for computed tomography is proposed. The developed design focuses on taking into account the statistical nature of local projection data and recovering fine structures which are lost in the conventional total-variation (TV)-minimization reconstruction. The proposed method falls within the compressed sensing framework of TV minimization, which only assumes that the interior ROI is piecewise constant or polynomial and does not need any additional prior knowledge. To integrate the statistical distribution property of projection data, the objective function is built under the criteria of penalized weighed least-square (PWLS-TV). In the implementation of the proposed method, the interior projection extrapolation based FBP reconstruction is first used as the initial guess to mitigate truncation artifacts and also provide an extended field-of-view. Moreover, an interior feature refinement step, as an important processing operation is performed after each iteration of PWLS-TV to recover the desired structure information which is lost during the TV minimization. Here, a feature descriptor is specifically designed and employed to distinguish structure from noise and noise-like artifacts. A modified steepest descent algorithm is adopted to minimize the associated objective function. The proposed method is applied to both digital phantom and in vivo Micro-CT datasets, and compared to FBP, ART-TV and PWLS-TV. The reconstruction results demonstrate that the proposed method performs better than other conventional methods in suppressing noise, reducing truncated and streak artifacts, and preserving features. The proposed approach demonstrates its potential usefulness for feature preservation of interior tomography under truncated projection measurements. PMID:27362527

  17. A feature refinement approach for statistical interior CT reconstruction

    Science.gov (United States)

    Hu, Zhanli; Zhang, Yunwan; Liu, Jianbo; Ma, Jianhua; Zheng, Hairong; Liang, Dong

    2016-07-01

    Interior tomography is clinically desired to reduce the radiation dose rendered to patients. In this work, a new statistical interior tomography approach for computed tomography is proposed. The developed design focuses on taking into account the statistical nature of local projection data and recovering fine structures which are lost in the conventional total-variation (TV)—minimization reconstruction. The proposed method falls within the compressed sensing framework of TV minimization, which only assumes that the interior ROI is piecewise constant or polynomial and does not need any additional prior knowledge. To integrate the statistical distribution property of projection data, the objective function is built under the criteria of penalized weighed least-square (PWLS-TV). In the implementation of the proposed method, the interior projection extrapolation based FBP reconstruction is first used as the initial guess to mitigate truncation artifacts and also provide an extended field-of-view. Moreover, an interior feature refinement step, as an important processing operation is performed after each iteration of PWLS-TV to recover the desired structure information which is lost during the TV minimization. Here, a feature descriptor is specifically designed and employed to distinguish structure from noise and noise-like artifacts. A modified steepest descent algorithm is adopted to minimize the associated objective function. The proposed method is applied to both digital phantom and in vivo Micro-CT datasets, and compared to FBP, ART-TV and PWLS-TV. The reconstruction results demonstrate that the proposed method performs better than other conventional methods in suppressing noise, reducing truncated and streak artifacts, and preserving features. The proposed approach demonstrates its potential usefulness for feature preservation of interior tomography under truncated projection measurements.

  18. Conference on Boundary and Interior Layers : Computational and Asymptotic Methods

    CERN Document Server

    2015-01-01

    This volume offers contributions reflecting a selection of the lectures presented at the international conference BAIL 2014, which was held from 15th to 19th September 2014 at the Charles University in Prague, Czech Republic. These are devoted to the theoretical and/or numerical analysis of problems involving boundary and interior layers and methods for solving these problems numerically. The authors are both mathematicians (pure and applied) and engineers, and bring together a large number of interesting ideas. The wide variety of topics treated in the contributions provides an excellent overview of current research into the theory and numerical solution of problems involving boundary and interior layers.  .

  19. The effect of interior aircraft noise on pilot performance.

    Science.gov (United States)

    Lindvall, Johan; Västfjall, Daniel

    2013-04-01

    This study examined the effect of the interior sounds of an aircraft cockpit on ratings of affect and expected performance decrement. While exposed to 12 interior aircraft sounds, of which half were modified to correspond to what is experienced with an active noise reduction (ANR) headset, 23 participants rated their affective reactions and how they believed their performance on various tasks would be affected. The results suggest that implementation of ANR-technique has a positive effect on ratings of expected performance. In addition, affective reactions to the noise are related to ratings of expected performance. The implications of these findings for both research and pilot performance are discussed. PMID:24032324

  20. PhD Thesis: Functional Textiles in Hospital Interiors

    DEFF Research Database (Denmark)

    Mogensen, Jeppe Emil

    The PhD thesis explores the possibilities and design qualities of using functional textiles in the interior of hospital environments, and is the result of a three-year collaboration between Aalborg University, Department of Civil Engineering, and VIA University College, VIA Design. The thesis...... main design qualities that may improve the patients’ experience of the hospital interior, and in the experimental studies these aesthetic quali- ties are contextualised in empirical studies conducted at two Danish hospitals. Through these different studies, the PhD thesis addresses the technical and...

  1. Seismic Study of Magnetic Field in the Solar Interior

    Indian Academy of Sciences (India)

    H. M. Antia

    2008-03-01

    Magnetic field in the solar interior contributes to the even order splitting coefficients, but it is not possible to separate the effect of magnetic field from those due to other deviations from spherical symmetry. Results obtained using GONG and MDI data are discussed. Limits on possible magnetic field in the solar core and in the tachocline region are obtained. There is some signal from possible magnetic field in the convection zone, but evidence of possible temporal variation in the solar interior is only marginal.

  2. Evaluation of physical protection elements for interior applications

    International Nuclear Information System (INIS)

    Considerable emphasis has been given in recent years to the threat of sabotage or theft by an insider at nuclear facilities, a threat inherently different from that by outsiders. Special safeguards compatible with facility operations, safety, and maintenance programs are needed to counter the insider's unique knowledge and access to vital material and equipment. To help identify elements that meet these needs, field evaluations were performed on an interior access control system, piping sensors, interior video motion detectors, and valve monitoring devices. Both technical and operational evaluation data were obtained from tests in a realistic operating environment. Safeguards elements and operational test results and evaluations are described

  3. Diffeomorphisms having rotation sets with non-empty interior

    International Nuclear Information System (INIS)

    In 1991 Llibre and MacKay proved that if f is a 2-torus homeomorphism isotopic to identity and the rotation set of f has a non-empty interior then f has positive topological entropy. Here, we give a partial converse theorem. We show that the interior of the rotation set of a 2-torus C1+α diffeomorphism isotopic to identity of positive topological entropy is not empty, under the additional hypothesis that f has a suitable finite covering that is topologically transitive. We also give examples that show that these hypotheses are necessary

  4. Distributed Interior-point Method for Loosely Coupled Problems

    DEFF Research Database (Denmark)

    Pakazad, Sina Khoshfetrat; Hansson, Anders; Andersen, Martin Skovgaard

    require many iterations to converge. In order to alleviate this issue, we propose algorithms that combine the Newton and interior-point methods with proximal splitting methods for solving such problems. Particularly, the algorithm for solving unconstrained loosely coupled problems, is based on Newton......’s method and utilizes proximal splitting to distribute the computations for calculating the Newton step at each iteration. A combination of this algorithm and the interior-point method is then used to introduce a distributed algorithm for solving constrained loosely coupled problems. We also provide...

  5. Qualidade da cama e do ar em diferentes condições de alojamento de frangos de corte

    Directory of Open Access Journals (Sweden)

    Thayla Morandi Ridolfi de Carvalho

    2011-04-01

    Full Text Available O objetivo deste trabalho foi avaliar as condições iniciais de alojamento de aves, de um dia de idade, em termos da qualidade da cama de frango reutilizada e do ar, em aviários comerciais de produção com diferentes sistemas de ventilação mínima e tipologia, por meio de análise geoestatística. O experimento foi realizado em quatro aviários: Blue House I (T1 e Blue House II (T2, Dark House (T3 e Convencional (T4. As variáveis analisadas foram: pH, umidade, temperatura superficial e concentração de amônia, tendo-se coletado as amostras na altura dos frangos, em 80 pontos equidistantes no interior do pinteiro. A análise geoestatística auxiliou a identificação de pontos críticos no controle dos ambientes estudados. O manejo da ventilação mínima não é suficiente para garantir a qualidade do ar nos pinteiros. A cama reutilizada de casca de café e arroz (T1 e T2 apresenta melhor qualidade do que a cama reutilizada de maravalha fina (T3 e T4. O sistema de ventilação mínima, em T2 e T4, é o mais eficiente quanto à renovação do ar nos pinteiros.

  6. Combined oxygen, hydrogen, /sup 40/Ar//sup 39/Ar isotopic evaluation of molybdenite mineralization, east Pioneer Mountains, Montana

    Energy Technology Data Exchange (ETDEWEB)

    Chesley, J.T.; Snee, L.W.; O' Neil, J.R.

    1985-01-01

    The Pear Lake molybdenite (moly) prospect is in the Eastern Pioneer Wilderness Area, 30 km south of the Cannivan Gulch moly deposit. It lies on a NW-SE trend with other prospects that are contemporaneous. Mineralized veins outcrop sporadically over a 4 square mile area, with a major concentration in the center of the study area. Previous studies have suggested potential moly-mineralization at depth. /sup 40/Ar//sup 39/Ar age-spectra on hornblend (hb) from the granodiorite host rock indicate emplacement at 75.0 +/- 1 Ma, with biotite closure at 69.0 +/- .3 Ma, in the vicinity of Pear Lake. Hydrothermal muscovites from the moly-bearing veins have ages of 68.0 +/- .5 Ma. partial resetting of biotite cooling dates in the vicinity of mineralization are observed, but biotites on the outer portion of the mineralizing system are undisturbed. These relations suggest that mineralization occurred after the host pluton had cooled to below 280/sup 0/C. Quartz-magnetite isotopic temperatures are 380 to 420/sup 0/C for moly-veins. These data suggest that magmatic hydrothermal fluids operated in the upper portion of this molysystem. These isotopic data, combined with geologic mapping, suggest that the Pear Lake moly prospect resulted from a weak, short-lived magmatic hydrothermal event at depth, and is unlikely to contain economic levels of molybdenum. The combined /sup 40/Ar//sup 39/Ar-stable isotope approach should prove useful in evaluating other hydrothermal systems.

  7. ISEA reversed event in the Cretaceous Normal Superchron (CNS):40Ar/39Ar dating and paleomagnetic results

    Institute of Scientific and Technical Information of China (English)

    SHI Ruiping; HE Huaiyu; ZHU Rixiang; PAN Yongxin

    2004-01-01

    In order to provide the age for the ISEA (one reversed event in the CNS) a combined rock magnetic, paleomagnetic and geochronologic study has been conducted on two Cretaceous andesitic basalt lava flows from Sanbaoying, Liaoning Province of northeastern China. Rock magnetic investigations show that pseudo-single domain (PSD) titanomagnetite with poor-Ti content is the dominant magnetic mineral in Sanbaoying lava flows. Detailed systematic thermal demagnetization allowed us to isolate two remanence components after removing a low temperature component at 100℃/150℃; an intermediate temperature component with normal polarity at 150℃/200℃-380℃/400℃ and the characteristic remanence component (ChRM) with reversed polarity above 400℃/450℃. 40Ar/39Ar dating results show that Sanbaoying rocks were erupted at 116.0±0.3 Ma. Combination of paleomagnetic results and 40Ar/39Ar dating indicates that the reversed event recorded in Sanbaoying lavas corresponds to the ISEA event in the CNS. Our age determination for ISEA reversed event provides chronological evidence to study the relevance between global geological events that occurred in the CNS and geodynamo processes.

  8. 40Ar/39Ar ages and tectonic setting of ophiolite from the Neyriz area, southeast Zagros range, Iran

    International Nuclear Information System (INIS)

    An ophiolite, considered to be an allochthonous fragment of Tethyan oceanic crust and mantle, crops out near Neyriz in the Zagros Range, Iran. 40Ar/39Ar ages ranging from 76.8+-23.8 Ma to 105+-23.3 Ma were measured on hornblende from five samples of plagiogranite and diabase from the ophiolite. The most precise ages are 85.9+-3.8 Ma for a diabase and 83.6+-8.4 Ma for a plagiogranite. The weighted mean age of hornblende from the five samples is 87.5+-7.2 Ma which indicates that the igneous part of the Neyriz ophiolite formed during the early part of the Late Cretaceous. Pargasite from amphibolite below peridotite of the Neyriz ophiolite has a 40Ar/39Ar age of 94.9+-7.6 Ma. The pargasite age agrees within analytical uncertainty with the ages measured on diabase and plagiogranite. Comparable ages have been measured on igneous rocks from the Samail ophiolite of Oman and on amphibolite below peridotite of the Samail ophiolite. (orig.)

  9. Infrared spectroscopy of ArOH: A direct probe of the Ar+OH X2Π potential energy surface

    International Nuclear Information System (INIS)

    An infrared-ultraviolet (IR-UV) double-resonance technique has been implemented to obtain the infrared spectrum of ArOH in the vicinity of the fundamental OH stretch at 2.8 μm. A rotationally resolved spectrum of the fundamental OH stretching band of ArOH is observed at 3567.85(1) cm-1 (origin). A combination band, involving both OH stretch and intermolecular bending excitation, is identified at 3577.00(1) cm-1 (origin). The intermolecular energy of the excited bending state provides a direct measure of the anisotropy of the Ar+OH X2Π interaction potential. The rotational structure of the combination band reveals a large splitting between parity components with the same total angular momentum in the excited bending state [0.69(1) cm-1 for J=(3/2)]. The experimentally derived parity splitting is compared with previous experimental and theoretical determinations of this parameter. The parity splitting associated with the excited bending state reflects the change in the intermolecular potential when the pπ orbital containing the unpaired electron of OH lies in or out of the ArOH plane. (c) 2000 American Institute of Physics

  10. Classification of the Apollo-11 mare basalts according to /Ar-39/-/Ar-40/ ages and petrological properties

    International Nuclear Information System (INIS)

    Previously unpublished (Ar-39)-(Ar-40) ages and exposure ages are presented for Apollo 11 whole rocks and mineral separates. The age data for the Apollo 11 mare basalts in general are discussed in relation to their textural and petrological properties. The oldest rocks (10003, 10029) belong to the low-K group and crystallized at 3.90 + or - 0.03 AE. Three other low-K groups are defined in relation to the petrological classification of Beaty and Albee (1978) and to information on the rock crystallization ages, exposure ages and normative quartz contents. These groups have ages of 3.84 + or - 0.04 AE (10062), 3.75 + or - 0.03 AE (10050) and 3.72 + or - 0.04 AE (10044, 10047, 10058). The best defined (Ar-39)-(Ar-40) age for the high-K basalts is 3.62 + or - 0.05 AE (for mineral separates from 10072). At least four distinct, fairly thin flows of low-K basalt are believed to have been erupted over a 200-my period, followed by either one or several, as yet indistinguishable, very thin flows of high-K basalt. It is not possible to decide whether the earliest dated of the mare basalt eruptions at Mare Tranquillitatis pre-dated, post-dated, or were contemporary with the Imbrian impact event

  11. 40Ar/39Ar dated climatic and hydrological variability between MIS20 and MIS18 at Sulmona Basin (central Italy)

    Science.gov (United States)

    Zanchetta, Giovanni; Giaccio, Biagio; Eleonora, Reagattieri; Nomade, Sebastien; Renne, Paul R.; Sprain, Courtney J.; Drysdale, Russell N.; Tzedakis, Polychronis C.; Messina, Paolo; Scardia, Giancarlo; Sposato, Andrea

    2015-04-01

    Understanding spatial-temporal variability, magnitude and different expressions of Quaternary millennial-scale palaeoclimatic changes is one of the frontier challenges of modern palaeoclimatology. Addressing this issue requires the acquisition of regionally representative, and ideally independently-dated, records of climatic variability. Multiproxy record (stable isotopes, XRF, MS, %CaCO3) from lacustrine succession of Sulmona basin (central Italy), highlights climatic and hydrological variability at orbital to millennial scales between MIS20 and MIS18. The record highlights the presence of interesting millennial scale variability within MIS19, considered to be the best orbital analogue of the current interglacial. The presence of several tephra layers precisely dated by 40Ar/39Ar technique, allow placement of the record within a robust time frame. Assembling a high-resolution paleoclimatic record for MIS19 anchored to a high-precision 40Ar/39Ar chronology, it is possible to show that the MIS 19c interglacial started shortly before the boreal summer insolation and obliquity maximum/precession minimum at 790-788 ka, and ended 11.6 ± 2.3 kyr later, when orbital parameters assumed a configuration similar to the present one.

  12. Geochemistry and 40Ar/39Ar age of Early Carboniferous dolerite sills in the southern Baltic Sea

    Directory of Open Access Journals (Sweden)

    Gediminas Motuza

    2015-08-01

    Full Text Available The Early Carboniferous magmatic event in the southern Baltic Sea is manifested by dolerite intrusions. The presumable area in which the dolerite intrusions occur ranges from 30 to 60 km in east–west direction, and is about 100 km in north–south direction. The dolerites were sampled in well D1-1 and investigated by applying chemical analysis and 40Ar/39Ar step-heating dating. Dolerites are classified as alkali and sodic, characterized by high TiO2 (3.92, 3.99 wt% and P2O5 (1.67, 1.77 wt% and low MgO (4.89, 4.91 wt% concentrations, enriched in light rare earth elements, originated from an enriched mantle magma source and emplaced in a continental rift tectonic setting. The 351 ± 11 Ma 40Ar/39Ar plateau age for groundmass plagioclase indicates a considerable age gap with the 310–250 Ma magmatism in southern Scandinavia and northern Germany. The magmatic rocks in the Baltic Sedimentary Basin are coeval with alkaline intrusions of NE Poland. Both magmatic provinces lie in the northwestward prolongation of the Pripyat–Dnieper–Donetsk Rift (370–359 Ma and may constitute a later phase of magmatic activity of this propagating rift system.

  13. Origin of the Mile Tilek Tuff, South Andaman: evidence from 40Ar-39Ar chronology and geochemistry

    International Nuclear Information System (INIS)

    The Mile Tilek Tuff is one of several consolidated volcanic ash deposits in the Andaman and Nicobar Islands that has preserved evidence of a large-scale volcanic eruption in Southeast Asia. Assumed to be of Mio-Pliocene age (∼ 25-2 Ma), the tuff was thought to have been generated by the Andaman-Indonesia volcanic arc. Little was known about its source volcano because of absence of critical isotope data. To provide accurate age information and determine its source, we dated the tuff by 40Ar-39Ar method and measured its trace element contents and Sr-Nd isotopic ratios. The 40Ar-39Ar plateau age for the whole rock is 0.73 ± 0.16 (2σ) Ma, which suggests that the tuff got deposited much later than previously believed. Chemically, the tuff possesses typical characteristics of subduction zone magmatism. Its Sr-Nd isotopic compositions (87Sr/86Sr = 0.7073 and εNd ≤ 0.9) suggest substantial continental crustal contamination of its source magma, which points to a source volcano in Sumatra. Based on available age information on large-scale volcanic eruptions in Indonesia, we speculate that the Ranau volcano in south Sumatra could have been the source of the Mile Tilek Tuff. (author)

  14. 40Ar/39Ar impact ages and time-temperature argon diffusion history of the Bunburra Rockhole anomalous basaltic achondrite

    Science.gov (United States)

    Jourdan, Fred; Benedix, Gretchen; Eroglu, Ela.; Bland, Phil. A.; Bouvier, Audrey.

    2014-09-01

    The Bunburra Rockhole meteorite is a brecciated anomalous basaltic achondrite containing coarse-, medium- and fine-grained lithologies. Petrographic observations constrain the limited shock pressure to between ca. 10 GPa and 20 GPa. In this study, we carried out nine 40Ar/39Ar step-heating experiments on distinct single-grain fragments extracted from the coarse and fine lithologies. We obtained six plateau ages and three mini-plateau ages. These ages fall into two internally concordant populations with mean ages of 3640 ± 21 Ma (n = 7; P = 0.53) and 3544 ± 26 Ma (n = 2; P = 0.54), respectively. Based on these results, additional 40Ar/39Ar data of fusion crust fragments, argon diffusion modelling, and petrographic observations, we conclude that the principal components of the Bunburra Rockhole basaltic achondrite are from a melt rock formed at ∼3.64 Ga by a medium to large impact event. The data imply that this impact generated high enough energy to completely melt the basaltic target rock and reset the Ar systematics, but only partially reset the Pb-Pb age. We also conclude that a complete 40Ar∗ resetting of pyroxene and plagioclase at this time could not have been achieved at solid-state conditions. Comparison with a terrestrial analog (Lonar crater) shows that the time-temperature conditions required to melt basaltic target rocks upon impact are relatively easy to achieve. Ar data also suggest that a second medium-size impact event occurred on a neighbouring part of the same target rock at ∼3.54 Ga. Concordant low-temperature step ages of the nine aliquots suggest that, at ∼3.42 Ga, a third smaller impact excavated parts of the ∼3.64 Ga and ∼3.54 Ga melt rocks and brought the fragments together. The lack of significant impact activity after 3.5 Ga, as recorded by the Bunburra Rockhole suggests that (1) either the meteorite was ejected in a small secondary parent body where it resided untouched by large impacts, or (2) it was covered by a porous heat

  15. Mineralogy and Ar-39 - Ar-40 of an old pristine basalt: Thermal history of the HED parent body

    Science.gov (United States)

    Takeda, Hiroshi; Mori, Hiroshi; Bogard, Donald D.

    1994-01-01

    Previous investigations of mineral chemistry and Rb-Sr and Sm-Nd ages indicated that clast,84 from eucrite Yamato 75011 had preserved the pristine nature of its initial crystallization during an early stage of the HED parent body. Microscale mineralogy and Ar-39-Ar-40 ages of this clast, however, revealed local disturbance of microtextures and partially reset ages. This evidence suggests that, in addition to initial crystallization and rapid cooling, the Y75011,84 clast experienced shock deformation, reheating of short duration at higher temperature, and brecciation. These characteristics suggest two or more impact events. Fe-rich olivine filling fractures in pyroxene may have been introduced during the accompanying shock fracturing. The inferred Ar-39-Ar-40 degassing ages for Y75011 matrix and clast, 84 are 3.94 +/- 0.04 Ga and 3.98 +/- 0.03 Ga, respectively. The suggested degassing age for a clast from Y790020, believed to be paired with Y75011, is approximately 4.03 Ga, but could be younger. We consider it likely that all three samples experienced a common degassing event 3.95 +/- 0.05 Ga ago, but we cannot rule out two or more events spaced over a approximately 0.1 Ga interval. Higher temperature extractions of the two clast samples show significantly older apparent ages up to approximately 4.5 Ga and suggest that the time/temperature regime of this event was not sufficient to degas Ar totally. Most likely, the K-Ar ages were reset by thermal metamorphism associated with one or more impact events associated with shock fracturing, formation of Fe-rich olivine veins, and/or meteorite brecciation. The pyroxene annealing that commonly occurs in many eucrites is likely to be a much earlier process than the impact-produced textural changes and reset K-Ar ages observed in these meteorites. The existence of mineralogical and chronological evidence for metamorphism in an otherwise pristine eucrite suggests that the HED parent body experienced an extensive degree of

  16. I-Xe and 40Ar-39Ar dating of silicate from Weekeroo Station and Netschaevo IIE iron meteorites

    International Nuclear Information System (INIS)

    Silicate inclusions from two IIE iron meteorites were dated by the I-Xe and 40Ar-39Ar techniques. Weekeroo Station, a 'normal' IIE iron, shows no loss of radiogenic 40Ar at low temperature, and the well defined 40Ar-39Ar plateau yields an age of 4.54 +- 0.03 Byr. The xenon data define a good I-Xe correlation with an age of + 10.9 +- 0.5 Myr relative to Bjurbole. Despite its relatively young age, Weekeroo Station's (129Xe/132Xe)sub(trapped) ratio (= 0.84 +- 0.05) lies significantly below the solar value. Netschaevo silicate has a chondritic composition, unlike 'normal' IIE silicate which is more differentiated. Nevertheless Netschaevo gives a 40Ar-39Ar plateau-age of only 3.79 +- 0.03 Byr, with the xenon data failing to define an I-Xe isochron. Only irons from the IAB and IIE groups contain silicate inclusions, but these two groups differ in many other respects, mostly suggesting that IAB meteorites are more primitive. The I-Xe chronology supports this suggestion inasmuch as Weekeroo Station formed well after IAB silicates. The four silicate-bearing IIE irons which have now been dated can be subdivided into distinct pairs: Weekeroo Station and Colomera formed near the beginning of the solar system, while Netschaevo and Kodaikanal both formed only 3.8 Byr ago. A review of other properties of these meteorites generally supports this subdivision. This work underscores the complexity of the history of IIE meteorites; in particular, an adequate model must account for the formation of two IIE irons at 3.8 Byr without disturbing rare gases in Weekeroo Station. All formation models are quite speculative, but the one which seems best to fit the available evidence postulates two parent bodies: the 3.8 Byr old silicate formed on one parent body, all other IIE material resided in a separate body, and subsequent collision(s) mixed the young silicate with IIE metal. (author)

  17. 40Ar/39Ar geochronology, paleomagnetism, and evolution of the Boring volcanic field, Oregon and Washington, USA

    Science.gov (United States)

    Fleck, Robert J.; Hagstrum, Jonathan T.; Calvert, Andrew T.; Evarts, Russell C.; Conrey, Richard M.

    2014-01-01

    The 40Ar/39Ar investigations of a large suite of fine-grained basaltic rocks of the Boring volcanic field (BVF), Oregon and Washington (USA), yielded two primary results. (1) Using age control from paleomagnetic polarity, stratigraphy, and available plateau ages, 40Ar/39Ar recoil model ages are defined that provide reliable age results in the absence of an age plateau, even in cases of significant Ar redistribution. (2) Grouping of eruptive ages either by period of activity or by composition defines a broadly northward progression of BVF volcanism during latest Pliocene and Pleistocene time that reflects rates consistent with regional plate movements. Based on the frequency distribution of measured ages, periods of greatest volcanic activity within the BVF occurred 2.7–2.2 Ma, 1.7–0.5 Ma, and 350–50 ka. Grouped by eruptive episode, geographic distributions of samples define a series of northeast-southwest–trending strips whose centers migrate from south-southeast to north-northwest at an average rate of 9.3 ± 1.6 mm/yr. Volcanic activity in the western part of the BVF migrated more rapidly than that to the east, causing trends of eruptive episodes to progress in an irregular, clockwise sense. The K2O and CaO values of dated samples exhibit well-defined temporal trends, decreasing and increasing, respectively, with age of eruption. Divided into two groups by K2O, the centers of these two distributions define a northward migration rate similar to that determined from eruptive age groups. This age and compositional migration rate of Boring volcanism is similar to the clockwise rotation rate of the Oregon Coast Range with respect to North America, and might reflect localized extension on the trailing edge of that rotating crustal block.

  18. AR-39Ar-40 dating of basalts and rock breccias from Apollo 17 and the malvern achondrite

    Science.gov (United States)

    Kirsten, T.; Horn, P.

    1977-01-01

    The principles and the potential of the Ar-39/Ar-40 dating technique are illustrated by means of results obtained for 12 Apollo 17 rocks. Emphasis is given to methodical problems and the geological interpretation of lunar rock ages. Often it is ambigious to associate a given lunar breccia with a certain formation, or a formation with a basin. In addition, large-scale events on the Moon have not necessarily reset radiometric clocks completely. One rock fragment has a well-defined plateau age of 4.28 b.y., but the ages of two Apollo 17 breccias define an upper limit for the formation age of the Serenitatis basin at 4.05 b.y. Ages derived from five mare basalts indicate cessation of mare volcanism at Taurus-Littrow approximately 3.78 b.y. ago. Ca/Ar-37 exposure ages show that Camelot Crater was formed by an impact approximately 95 m.y. ago. After a short summary of the lunar timetable as it stands at the end of the Apollo program, we report about Ar-39/Ar-40 and rare gas studies on the Malvern meteorite. This achondrite resembles lunar highland breccias in texture as well as in rare-gas patterns. It was strongly annealed at some time between 3.4 and 3.8 b.y. ago. The results indicate that very similar processes have occurred on the Moon and on achondritic parent bodies at comparable times, leading to impact breccias with strikingly similar features, including the retention of rare-gas isotopes from various sources.

  19. The role of N-acetyl-cysteine in the lung remote injury after hepatic ischemia and reperfusion in rabbits O papel da N-acetil-cisteína nas lesões pulmonares provocadas à distância pela isquemia e reperfusão hepática em coelhos

    Directory of Open Access Journals (Sweden)

    Angela Potter de Castro

    2012-01-01

    Full Text Available PURPOSE: To study the lesions in the lung of rabbits caused by ischemia/reperfusion hepatic (I/R after the use of N-acetyl-cysteine (NAC. METHODS: Twenty-four rabbits distributed in two groups: control group GI (n = 12 5% glucose solution and experiment group GII (n = 12 NAC. The animals were pre-anesthetized with 1% acepromazine maleate and anesthetized with ketamine 10% and 2% xylazine intramuscularly. The GI and GII were given glucose solution intravenously or NAC 15min before occlusion of the hepatic pedicle (30 min. After the period of reperfusion of 24h (n = 6 or 48h (n = 6, liver and lung samples were collected for histology and immunohistochemistry to assess the impairment of cell. RESULTS: The animals of GII and GII-24h-48h showed parenchyma liver close to normal, when using NAC. The GII and GII-24h-48h showed lower thickness of alveolar cells that GI and GI-24h-48h. The expression of caspase 3 in lung cells GII presented smaller value compared to the GI group. CONCLUSION: N-acetyl-cysteine administered 15min prior to the injury ischemia/reperfusion had a significant protective role by minimizing lung injury and apoptotic morphology in the period observed.OBJETIVO: Estudar as lesões no fígado e no pulmão de coelhos, provocadas pela isquemia/reperfusão hepática (I/R moduladas pelo uso da N-acetil-cisteína (NAC. MÉTODOS: Vinte e quatro coelhos distribuídos em dois grupos: Grupo controle GI (n=12 solução de glicose 5% e Grupo experimento GII (n=12 NAC. Os animais foram pré-anestesiados com maleato de acepromazina 1% e anestesiados com cloridrato de quetamina 10% e xilazina 2% via intramuscular. Os grupos GI e GII receberam solução glicosada ou NAC respectivamente via endovenosa 15min antes da oclusão do pedículo hepático (30 min. Após iniciou-se o período de reperfusão por 24h (n=6 ou 48h (n=6, terminada a reperfusão, amostras do fígado e pulmão foram coletadas para a histologia e imunoistoquímica para avaliar o

  20. Efeito do enxerto autólogo de pericôndrio costal com butil-2-cianoacrilato em lesão provocada na cartilagem articular do joelho de coelhos The effect of autologous costal perichondrium graft with butyl-2-cyanoacrylate in provoked injury in the articular cartilage of rabbit’s knee

    Directory of Open Access Journals (Sweden)

    Mário Sérgio Viana Xavier

    1999-10-01

    Full Text Available A finalidade desse estudo foi verificar o efeito do enxerto autólogo de pericôndrio com butil-2-cianoacrilato em lesão provocada na cartilagem articular do joelho de coelhos. Foram utilizados animais machos, adultos, divididos em 2 grupos, denominados de Grupo A e de Grupo B, de 17 animais cada um. Os animais do Grupo A foram reoperados com 4 semanas e os do Grupo B com 8 semanas. Foi retirado um fragmento de 2 cm da 7ª cartilagem costal esquerda do qual se descolou o pericôndrio. Retiraram-se dois cilindros ósseo-cartilaginosos, um de cada côndilo femural medial do mesmo animal. De um lado a cartilagem articular do cilindro foi substituida por pericôndrio com um fina camada do adesivo tecidual na sua face externa e do outro lado só foi retirada a cartilagem articular. Os cilindros foram recolocados nos fêmures. Macroscopicamente, no Grupo A, encontrou-se a maioria das lesões com pericôndrio recobertas totalmente com tecido e todas as lesões sem pericôndrio recobertas parcialmente. No Grupo B, não se encontrou diferença macroscópica significante entre a cobertura total e parcial com tecido, das lesões. Estatisticamente, não houve diferença microscópica significante entre as lesões com pericôndrio e sem pericôndrio do Grupo A e do Grupo B e nem entre os Grupos A e B.The purpose of this study was to verify the effect of the perichondrium graft with butyl-2-cyanoacrylate in provoked injury in the articular cartilage of rabbit`s knee. Male adult animals were used, divided in 2 groups, called Group A and Group B, with 17 animals each. The Group A animals were reoperated in 4 weeks and the Group B animals in 8 weeks. A 2 cm fragment was taken out from the 7th costal cartilage from which the perichondrium was removed. Two osteo-cartilaginous cylinders were taken out from each medialis condyles of the femurs in the same animal. The articular cartilage of the cylinder was replaced in one side by the perichondrium with a thin layer