WorldWideScience

Sample records for ap star beta

  1. The radius and effective temperature of the binary Ap star beta CrB from CHARA/FLUOR and VLT/NACO observations

    CERN Document Server

    Bruntt, H; Merand, A; Brandao, I M; Bedding, T R; Brummelaar, T A ten; Foresto, V Coude du; Cunha, M S; Farrington, C; Goldfinger, P J; Kiss, L L; McAlister, H A; Ridgway, S T; Sturmann, J; Sturmann, L; Turner, N; Tuthill, P G

    2009-01-01

    The prospects for using asteroseismology of rapidly oscillating Ap (roAp) stars are hampered by the large uncertainty in fundamental stellar parameters. Results in the literature for the effective temperature (Teff) often span a range of 1000 K. Our goal is to reduce systematic errors and improve the Teff calibration of Ap stars based on new interferometric measurements. We obtained long-baseline interferometric observations of beta CrB using the CHARA/FLUOR instrument. To disentangle the flux contributions of the two components of this binary star, we obtained VLT/NACO adaptive optics images. We determined limb darkened angular diameters of 0.699+-0.017 mas for beta CrB A (from interferometry) and 0.415+-0.017 mas for beta CrB B (from surface brightness- color relations), corresponding to radii of 2.63+-0.09 Rsun (3.4 percent uncertainty) and 1.56+-0.07 Rsun (4.5 percent). The combined bolometric flux of the A and B components was determined from satellite UV data, spectrophotometry in the visible and broadb...

  2. Ap stars with variable periods

    OpenAIRE

    Mikulášek, Zdeněk; Krtička, Jiří; Janík, Jan; Zejda, Miloslav; Henry, Gegory W.; Paunzen, Ernst; Žižňovský, Jozef; Zverko, Juraj

    2013-01-01

    The majority of magnetic chemically peculiar (mCP) stars exhibit periodic light, magnetic, radio, and spectroscopic variations that can be adequately modelled as a rigidly-rotating main-sequence star with persistent surface structures. Nevertheless, there is a small sample of diverse mCP stars whose rotation periods vary on timescales of decades while the shapes of their phase curves remain unchanged. Alternating period increases and decreases have been suspected in the hot CP stars CU Vir an...

  3. Ap stars with variable periods

    CERN Document Server

    Mikulášek, Zdeněk; Janík, Jan; Zejda, Miloslav; Henry, Gegory W; Paunzen, Ernst; Žižňovský, Jozef; Zverko, Juraj

    2013-01-01

    The majority of magnetic chemically peculiar (mCP) stars exhibit periodic light, magnetic, radio, and spectroscopic variations that can be adequately modelled as a rigidly-rotating main-sequence star with persistent surface structures. Nevertheless, there is a small sample of diverse mCP stars whose rotation periods vary on timescales of decades while the shapes of their phase curves remain unchanged. Alternating period increases and decreases have been suspected in the hot CP stars CU Vir and V901 Ori, while rotation in the moderately cool star BS Cir has been decelerating. These examples bring new insight into this theoretically unpredicted phenomenon. We discuss possible causes of such behaviour and propose that dynamic interactions between a thin, outer, magnetically-confined envelope braked by the stellar wind, and an inner faster-rotating stellar body are able to explain the observed rotational variability

  4. Multiplicity of rapidly oscillating Ap stars

    CERN Document Server

    Schoeller, M; Hubrig, S; Kurtz, D W

    2012-01-01

    Rapidly oscillating Ap (roAp) stars have rarely been found in binary or higher order multiple systems. This might have implications for their origin. We intend to study the multiplicity of this type of chemically peculiar stars, looking for visual companions in the range of angular separation between 0.05" and 8". We carried out a survey of 28 roAp stars using diffraction-limited near-infrared imaging with NAOS-CONICA at the VLT. Additionally, we observed three non-oscillating magnetic Ap stars. We detected a total of six companion candidates with low chance projection probabilities. Four of these are new detections, the other two are confirmations. An additional 39 companion candidates are very likely chance projections. We also found one binary system among the non-oscillating magnetic Ap stars. The detected companion candidates have apparent K magnitudes between 6.8 and 19.5 and angular separations ranging from 0.23" to 8.9", corresponding to linear projected separations of 30-2400AU. While our study confi...

  5. Magnetic Doppler Imaging of Ap stars

    OpenAIRE

    Silvester, J.; Wade, G. A.; Kochukhov, O.; Landstreet, J. D.; Bagnulo, S.

    2007-01-01

    Historically, the magnetic field geometries of the chemically peculiar Ap stars were modelled in the context of a simple dipole field. However, with the acquisition of increasingly sophisticated diagnostic data, it has become clear that the large-scale field topologies exhibit important departures from this simple model. Recently, new high-resolution circular and linear polarisation spectroscopy has even hinted at the presence of strong, small-scale field structures, which were completely une...

  6. The Dushak–Erekdag Survey of roAp Stars

    Indian Academy of Sciences (India)

    Tatyana Dorokhova; Nikolay Dorokhov

    2005-06-01

    The search of roAp stars at Mt. Dushak–Erekdag Observatory was started in 1992 using the 0.8m Odessa telescope equipped with a two-star high-speed photometer. We have observed more than a dozen stars so far and discovered HD 99563 as roAp star while BD+8087 is suspected to have rapid oscillations. Negative results of our observations for the search of rapid oscillations in four stars in NGC 752 are also discussed.

  7. Multiplicity among chemically peculiar stars II. Cool magnetic Ap stars

    OpenAIRE

    Carrier, F.; North, P.; Udry, S.; Babel, J.

    2002-01-01

    We present new orbits for sixteen Ap spectroscopic binaries, four of which might in fact be Am stars, and give their orbital elements. Four of them are SB2 systems: HD 5550, HD 22128, HD 56495 and HD 98088. The twelve other stars are : HD 9996, HD 12288, HD 40711, HD 54908, HD 65339, HD 73709, HD 105680, HD 138426, HD 184471, HD 188854, HD 200405 and HD 216533. Rough estimates of the individual masses of the components of HD 65339 (53 Cam) are given, combining our radial velocities with the r...

  8. Kepler observations of rapidly oscillating Ap, δ Scuti and γ Doradus pulsations in Ap stars

    DEFF Research Database (Denmark)

    Balona, Luis A.; Cunha, Margarida S.; Kurtz, Donald W.;

    2011-01-01

    Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present. Multiper......Observations of the A5p star KIC 8677585 obtained during the Kepler 10-d commissioning run with 1-min time resolution show that it is a rapidly oscillating Ap (roAp) star with several frequencies with periods near 10 min. In addition, a low frequency at 3.142 d−1 is also clearly present....... Multiperiodic γ Doradus (γ Dor) and δ Scuti (δ Sct) pulsations, never before seen in any Ap star, are present in Kepler observations of at least three other Ap stars. Since γ Dor pulsations are seen in Ap stars, it is likely that the low frequency in KIC 8677585 is also a γ Dor pulsation. The simultaneous...

  9. Discovery of new roAp pulsators in the UVES survey of cool magnetic Ap stars

    CERN Document Server

    Kochukhov, O; Ryabchikova, T; Boyko, S; Cunha, M; Tsymbal, V; Weiss, W

    2013-01-01

    We have carried out a survey of short-period pulsations among a sample of carefully chosen cool Ap stars using time-resolved observations with the UVES spectrometer at the ESO 8-m VLT telescope. Here we report the discovery of pulsations with amplitudes 50-100 m/s and periods 7-12 min in HD132205, HD148593 and HD151860. These objects are therefore established as new rapidly oscillating Ap (roAp) stars. In addition, we independently confirm the presence of pulsations in HD69013, HD96237 and HD143487 and detect, for the first time, radial velocity oscillations in two previously known photometric roAp stars HD119027 and HD185256. At the same time, no pulsation variability is found for HD5823, HD178892 and HD185204. All of the newly discovered roAp stars were previously classified as non-pulsating based on the low-precision ground-based photometric surveys. This shows that such observations cannot be used to reliably distinguish between pulsating and non-pulsating stars and that all cool Ap stars may harbor p-mod...

  10. A Brightness-Referenced Star Identification Algorithm for APS Star Trackers

    OpenAIRE

    Peng Zhang; Qile Zhao; Jingnan Liu; Ning Liu

    2014-01-01

    Star trackers are currently the most accurate spacecraft attitude sensors. As a result, they are widely used in remote sensing satellites. Since traditional charge-coupled device (CCD)-based star trackers have a limited sensitivity range and dynamic range, the matching process for a star tracker is typically not very sensitive to star brightness. For active pixel sensor (APS) star trackers, the intensity of an imaged star is valuable information that can be used in star identification process...

  11. Diffusion and Settling in Ap/Bp Stars

    Energy Technology Data Exchange (ETDEWEB)

    Turcotte, S

    2003-04-09

    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  12. Diffusion and Settling in Ap/Bp Stars

    CERN Document Server

    Turcotte, S

    2003-01-01

    Ap/Bp stars are magnetic chemically peculiar early A and late B type stars of the main sequence. They exhibit peculiar surface abundance anomalies that are thought to be the result of gravitational settling and radiative levitation. The physics of diffusion in these stars are reviewed briefly and some model predictions are discussed. While models reproduce some observations reasonably well, more work is needed before the behavior of diffusing elements in a complex magnetic field is fully understood.

  13. Autonomous star tracker based on active pixel sensors (APS)

    Science.gov (United States)

    Schmidt, U.

    2004-06-01

    Star trackers are opto-electronic sensors used onboard of satellites for the autonomous inertial attitude determination. During the last years, star trackers became more and more important in the field of the attitude and orbit control system (AOCS) sensors. High performance star trackers are based up today on charge coupled device (CCD) optical camera heads. The Jena-Optronik GmbH is active in the field of opto-electronic sensors like star trackers since the early 80-ties. Today, with the product family ASTRO5, ASTRO10 and ASTRO15, all marked segments like earth observation, scientific applications and geo-telecom are supplied to European and Overseas customers. A new generation of star trackers can be designed based on the APS detector technical features. The measurement performance of the current CCD based star trackers can be maintained, the star tracker functionality, reliability and robustness can be increased while the unit costs are saved.

  14. A brightness-referenced star identification algorithm for APS star trackers.

    Science.gov (United States)

    Zhang, Peng; Zhao, Qile; Liu, Jingnan; Liu, Ning

    2014-01-01

    Star trackers are currently the most accurate spacecraft attitude sensors. As a result, they are widely used in remote sensing satellites. Since traditional charge-coupled device (CCD)-based star trackers have a limited sensitivity range and dynamic range, the matching process for a star tracker is typically not very sensitive to star brightness. For active pixel sensor (APS) star trackers, the intensity of an imaged star is valuable information that can be used in star identification process. In this paper an improved brightness referenced star identification algorithm is presented. This algorithm utilizes the k-vector search theory and adds imaged stars' intensities to narrow the search scope and therefore increase the efficiency of the matching process. Based on different imaging conditions (slew, bright bodies, etc.) the developed matching algorithm operates in one of two identification modes: a three-star mode, and a four-star mode. If the reference bright stars (the stars brighter than three magnitude) show up, the algorithm runs the three-star mode and efficiency is further improved. The proposed method was compared with other two distinctive methods the pyramid and geometric voting methods. All three methods were tested with simulation data and actual in orbit data from the APS star tracker of ZY-3. Using a catalog composed of 1500 stars, the results show that without false stars the efficiency of this new method is 4~5 times that of the pyramid method and 35~37 times that of the geometric method. PMID:25299950

  15. A Brightness-Referenced Star Identification Algorithm for APS Star Trackers

    Directory of Open Access Journals (Sweden)

    Peng Zhang

    2014-10-01

    Full Text Available Star trackers are currently the most accurate spacecraft attitude sensors. As a result, they are widely used in remote sensing satellites. Since traditional charge-coupled device (CCD-based star trackers have a limited sensitivity range and dynamic range, the matching process for a star tracker is typically not very sensitive to star brightness. For active pixel sensor (APS star trackers, the intensity of an imaged star is valuable information that can be used in star identification process. In this paper an improved brightness referenced star identification algorithm is presented. This algorithm utilizes the k-vector search theory and adds imaged stars’ intensities to narrow the search scope and therefore increase the efficiency of the matching process. Based on different imaging conditions (slew, bright bodies, etc. the developed matching algorithm operates in one of two identification modes: a three-star mode, and a four-star mode. If the reference bright stars (the stars brighter than three magnitude show up, the algorithm runs the three-star mode and efficiency is further improved. The proposed method was compared with other two distinctive methods the pyramid and geometric voting methods. All three methods were tested with simulation data and actual in orbit data from the APS star tracker of ZY-3. Using a catalog composed of 1500 stars, the results show that without false stars the efficiency of this new method is 4~5 times that of the pyramid method and 35~37 times that of the geometric method.

  16. Miniature Autonomous Star Tracker Based on CMOS APS

    OpenAIRE

    Ying, Dong; Zheng, You; Fei, Xing; Qin, Chou

    2006-01-01

    An APS (Active Pixel Sensor) based autonomous star tracker (AAST) has been proposed for small satellite and microsatellite attitude determination. A prototype of AAST has been developed. It has low mass of 1kg, low power of 3W, high rate up to 5Hz, and acquisition success rate of higher than 99.9%. The improvements in dimensions and performances are realized with the replacement of the CCD (Charge Coupled Device) by the APS. The optical design of the prototype is based on PSF (Point Spread Fu...

  17. Abnormal lithium abundance in several Ap-Bp stars

    CERN Document Server

    Shavrina, A; Drake, N A; Kudryavtsev, D O; Gopka, V F; Yushchenko, V A; Yushchenko, A V

    2013-01-01

    Using observations of rapidly rotating roAp star HD 12098, obtained with 6m telescope of SAO RAS in 2005-2008 in nine rotational phases (0.001-0.817), and code V. Tsymbal ROTATE we identified 3 lithium spots on the surface of star, one of them coincided with the position of one magnetic pole and two others are located near the other pole, symmetrically with respect to it. Perhaps magnetic field of the star has a more complex structure than the dipole (Shavrina 2008). Lithium abundance in the spots is greater than cosmic one. It can be explained by diffusion of lithium in the presence of a magnetic field or by production of lithium in the reactions of "spallation" on the surface of star near the magnetic poles (see, for example, Goriely 2007). Enhanced lithium abundances was also determined for other two slowly rotating Ap stars HR 465 and HD 965. The analysis is performed using a synthetic spectrum method taking into account magnetic splitting of lines by the SYNTHM code of Khan (2004).

  18. On the evolution of the magnetic field of Ap star $\\alpha^2$ CVn

    CERN Document Server

    Bychkov, V D; Madej, J; Topilskaya, G P

    2016-01-01

    New high-precision measurements of the longitudinal magnetic field of Ap stars suggest the existence of secular intrinsic variations of the global magnetic field in some stars. We argue that such changes are apparent in the Ap star $\\alpha^2$ CVn in the time scale of $\\sim$ 10 years, which results from the analysis of literature data. Therefore, such an observation implies, that the rate of magnetic field evolution of Ap stars is much higher than was previously thought.

  19. Magnetic AP Stars in the Hertzsprung-Russell Diagram

    Science.gov (United States)

    Hubrig, S.; North, P.; Mathys, G.

    2000-08-01

    The evolutionary state of magnetic Ap stars is rediscussed using the recently released Hipparcos data. The distribution of the magnetic Ap stars of mass below 3 Msolar in the H-R diagram differs from that of the normal stars in the same temperature range at a high level of significance. Magnetic stars are concentrated toward the center of the main-sequence band. This is shown in two forms of the H-R diagram: one where logL is plotted against logTeff and a version more directly tied to the observed quantities, showing the astrometry-based luminosity (Arenou & Luri) against the (B2-G)0 index of Geneva photometry. In particular, it is found that magnetic fields appear only in stars that have already completed at least approximately 30% of their main-sequence lifetime. No clear picture emerges as to the possible evolution of the magnetic field across the main sequence. Hints of some (loose) relations between magnetic field strength and other stellar parameters are found: stars with shorter periods tend to have stronger fields, as do higher temperature and higher mass stars. A marginal trend of the magnetic flux to be lower in more slowly rotating stars may possibly be seen as suggesting a dynamo origin for the field. No correlation between the rotation period and the fraction of the main-sequence lifetime completed is observed, indicating that the slow rotation in these stars must already have been achieved before they became observably magnetic. Based on data from the ESA Hipparcos satellite and on observations collected at the European Southern Observatory (La Silla, Chile; ESO programs Nos. 43.7-004, 44.7-012, 49.7-030, 50.7-067, 51.7-041, 52.7-063, 53.7-028, 54.E-0416, and 55.E-0751), at the Observatoire de Haute-Provence (Saint-Michel l'Observatoire, France), at Kitt Peak National Observatory, and at the Canada-France-Hawaii Telescope.

  20. Towards a theory of rapidly oscillating Ap stars

    CERN Document Server

    Gough, Douglas

    2011-01-01

    Peculiar A stars are so named because they exhibit abundance peculiarities in their atmospheres. It is believed that these arise as a result of differentiation of chemical species in large magnetic spots in which convective mixing is inhibited: there might be just two antipodal spots, whose axis is inclined to the axis of rotation. Many of the Ap stars that are rotating slowly also pulsate, with periods substantially shorter than the period of the fundamental radial mode. The pulsations appear to be nonradial, but axisymmetric, with their common axis usually aligned with the axis of the spots. In this lecture I shall first discuss the magnetic suppression of convection in the spots, and then I shall try to explain the pulsation phenomenon, reviewing some of the suggestions that have been made to explain the alignment and the excitation mechanism, and finally raising some issues that need to be addressed.

  1. Discovery of the longest-period rapidly oscillating Ap star HD177765

    CERN Document Server

    Alentiev, D; Ryabchikova, T; Cunha, M; Tsymbal, V; Weiss, W

    2011-01-01

    We present the discovery of a long-period, rapidly oscillating Ap star, HD177765. Using high-resolution time-series observations obtained with UVES at the ESO VLT telescope, we found radial velocity variations with amplitudes 7-150 m/s and a period of 23.6 min, exceeding that of any previously known roAp star. The largest pulsation amplitudes are observed for Eu III, Ce III and for the narrow core of Halpha. We derived the atmospheric parameters and chemical composition of HD177765, showing this star to be similar to other long-period roAp stars. Comparison with theoretical pulsational models indicates an advanced evolutionary state for HD177765. Abundance analyses of this and other roAp stars suggest a systematic variation with age of the rare-earth line anomalies seen in cool Ap stars.

  2. A Tight Upper Limit on Oscillations in the Ap star Epsilon Ursae Majoris from WIRE Photometry

    CERN Document Server

    Retter, A; Buzasi, D L; Kjeldsen, H; Kiss, L L; Retter, Alon; Bedding, Timothy R.; Buzasi, Derek L.; Kjeldsen, Hans; Kiss, Laszlo L.

    2004-01-01

    Observations of Epsilon UMa obtained with the star tracker on the Wide Field Infrared Explorer (WIRE) satellite during a month in mid-2000 are analyzed. This is one of the most precise photometry of an Ap star. The amplitude spectrum is used to set an upper limit of 75 parts per million for the amplitude of stellar pulsations in this star unless it accidentally oscillates with a single mode at the satellite orbit, its harmonics or their one day aliases. This is the tightest limit put on the amplitude of oscillations in an Ap star. As the rotation period of Epsilon UMa is relatively short (5.1 d), it cannot be argued that the observations were made at a wrong rotational phase. Our results thus support the idea that some Ap stars do not pulsate at all.

  3. A magnetic model for acoustic modes in roAp stars

    CERN Document Server

    Zita, E J

    1998-01-01

    The mechanism for excitation of p-modes in rapidly oscillating, peculiar A (roAp, or cool chemically peculiar, CP) stars is unknown. Observations strongly suggest that acoustic modes in roAp stars are causally linked to the stars' magnetic field. We propose that small fluctuations in the shape of the mean magnetic field drive magnetosonic waves, which are observed as p-modes in these stars. The dynamic edge region of roAp stars is a force-free spherical shell. When strongly coupled to the magnetic field, a force-free plasma can oscillate about a minimum in its mean magnetic energy. We describe the stable eigenmodes for this energy minimum in a spherical shell with an open boundary. The wavenumbers, frequencies, and energies of resulting oscillations are consistent with observations of p-modes in roAp stars. Our magnetic model for p-mode oscillations in stars does not invoke convection or opacity mechanisms. We also suggest the possibility of a nonlinear dynamo for such magnetic stars, which lack the convectio...

  4. Stokes IQUV mapping of $\\alpha^2$ CVn & other Ap stars using ESPaDOnS and NARVAL

    OpenAIRE

    Silvester, J.; Kochukhov, O.; Wade, G. A.

    2013-01-01

    New spectral line polarisation observations of 7 bright Ap stars have been obtained with the ESPaDOnS and Narval high resolution spectropolarimeters (Silvester et al. 2012). The aim of this data set is produce a series of surface magnetic field and surface chemistry maps for these Ap stars. We present new magnetic maps for the Ap star $\\alpha^2$ CVn using these new data and the MDI inversion code INVERS10. $\\alpha^2$ CVn is the first Ap star to be observed during two separate epochs using hig...

  5. MALDI, AP/MALDI and ESI techniques for the MS detection of amyloid [beta]-peptides

    Science.gov (United States)

    Grasso, Giuseppe; Mineo, Placido; Rizzarelli, Enrico; Spoto, Giuseppe

    2009-04-01

    Amyloid [beta]-peptides (A[beta]s) are involved in several neuropathological conditions such as Alzheimer's disease and considerable experimental evidences have emerged indicating that different proteases play a major role in regulating the accumulation of A[beta]s in the brain. Particularly, insulin-degrading enzyme (IDE) has been shown to degrade A[beta]s at different cleavage sites, but the experimental results reported in the literature and obtained by mass spectrometry methods are somehow fragmentary. The detection of A[beta]s is often complicated by solubility issues, oxidation artifacts and spontaneous aggregation/cleavage and, in order to rationalize the different reported results, we analyzed A[beta]s solutions by three different MS approaches: matrix assisted laser desorption ionization-time of flight (MALDI-TOF), atmospheric pressure (AP) MALDI ion trap and electrospray ionization (ESI) ion trap. Differences in the obtained results are discussed and ESI is chosen as the most suitable MS method for A[beta]s detection. Finally, cleavage sites produced by interaction of A[beta]s with IDE are identified, two of which had never been reported in the literature.

  6. Stokes IQUV Magnetic Doppler Imaging of Ap stars I. ESPaDOnS and NARVAL Observations

    OpenAIRE

    Silvester, J.; Wade, G. A.; Kochukhov, O.; Bagnulo, S.; Folsom, C. P.; Hanes, D.

    2012-01-01

    In this paper we describe and evaluate new spectral line polarisation observations obtained with the goal of mapping the surfaces of magnetic Ap stars in great detail. One hundred complete or partial Stokes IQUV sequences, corresponding to 297 individual polarised spectra, have been obtained for 7 bright Ap stars using the ESPaDOnS and NARVAL spectropolarimeters. The targets span a range of mass from approximately 1.8 to 3.4 solar mass, a range of rotation period from 2.56 to 6.80 days, and a...

  7. The magnetic field topology and chemical abundance distributions of the Ap star HD 32633

    OpenAIRE

    Silvester, James; Kochukhov, Oleg; Wade, G. A.

    2015-01-01

    Previous observations of the Ap star HD 32633 indicated that its magnetic field was unusually complex in nature and could not be characterised by a simple dipolar structure. Here we derive magnetic field maps and chemical abundance distributions for this star using full Stokes vector (Stokes $IQUV$) high-resolution observations obtained with the ESPaDOnS and Narval spectropolarimeters. Our maps, produced using the Invers10 magnetic Doppler imaging (MDI) code, show that HD 32633 has a strong m...

  8. Properties of a volume-limited sample of magnetic Ap/Bp stars

    CERN Document Server

    Power, J; Hanes, D A; Aurière, M; Silvester, J

    2006-01-01

    This paper describes a study to deduce fundamental parameters and magnetic field characteristics for all magnetic Ap/Bp stars with in a 100 parsec heliocentric radius volume. This study has allowed for the first time the determination of an effectively unbiased magnetic field distribution of a sample of intermediate mass stars. From published catalogues and other literature sources, we have identified 57 bone fide magnetic A and B stars in the volume, corresponding to 1.7% of all intermediate mass stars within 100 parsec of the Sun. The masses of Ap stars range from 1.5 to 6 solar masses, with the peak of the mass incidence distribution between 3.3 and 3.6 solar masses. Observations of 30 of the Ap/Bp stars were obtained using the MuSiCoS spectropolarimeter at the Telescope Bernard Lyot at Pic du Midi Observatory. These observations will be used to refine periods, and determine magnetic field strength and geometry.

  9. Rotation and oblique pulsation in Kepler observations of the roAp star KIC 10483436

    DEFF Research Database (Denmark)

    Balona, L. A.; Cunha, M. S.; Gruberbauer, M.;

    2011-01-01

    Photometry of KIC 10483436 was obtained continuously with 1-min exposures over a 27-d period from the Kepler satellite. The light curve shows rotational variations from surface spots with a period of 4.303 ± 0.002 d, an amplitude of about 6 mmag and eight pulsation frequencies typical of roAp stars...

  10. A Tight Upper Limit on Oscillations in the Ap star Epsilon Ursae Majoris from WIRE Photometry

    OpenAIRE

    Retter, Alon; Bedding, Timothy R.; Buzasi, Derek L.; Kjeldsen, Hans; Kiss, Laszlo L.

    2003-01-01

    Observations of Epsilon UMa obtained with the star tracker on the Wide Field Infrared Explorer (WIRE) satellite during a month in mid-2000 are analyzed. This is one of the most precise photometry of an Ap star. The amplitude spectrum is used to set an upper limit of 75 parts per million for the amplitude of stellar pulsations in this star unless it accidentally oscillates with a single mode at the satellite orbit, its harmonics or their one day aliases. This is the tightest limit put on the a...

  11. Neutron Stars as a Source of the Short-Lived Nuclides in Ap-star Atmospheres

    International Nuclear Information System (INIS)

    We propose a new explanation of some magnetic chemically peculiar (MCP) star anomalies, which is based on an assumption that such stars be the close binary systems with a secondary component being a neutron star. Within this hypothesis one can naturally explain the main anomalous features of MCP stars: first of all, an existence of the short-lived radioactive isotopes detected in some stars (like Przybylski's star (PS) and HR465), and some others peculiarities. Also we can assume the presence of the electron-positron annihilation emission lines (0.511 MeV) in the gamma spectrum of some MCP stars

  12. The roAp star $\\alpha$ Circini as seen by BRITE-Constellation

    CERN Document Server

    Weiss, W W; Pigulski, A; Popowicz, A; Huber, D; Kuschnig, R; Moffat, A F J; Matthews, J M; Saio, H; Schwarzenberg-Czerny, A; Grant, C C; Koudelka, O; Lüftinger, T; Rucinski, S M; Wade, G A; Alves, J; Guedel, M; Handler, G; Mochnacki, St; Orleanski, P; Pablo, B; Pamyatnykh, A; Ramiaramanantsoa, T; Rowe, J; Whittaker, G; Zawistowski, T; Zocłonska, E; Zwintz, K

    2016-01-01

    We report on an analysis of high-precision, multi-colour photometric observations of the rapidly-oscillating Ap (roAp) star $\\alpha$ Cir. These observations were obtained with the BRITE-Constellation, which is a coordinated mission of five nanosatellites that collects continuous millimagnitude-precision photometry of dozens of bright stars for up to 180 days at a time in two colours (Johnson B and R). BRITE stands for BRight Target Explorer. The object $\\alpha$ Cir is the brightest roAp star and an ideal target for such investigations, facilitating the determination of oscillation frequencies with high resolution. This star is bright enough for complementary interferometry and time-resolved spectroscopy. Four BRITE satellites observed $\\alpha$ Cir for 146 d or 33 rotational cycles. Phasing the photometry according to the 4.4790 d rotational period reveals qualitatively different light variations in the two photometric bands. The phased red-band photometry is in good agreement with previously-published WIRE da...

  13. Spectral analysis of Kepler SPB and Beta Cep candidate stars

    CERN Document Server

    Lehmann, H; Semaan, T; Gutiérrez, J; Smalley, B; Briquet, M; Shulyak, D; Tsymbal, V; de Cat, P

    2010-01-01

    We determine the fundamental parameters of SPB and Beta Cep candidate stars observed by the Kepler satellite mission and estimate the expected types of non-radial pulsators by comparing newly obtained high-resolution spectra with synthetic spectra computed on a grid of stellar parameters assuming LTE and check for NLTE effects for the hottest stars. For comparison, we determine Teff independently from fitting the spectral energy distribution of the stars obtained from the available photometry. We determine Teff, log(g), micro-turbulent velocity, vsin(i), metallicity, and elemental abundance for 14 of the 16 candidate stars, two of the stars are spectroscopic binaries. No significant influence of NLTE effects on the results could be found. For hot stars, we find systematic deviations of the determined effective temperatures from those given in the Kepler Input Catalogue. The deviations are confirmed by the results obtained from ground-based photometry. Five stars show reduced metallicity, two stars are He-stro...

  14. Stokes IQUV Magnetic Doppler Imaging of Ap stars I. ESPaDOnS and NARVAL Observations

    CERN Document Server

    Silvester, J; Kochukhov, O; Bagnulo, S; Folsom, C P; Hanes, D

    2012-01-01

    In this paper we describe and evaluate new spectral line polarisation observations obtained with the goal of mapping the surfaces of magnetic Ap stars in great detail. One hundred complete or partial Stokes IQUV sequences, corresponding to 297 individual polarised spectra, have been obtained for 7 bright Ap stars using the ESPaDOnS and NARVAL spectropolarimeters. The targets span a range of mass from approximately 1.8 to 3.4 solar mass, a range of rotation period from 2.56 to 6.80 days, and a range of maximum longitudinal magnetic field strength from 0.3 to over 4 kG. For 3 of the 7 stars, we have obtained dense phase coverage sampling the entire rotational cycle. These datasets are suitable for immediate magnetic and chemical abundance surface mapping using Magnetic Doppler Imaging (MDI). For the 4 remaining stars, partial phase coverage has been obtained, and additional observations will be required in order to map the surfaces of these stars. The median signal-to-noise ratio of the reduced observations is ...

  15. X-rays from magnetic intermediate mass Ap/Bp stars

    Science.gov (United States)

    Robrade, Jan

    2016-09-01

    The X-ray emission of magnetic intermediate mass Ap/Bp stars is reviewed and put into context of intrinsic as well as extrinsic hypotheses for its origin. New X-ray observations of Ap/Bp stars are presented and combined with an updated analysis of the available datasets, providing the largest sample of its type that is currently available. In the studied stars the X-ray detections are found predominantly among the more massive, hotter and more luminous targets. Their X-ray properties are quite diverse and beside strong soft X-ray emission significant magnetic activity is frequently present. While a connection between more powerful winds and brighter X-ray emission is expected in intrinsic models, the scatter in X-ray luminosity at given bolometric luminosity is so far unexplained and several observational features like X-ray light curves and flaring, luminosity distributions and spectral properties are often similar to those of low-mass stars. It remains to be seen if these features can be fully reproduced by magnetospheres of intermediate mass stars. The article discusses implications for magnetically confined wind-shock models (MCWS) and stellar magnetospheres under the assumption that the intrinsic model is applicable, but also examines the role of possible companions. Further, related magnetospheric phenomena are presented and an outlook on future perspectives is given.

  16. Abundance distributions over the surfaces of magnetic ApBp stars: theoretical predictions

    CERN Document Server

    Alecian, G

    2015-01-01

    Recently published empirical abundance maps, obtained through (Zeeman) Doppler mapping (ZDM), do not currently agree with the abundance structures predicted by means of numerical models of atomic diffusion in magnetic atmospheres of ApBp stars. In a first step towards the resolution of these discrepancies, we present a state of the art grid of equilibrium abundance stratifications in the atmosphere of a magnetic Ap star with T_eff = 10000 K and log g = 4.0. A description of the behaviour of 16 chemical elements including predictions concerning the over- and/or under-abundances over the stellar surface is followed by a discussion of the possible influence of presently neglected physical processes.

  17. Mining the HST "Advanced Spectral Library (ASTRAL) - Hot Stars": The High Definition UV Spectrum of the Ap Star HR 465

    Science.gov (United States)

    Carpenter, Kenneth G.; Ayres, T. R.; Nielsen, K. E.; Kober, G. V.; Wahlgren, G. M.; Adelman, S. J.; Cowley, C. R.

    2014-01-01

    The "Advanced Spectral Library (ASTRAL) Project: Hot Stars" is a Hubble Space Telescope (HST) Cycle 21 Treasury Program (GO-13346: Ayres PI). It is designed to collect a definitive set of representative, high-resolution ( 30,000-100,000), high signal/noise (S/N>100), and full UV coverage 1200 - 3000 A) spectra of 21 early-type stars, utilizing the high-performance Space Telescope Imaging Spectrograph (STIS). The targets span the range of spectral types between early-O and early-A, including both main sequence and evolved stars, fast and slow rotators, as well as chemically peculiar (CP) and magnetic objects. These extremely high-quality STIS UV echelle spectra will be available from the HST archive and, in post-processed and merged form, at http://casa.colorado.edu ayres/ASTRAL/. The UV "atlases" produced by this program will enable investigations of a broad range of problems -- stellar, interstellar, and beyond -- for many years to come. We offer a first look at one of the earliest datasets to come out of this observing program, a "high definition" UV spectrum of the Ap star HR 465, which was chosen as a prototypical example of an A-type magnetic CP star. HR 465 has a global magnetic field of ~2200 Gauss. Earlier analyses of IUE spectra show strong iron-peak element lines, along with heavy elements such as Ga and Pt, while being deficient in the abundance of some ions of low atomic number, such as carbon. We demonstrate the high quality of the ASTRAL data and present the identification of spectral lines for a number of elements. By comparison of the observed spectra with calculated spectra, we also provide estimates of element abundances, emphasizing heavy elements, and place these measurements in the context of earlier results for this and other Ap stars.

  18. Stokes IQUV magnetic Doppler imaging of Ap stars - I. ESPaDOnS and NARVAL observations

    Science.gov (United States)

    Silvester, J.; Wade, G. A.; Kochukhov, O.; Bagnulo, S.; Folsom, C. P.; Hanes, D.

    2012-10-01

    In this paper we describe and evaluate new spectral line polarization observations obtained with the goal of mapping the surfaces of magnetic Ap stars in great detail. One hundred complete or partial Stokes IQUV sequences, corresponding to 297 individual polarized spectra, have been obtained for seven bright Ap stars using the Échelle SpectroPolarimetric Device for the Observation of Stars (ESPaDOnS) and NARVAL high-resolution spectropolarimeters. The targets span a range of masses from approximately 1.8 to 3.4 M⊙, a range of rotation periods from 2.56 to 6.80 d and a range of maximum longitudinal magnetic field strengths from 0.3 to over 4 kG. For three of the seven stars, we have obtained dense phase coverage sampling the entire rotational cycle. These data sets are suitable for immediate magnetic and chemical abundance surface mapping using magnetic Doppler imaging. For the remaining four stars, partial phase coverage has been obtained, and additional observations will be required in order to map the surfaces of these stars. The median signal-to-noise ratio of the reduced observations is over 700 per 1.8 km s-1 pixel. Spectra of all stars show Stokes V Zeeman signatures in essentially all individual lines, and most stars show clear Stokes QU signatures in many individual spectral lines. The observations provide a vastly improved data set compared to previous generations of observations in terms of signal-to-noise ratio, resolving power and measurement uncertainties. Measurement of the longitudinal magnetic field demonstrates that the data are internally consistent within computed uncertainties typically at the 50-100σ level. Data are also shown to be in excellent agreement with published observations and in qualitative agreement with the predictions of published surface structure models. In addition to providing the foundation for the next generation of surface maps of Ap stars, this study establishes the performance and stability of the ESPaDOnS and NARVAL

  19. The fundamental parameters of the roAp star 10 Aql

    CERN Document Server

    Perraut, K; Cunha, M; Bigot, L; Brandão, I; Mourard, D; Nardetto, N; Chesneau, O; McAlister, H; Brummelaar, T A ten; Sturmann, J; Sturmann, L; Turner, N; Farrington, C; Goldfinger, P J

    2013-01-01

    Due to the strong magnetic field and related abnormal surface layers existing in rapidly oscillating Ap stars, systematic errors are likely to be present when determining their effective temperatures, which potentially compromises asteroseismic studies of these pulsators. Using long-baseline interferometry, our goal is to determine accurate angular diameters of a number of roAp targets to provide a temperature calibration for these stars. We obtained interferometric observations of 10 Aql with the visible spectrograph VEGA at the CHARA array. We determined a limb-darkened angular diameter of 0.275+/-0.009 mas and deduced a linear radius of 2.32+/-0.09 R_sun. We estimated the star's bolometric flux and used it, in combination with its parallax and angular diameter, to determine the star's luminosity and effective temperature. For two data sets of bolometric flux we derived an effective temperature of 7800+/-170 K and a luminosity of 18+/-1 L_sun or of 8000+/-210 K and 19+/-2 L_sun. We used these fundamental pa...

  20. Biodegradable star polymers functionalized with beta-cyclodextrin inclusion complexes.

    Science.gov (United States)

    Setijadi, Eki; Tao, Lei; Liu, Jingquan; Jia, Zhongfan; Boyer, Cyrille; Davis, Thomas P

    2009-09-14

    Three-armed biodegradable star polymers made from polystyrene (polySt) and poly (polyethylene glycol) acrylate (polyPEG-A) were synthesized via a "core first" methodology using a trifunctional RAFT agent, created by attaching RAFT agents to a core via their R-groups. The resultant three-armed polymeric structures were well-defined, with polydispersity indices less than 1.2. Upon aminolysis and further reaction with dithiodipyridine (DTDP), these three-armed polymers could be tailored with sulfhydryl and pyridyldisulfide (PDS) end functionalities, available for further reaction with any free-sulfhydryl group containing precursors to form disulfide linkages. Nuclear magnetic resonance (NMR) confirmed that more than 98% of the polymer arms retained integral trithiocarbonate active sites after polymerization. Intradisulfide linkages between the core and the arms conferred biodegradability on the star architectures. Subsequently, the arm-termini were attached to cholesterol also via disulfide linkages. The cholesterol terminated arms were then used to form supramolecular structures via inclusion complex formation with beta-cyclodextrin (beta-CD). The star architectures were found to degrade rapidly on treatment with DL-dithiothereitol (DTT). The star polymers and supramolecular structures were characterized using gel permation chromatography (GPC), static light scattering (SLS), 2D NMR, and fluorescence spectroscopy.

  1. The magnetic fields of Ap stars from high resolution Stokes IQUV spectropolarimetry

    Science.gov (United States)

    Silvester, James

    In this thesis we describe the acquisition of high resolution time resolved spectropolarimetric observations of 7 (bright and well understood) Ap stars in Stokes IQUV using the ESPaDOnS and Narval spectropolarimeters at the Canada-France-Hawaii Telescope and the 2m Telescope Bernard Lyot at Pic du Midi Observatory. We compare these observations with those obtained a decade earlier using the MuSiCoS spectropolarimeter to confirm consistency with the older data and provide evidence that both ESPaDOnS and Narval perform as expected in all Stokes parameters. We demonstrate that our refined longitudinal magnetic field and linear polarisation measurements for these 7 stars are of much greater quality than was previously obtained with MuSiCoS and that the global magnetic properties of these stars are stable over a long timescale. The ultimate aim of these new data is to provide a basis from which mapping of both the magnetic field and abundance structures can be performed on our target stars. We then describe magnetic field mapping of the Ap star alpha 2 CVn using these data. This mapping is achieved with the use of tomographic inversion of Doppler-broadened Stokes IQUV profiles of a large variety of spectral lines using the INVERS10 Magnetic Doppler imaging code. We show that not only are the new magnetic field maps of alpha 2 CVn consistent with a previous generation of maps of alpha 2 CVn, but that the same magnetic field topology can be derived from a variety of atomic line sets. This indicates that the magnetic field we derive for alpha2 CVn is a realistic representation of the star's true magnetic topology. Finally we investigate surface abundance structures for alpha 2 CVn for various chemical elements. We investigate the correlation between the location of these abundance features and the magnetic field of alpha 2 CVn. We will demonstrate that whilst the magnetic field plays a role in the formation of abundance structures, the current theoretical framework does

  2. Time-resolved photometric and spectroscopic analysis of a luminous Ap star HD103498

    CERN Document Server

    Joshi, S; Kochukhov, O; Sachkov, M; Tiwari, S K; Chakradhari, N K; Piskunov, N

    2009-01-01

    We present the results on the photometric and spectroscopic monitoring of a luminous Ap star HD103498. The time-series photometric observations were carried out on 17 nights using three-channel fast photometer attached to the 1.04-m optical telescope at ARIES, Nainital. The photometric data of five nights of year 2007 show clear signature of 15-min periodicity. However, the follow-up observations during 2007--2009 could not repeated any such periodicity. To confirm the photometric light variations, the time-series spectroscopic observations were carried out with the 2.56-m Nordic Optical Telescope (NOT) at La Palma on February 2, 2009. Any radial velocity variations were absent in this data set which is in full agreement with the photometric observations taken near the same night. Model atmosphere and abundance analysis of HD103498 show that the star is evolved from the Main Sequence and its atmospheric abundances are similar to two other evolved Ap stars HD133792 and HD204411: large overabundances of Si, Cr,...

  3. KIC 7582608: a new Kepler roAp star with frequency variability

    Directory of Open Access Journals (Sweden)

    Holdsworth D.L.

    2015-01-01

    Full Text Available We analyse the fifth roAp star reported in the Kepler field, KIC 7582608, discovered with the SuperWASP project. The object shows a high frequency pulsation at 181.7324d−1 (P = 7.9 min with an amplitude of 1.45 mmag, and low frequency rotational modulation corresponding to a period of 20.4339 d. Spectral analysis confirms the Ap nature of the target, with characteristic lines of rare earth elements present. From our spectral observations we derive a lower limit on the mean magnetic field modulus of 〈B〉 =3.05 ± 0.23 kG. Long Cadence Kepler observations show a frequency quintuplet split by the rotational period of the star, typical for an oblique pulsator. We suggest the star is a quadrupole pulsator with a geometry such that i ~ 66° and β ~ 33°. We detect frequency variations of the pulsation in both the WASP and Kepler data sets on many time scales. Linear, non-adiabatic stability modelling allows us to constrain a region on the HR diagram where the pulsations are unstable, an area consistent with observations.

  4. The first evidence for multiple pulsation axes: a new rapidly oscillating Ap star in the Kepler field, KIC 10195926

    DEFF Research Database (Denmark)

    Kurtz, Donald W.; Cunha, Margarida S.; Saio, H.;

    2011-01-01

    to these values that reproduces the rotational variations of the two obliquely pulsating modes with different pulsation axes. The star shows overabundances of the rare earth elements, but these are not as extreme as most other roAp stars. The spectrum is variable with rotation, indicating surface abundance...

  5. HD 24355 observed by the Kepler K2 mission: A rapidly oscillating Ap star pulsating in a distorted quadrupole mode

    CERN Document Server

    Holdsworth, Daniel L; Smalley, Barry; Saio, Hideyuki; Handler, Gerald; Murphy, Simon J; Lehmann, Holger

    2016-01-01

    We present an analysis of the first Kepler K2 mission observations of a rapidly oscillating Ap (roAp) star, HD 24355 ($V=9.65$). The star was discovered in SuperWASP broadband photometry with a frequency of 224.31 d$^{-1}$, (2596.18 $\\mu$Hz; $P = 6.4$ min) and an amplitude of 1.51 mmag, with later spectroscopic analysis of low-resolution spectra showing HD 24355 to be an A5 Vp SrEu star. The high precision K2 data allow us to identify 13 rotationally split sidelobes to the main pulsation frequency of HD 24355. This number of sidelobes combined with an unusual rotational phase variation show this star to be the most distorted quadrupole roAp pulsator yet observed. In modelling this star, we are able to reproduce well the amplitude modulation of the pulsation, and find a close match to the unusual phase variations. We show this star to have a pulsation frequency higher than the critical cut-off frequency. This is currently the only roAp star observed with the Kepler spacecraft in Short Cadence mode that has a p...

  6. Accurate age determinations of several nearby open clusters containing magnetic Ap stars

    CERN Document Server

    Silaj, J

    2014-01-01

    Aims: Our aim is to obtain ages that are as accurate as possible for the seven nearby open clusters alpha Per, Coma Ber, IC 2602, NGC 2232, NGC 2451A, NGC 2516, and NGC 6475, each of which contains at least one magnetic Ap or Bp star. Simultaneously, we test the current calibrations of Te and luminosity for the Ap/Bp star members, and identify clearly blue stragglers in the clusters studied. Methods: We explore the possibility that isochrone fitting in the theoretical Hertzsprung-Russell diagram (i.e. log (L/L&sun;) vs. log Te), rather than in the conventional colour-magnitude diagram, can provide more precise and accurate cluster ages, with well-defined uncertainties. Results: Well-defined ages are found for all the clusters studied. For the nearby clusters studied, the derived ages are not very sensitive to the small uncertainties in distance, reddening, membership, metallicity, or choice of isochrones. Our age determinations are all within the range of previously determined values, but the associated u...

  7. 14 Ceti: a probable Ap-star-descendant entering the Hertzsprung gap

    Science.gov (United States)

    Aurière, M.; Konstantinova-Antova, R.; Petit, P.; Charbonnel, C.; Van Eck, S.; Donati, J.-F.; Lignières, F.; Roudier, T.

    2012-07-01

    Context. 14 Ceti is a subgiant star of F spectral class that displays variations in the S-index of its Ca ii H & K lines and an X-ray emission that is stronger than the mean observed for its spectral class, which may be due to some magnetic activity. Aims: We attempt to Zeeman-detect and study the magnetic field of 14 Ceti and to infer its origin. Methods: We used the spectropolarimeter Narval at the Telescope Bernard Lyot, Pic du Midi Observatory, and the least squares deconvolution method to create high signal-to-noise ratio Stokes V profiles. We derived the surface-averaged longitudinal magnetic field Bl. We also measured the S-index, and the radial velocity for each observation. Results: 14 Ceti is Zeeman-detected for the 30 observed dates spanning from August 2007 to January 2012. The average longitudinal magnetic field does not reverse its sign, reaches about -35 G, and shows some month-long-timescale variations in our 2008 and 2011-2012 observations. The S-index follows the same long-term trend as Bl. 14 Ceti is confirmed as a single star without H-K emission cores. The strength of the observed surface magnetic field of 14 Ceti is one order of magnitude greater than the observed one for late F main-sequence stars, and is comparable to the values measured in the active late F pre-main-sequence star HR 1817. On the other hand, taking into account the post-main-sequence evolution of an Ap star, an oblique rotator model can explain the strength of the magnetic field of 14 Ceti. The variations with a timescale of months observed for both the Bl and S-index could be due to the rotation. Conclusions: The most probable scenario to explain our observations appears to be that 14 Ceti is the descendant of a cool Ap star. Based on data obtained using the Télescope Bernard Lyot at Observatoire du Pic du Midi, CNRS/INSU and Université de Toulouse, France.

  8. HD 18078: A very slowly rotating Ap star with an unusual magnetic field structure

    Science.gov (United States)

    Mathys, G.; Romanyuk, I. I.; Kudryavtsev, D. O.; Landstreet, J. D.; Pyper, D. M.; Adelman, S. J.

    2016-02-01

    Context. The existence of a significant population of Ap stars with very long rotation periods (up to several hundred years) has progressively emerged over the past two decades. However, only lower limits of the periods are known for most of them because their variations have not yet been observed over a sufficient timebase. Aims: We determine the rotation period of the slowly rotating Ap star HD 18078 and we derive constraints on the geometrical structure of its magnetic field. Methods: We combine measurements of the mean magnetic field modulus obtained from 1990 to 1997 with determinations of the mean longitudinal magnetic field spanning the 1999-2007 time interval to derive an unambiguous value of the rotation period. We show that this value is consistent with photometric variations recorded in the Strömgren uvby photometric system between 1995 and 2004. We fit the variations of the two above-mentioned field moments with a simple model to constrain the magnetic structure. Results: The rotation period of HD 18078 is (1358 ± 12) d. The geometrical structure of its magnetic field is consistent to first order with a colinear multipole model whose axis is offset from the centre of the star. Conclusions: HD 18078 is only the fifth Ap star with a rotation period longer than 1000 d for which the exact value of that period (as opposed to a lower limit) could be determined. The strong anharmonicity of the variations of its mean longitudinal magnetic field and the shift between their extrema and those of the mean magnetic field modulus are exceptional and indicative of a very unusual magnetic structure. Based in part on observations made at Observatoire de Haute Provence (CNRS), France; at Kitt Peak National Observatory, National Optical Astronomy Observatory (NOAO Prop. ID: KP2442; PI: T. Lanz), which is operated by the Association of Universities for Research in Astronomy (AURA) under cooperative agreement with the National Science Foundation; at the Canada

  9. Models of large-scale magnetic fields in stellar interiors. Application to solar and ap stars

    International Nuclear Information System (INIS)

    Stellar astrophysics needs today new models of large-scale magnetic fields, which are observed through spectropolarimetry at the surface of Ap/Bp stars, and thought to be an explanation for the uniform rotation of the solar radiation zone, deduced from helio seismic inversions. During my PhD, I focused on describing the possible magnetic equilibria in stellar interiors. The found configurations are mixed poloidal-toroidal, and minimize the energy for a given helicity, in analogy with Taylor states encountered in spheromaks. Taking into account the self-gravity leads us to the 'non force-free' equilibria family, that will thus influence the stellar structure. I derived all the physical quantities associated with the magnetic field; then I evaluated the perturbations they induce on gravity, thermodynamic quantities as well as energetic ones, for a solar model and an Ap star. 3D MHD simulations allowed me to show that these equilibria form a first stable states family, the generalization of such states remaining an open question. It has been shown that a large-scale magnetic field confined in the solar radiation zone can induce an oblateness comparable to a high core rotation law. I also studied the secular interaction between the magnetic field, the differential rotation and the meridional circulation in the aim of implementing their effects in a next generation stellar evolution code. The influence of the magnetism on convection has also been studied. Finally, hydrodynamic processes responsible for the mixing have been compared with diffusion and a change of convection's efficiency in the case of a CoRoT star target. (author)

  10. The magnetic field topology and chemical abundance distributions of the Ap star HD 32633

    Science.gov (United States)

    Silvester, J.; Kochukhov, O.; Wade, G. A.

    2015-10-01

    Previous observations of the Ap star HD 32633 indicated that its magnetic field was unusually complex in nature and could not be characterized by a simple dipolar structure. Here we derive magnetic field maps and chemical abundance distributions for this star using full Stokes vector (Stokes IQUV) high-resolution observations obtained with the ESPaDOnS and Narval spectropolarimeters. Our maps, produced using the INVERS10 magnetic Doppler imaging (MDI) code, show that HD 32633 has a strong magnetic field which features two large regions of opposite polarity but deviates significantly from a pure dipole field. We use a spherical harmonic expansion to characterize the magnetic field and find that the harmonic energy is predominately in the ℓ = 1 and 2 poloidal modes with a small toroidal component. At the same time, we demonstrate that the observed Stokes parameter profiles of HD 32633 cannot be fully described by either a dipolar or dipolar plus quadrupolar field geometry. We compare the magnetic field topology of HD 32633 with other early-type stars for which MDI analyses have been performed, supporting a trend of increasing field complexity with stellar mass. We then compare the magnetic field topology of HD 32633 with derived chemical abundance maps for the elements Mg, Si, Ti, Cr, Fe, Ni and Nd. We find that the iron-peak elements show similar distributions, but we are unable to find a clear correlation between the location of local chemical enhancements or depletions and the magnetic field structure.

  11. Pulsational line profile variation of the roAp star HR 3831

    CERN Document Server

    Kochukhov, O

    2005-01-01

    We report the first comprehensive investigation of the line profile variation caused by non-radial pulsation in a magnetic oscillating chemically peculiar star. Spectrum variation of the well-known roAp star HR 3831 is detected using very high-resolution high signal-to-noise spectroscopic time-series observations and are followed through the whole rotation cycle of the star. We confirm outstanding diversity of pulsational behaviour of different lines in the HR 3831 spectrum and attribute this phenomenon to an interplay between extreme vertical chemical inhomogeneity of the HR 3831 atmosphere and a running pulsation wave, propagating towards the upper photospheric layers with increasing amplitude. Rapid profile variation of the NdIII 6145 A line is characterized by measuring changes of its equivalent width and the first three moments. We demonstrate that rotational modulation of the radial velocity oscillations cannot be fully explained by an oblique axisymmetric dipole (ell=1, m=0) mode, implied by the classi...

  12. KIC 4768731: a bright long-period roAp star in the Kepler Field

    CERN Document Server

    Smalley, B; Murphy, S J; Lehmann, H; Kurtz, D W; Holdsworth, D L; Cunha, M S; Balona, L A; Briquet, M; Bruntt, H; de Cat, P; Lampens, P; Thygesen, A O; Uytterhoeven, K

    2015-01-01

    We report the identification of 61.45 d^-1 (711.2 mu Hz) oscillations, with amplitudes of 62.6-mu mag, in KIC 4768731 (HD 225914) using Kepler photometry. This relatively bright (V=9.17) chemically peculiar star with spectral type A5 Vp SrCr(Eu) has previously been found to exhibit rotational modulation with a period of 5.21 d. Fourier analysis reveals a simple dipole pulsator with an amplitude that has remained stable over a 4-yr time span, but with a frequency that is variable. Analysis of high-resolution spectra yields stellar parameters of T_eff = 8100 +/- 200 K, log g = 4.0 +/- 0.2, [Fe/H] = +0.31 +/- 0.24 and v sin i = 14.8 +/- 1.6 km/s. Line profile variations caused by rotation are also evident. Lines of Sr, Cr, Eu, Mg and Si are strongest when the star is brightest, while Y and Ba vary in anti-phase with the other elements. The abundances of rare earth elements are only modestly enhanced compared to other roAp stars of similar T_eff and log g. Radial velocities in the literature suggest a significant...

  13. Weak magnetic fields in Ap/Bp stars: Evidence for a dipole field lower limit and a tentative interpretation of the magnetic dichotomy

    OpenAIRE

    Auriere, M.; Wade, G. A.; Silvester, J.; Lignieres, F.; Bagnulo, S.; Bale, K.; Dintrans, B.; Donati, J. F.; Folsom, C. P.; Gruberbauer, M.; Hoa, A. Hui Bon; Jeffers, S.; Johnson, N.; Landstreet, J. D.; Lebre, A.

    2007-01-01

    We have investigated a sample of 28 well-known spectroscopically-identified magnetic Ap/Bp stars, with weak, poorly-determined or previously undetected magnetic fields, with the aim of exploring the weak part of the magnetic field distribution of Ap/Bp stars. Using the MuSiCoS and NARVAL spectropolarimeters we have obtained 282 LSD Stokes V signatures of our 28 sample stars. All stars were detected, showing clearly that when observed with sufficient precision, all firmly classified Ap/Bp star...

  14. The magnetic field topology and chemical abundance distributions of the Ap star HD 32633

    CERN Document Server

    Silvester, J; Wade, G A

    2015-01-01

    Previous observations of the Ap star HD 32633 indicated that its magnetic field was unusually complex in nature and could not be characterised by a simple dipolar structure. Here we derive magnetic field maps and chemical abundance distributions for this star using full Stokes vector (Stokes $IQUV$) high-resolution observations obtained with the ESPaDOnS and Narval spectropolarimeters. Our maps, produced using the Invers10 magnetic Doppler imaging (MDI) code, show that HD 32633 has a strong magnetic field which features two large regions of opposite polarity but deviates significantly from a pure dipole field. We use a spherical harmonic expansion to characterise the magnetic field and find that the harmonic energy is predominately in the $\\ell=1$ and $\\ell=2$ poloidal modes with a small toroidal component. At the same time, we demonstrate that the observed Stokes parameter profiles of HD 32633 cannot be fully described by either a dipolar or dipolar plus quadrupolar field geometry. We compare the magnetic fi...

  15. Stokes IQUV mapping of α2 CVn & other Ap stars using ESPaDOnS and NARVAL

    Science.gov (United States)

    Silvester, J.; Kochukhov, O.; Wade, G. A.

    2013-12-01

    New spectral line polarisation observations of 7 bright Ap stars have been obtained with the ESPaDOnS and Narval high resolution spectropolarimeters (Silvester et al. 2012). The aim of this data set is produce a series of surface magnetic field and surface chemistry maps for these Ap stars. We present new magnetic maps for the Ap star α2 CVn using these new data and the MDI inversion code INVERS10. α2 CVn is the first Ap star to be observed during two separate epochs using high resolution phase resolved spectropolarimetric IQUV observations and as such allows us an insight into how stable the surface magnetic structure is over a decade timescale. We show that the new maps give a magnetic field structure consistent with the previous maps obtained by Kochukhov and Wade (2010) from lower quality MuSiCoS spectra taken a decade ago and that the field topology cannot be described by a dipolar or quadrupolar field.

  16. Stokes IQUV mapping of $\\alpha^2$ CVn & other Ap stars using ESPaDOnS and NARVAL

    CERN Document Server

    Silvester, J; Wade, G A

    2013-01-01

    New spectral line polarisation observations of 7 bright Ap stars have been obtained with the ESPaDOnS and Narval high resolution spectropolarimeters (Silvester et al. 2012). The aim of this data set is produce a series of surface magnetic field and surface chemistry maps for these Ap stars. We present new magnetic maps for the Ap star $\\alpha^2$ CVn using these new data and the MDI inversion code INVERS10. $\\alpha^2$ CVn is the first Ap star to be observed during two separate epochs using high resolution phase resolved spectropolarimetric $IQUV$ observations and as such allows us an insight into how stable the surface magnetic structure is over a decade timescale. We show that the new maps give a magnetic field structure consistent with the previous maps obtained by Kochukhov and Wade (2010) from lower quality MuSiCoS spectra taken a decade ago and that the field topology cannot be described by a dipolar or quadrupolar field.

  17. Chemical stratification in the atmosphere of Ap star HD 133792. Regularized solution of the vertical inversion problem

    CERN Document Server

    Kochukhov, O; Ryabchikova, T A; Makaganyk, V; Bagnulo, S

    2006-01-01

    High spectral resolution studies of cool Ap stars reveal conspicuous anomalies of the shape and strength of many absorption lines. This is a signature of large atmospheric chemical gradients produced by the selective radiative levitation and gravitational settling of chemical species. Here we present a new approach to mapping the vertical chemical structures in stellar atmospheres. We have developed a regularized chemical inversion procedure that uses all information available in high-resolution stellar spectra. The new technique for the first time allowed us to recover chemical profiles without making a priori assumptions about the shape of chemical distributions. We have derived average abundances and applied the vertical inversion procedure to the high-resolution VLT UVES spectra of the weakly magnetic, cool Ap star HD 133792. Our analysis yielded improved estimates of the atmospheric parameters of HD 133792. We show that this star has negligible vsini and the mean magnetic field modulus =1.1+/-0.1 kG. We ...

  18. A dominant magnetic dipole for the evolved Ap star candidate EK Eridani

    CERN Document Server

    Auriere, M; Petit, P; Roudier, T; Donati, J -F; Charbonnel, C; Dintrans, B; Lignieres, F; Wade, G A; Morgenthaler, A; Tsvetkova, S

    2011-01-01

    EK Eri is one of the most slowly rotating active giants known, and has been proposed to be the descendant of a strongly magnetic Ap star. We have performed a spectropolarimetric study of EK Eri over 4 photometric periods with the aim of inferring the topology of its magnetic field. We used the NARVAL spectropolarimeter at the Bernard Lyot telescope at the Pic du Midi Observatory, along with the least-squares deconvolution method, to extract high signal-to-noise ratio Stokes V profiles from a timeseries of 28 polarisation spectra. We have derived the surface-averaged longitudinal magnetic field Bl. We fit the Stokes V profiles with a model of the large-scale magnetic field and obtained Zeeman Doppler images of the surface magnetic strength and geometry. Bl variations of up to about 80 G are observed without any reversal of its sign, and which are in phase with photometric ephemeris. The activity indicators are shown to vary smoothly on a timescale compatible with the rotational period inferred from photometry ...

  19. Periods of magnetic field variations in the Ap star $\\gamma$ Equulei (HD 201601)

    CERN Document Server

    Bychkov, V D; Madej, J

    2015-01-01

    This paper presents a series of 95 new measurements of the longitudinal (effective) magnetic field $B_e$ of the Ap star $\\gamma$ Equ (HD 201601). Observations were obtained at the coud\\'e focus of the 1-m reflector at the Special Astrophysical Observatory (SAO RAS) in Russia over a time period of 4190 days (more than 11 years). We compiled a long record of $B_e$ points, adding our measurements to all published data. The time series of magnetic data consists of 395 $B_e$ points extending for 24488 days, or over 67 years. Various methods of period determination were examined for the case in which the length of the observed time series is rather short and amounts only to ~69 percent of the period. We argue that the fitting of a sine wave to the observed $B_e$ points by least squares yields the most reliable period in the case of $\\gamma$ Equ. Therefore, the best period for long-term magnetic variations of $\\gamma$ Equ, and hence the rotational period, is $P_{\\rm rot}=35462.5 \\pm 1149$ days $= 97.16 \\pm 3.15$ yea...

  20. 1S0 Proton and Neutron Superfluidity in beta-stable Neutron Star Matter

    OpenAIRE

    W. Zuo; Li, Z.H.; Lu, G. C.; Li, J.Q.; Scheid, W.; Lombardo, U.; Schulze, H. -J.; Shen, C.W.

    2004-01-01

    We investigate the effect of a microscopic three-body force on the proton and neutron superfluidity in the $^1S_0$ channel in $\\beta$-stable neutron star matter. It is found that the three-body force has only a small effect on the neutron $^1S_0$ pairing gap, but it suppresses strongly the proton $^1S_0$ superfluidity in $\\beta$-stable neutron star matter.

  1. Ultra weak magnetic fields in Am stars: Beta UMa and theta Leo

    OpenAIRE

    Blazère, Aurore; Petit, Pascal; Lignières, François; Aurière, Michel; Böhm, Torsten; Wade, Gregg

    2014-01-01

    An extremely weak circularly-polarized signature was recently discovered in spectral lines of the chemically peculiar Am star Sirius A (Petit et al. 2011). This signal was interpreted as a Zeeman signature related to a sub-gauss longitudinal magnetic field, constituting the first detection of a surface magnetic field in an Am star. We present here ultra-deep spectropolarimetric observations of two other bright Am stars, $\\beta$ UMa and $\\theta$ Leo, observed with the NARVAL spectropolarimeter...

  2. The Solar Neighborhood. XXVI. AP Col: The Closest (8.4 pc) Pre-Main-Sequence Star

    CERN Document Server

    Riedel, Adric R; Henry, Todd J; Melis, Carl; Jao, Wei-Chun; Subasavage, John P; 10.1088/0004-6256/142/4/104

    2011-01-01

    We present the results of a multi-technique investigation of the M4.5Ve flare star AP Col, which we discover to be the nearest pre-main-sequence star. These include astrometric data from the CTIO 0.9m, from which we derive a proper motion of 342.0+/-0.5 mas yr^-1, a trigonometric parallax of 119.21+/-0.98 mas (8.39+/-0.07 pc), and photometry and photometric variability at optical wavelengths. We also provide spectroscopic data, including radial velocity (22.4+/-0.3 km s^-1), lithium Equivalent Width (EW) (0.28+/-0.02 A), H-alpha EW (-6.0 to -35 A), {\\it vsini} (11+/-1 km s^-1), and gravity indicators from the Siding Spring 2.3-m WiFeS, Lick 3-m Hamilton echelle, and Keck-I HIRES echelle spectrographs. The combined observations demonstrate that AP Col is the closer of only two known systems within 10 pc of the Sun younger than 100 Myr. Given its space motion and apparent age of 12-50 Myr, AP Col is likely a member of the recently proposed ~40 Myr old Argus/IC 2391 association.

  3. Neutrino trapping effects on {beta}-stable neutron star matter

    Energy Technology Data Exchange (ETDEWEB)

    Vidana, I.; Bombaci, I.; Polls, A.; Ramos, A

    2003-05-19

    We investigate in the framework of the Brueckner-Hartree-Fock approximation, the influence of neutrino trapping on the composition, equation of state, and structure of neutron stars immediately after birth. We explore also the consequences of neutrino trapping on the early evolution of a neutron star and on the final remnant left by the supernova explosion.

  4. Ultra weak magnetic fields in Am stars: Beta UMa and theta Leo

    CERN Document Server

    Blazère, Aurore; Lignières, François; Aurière, Michel; Böhm, Torsten; Wade, Gregg

    2014-01-01

    An extremely weak circularly-polarized signature was recently discovered in spectral lines of the chemically peculiar Am star Sirius A (Petit et al. 2011). This signal was interpreted as a Zeeman signature related to a sub-gauss longitudinal magnetic field, constituting the first detection of a surface magnetic field in an Am star. We present here ultra-deep spectropolarimetric observations of two other bright Am stars, $\\beta$ UMa and $\\theta$ Leo, observed with the NARVAL spectropolarimeter. The line profiles of the two stars display circularly-polarized signatures similar in shape to the observations gathered for Sirius A. These new detections suggest that very weak magnetic fields may be present in the photospheres of a significant fraction of intermediate-mass stars, although the strongly asymmetric Zeeman signatures measured so far in Am stars (featuring a prominent positive lobe and no detected negative lobe) are not expected in the standard theory of the Zeeman effect.

  5. On the consistency of magnetic field measurements of Ap stars: lessons learned from the FORS1 archive

    CERN Document Server

    Landstreet, J D; Fossati, L

    2014-01-01

    CONTEXT. The ESO archive of FORS1 spectropolarimetric observations may be used to create a homogeneous database of magnetic field measurements. However, no systematic comparison of FORS field measurements to those obtained with other instruments has been undertaken so far. AIMS. We exploit the FORS archive of circular spectropolarimetric data to examine in a general way how reliable and accurate field detections obtained with FORS are. METHODS. We examine the observations of Ap and Bp stars, on the grounds that almost all of the unambiguous detections of magnetic fields in the FORS1 archive are in these kinds of stars. We assess the overall quality of the FORS1 magnetic data by examining the consistency of field detections with what is known from previous measurements obtained with other instruments, and we look at patterns of internal consistency. RESULTS. FORS1 magnetic measurements are fully consistent with those made with other instruments, and the internal consistency of the data is excellent. However, i...

  6. Detection of ultra-weak magnetic fields in Am stars: beta UMa and theta Leo

    OpenAIRE

    Blazère, A.; Petit, P.; Lignières, F.; Aurière, M.; Ballot, J.; Böhm, T.; Folsom, C. P.; Gaurat, M.; Jouve, L.; Ariste, A. Lopez; Neiner, C.; Wade, G. A.

    2016-01-01

    An extremely weak circularly polarized signature was recently discovered in spectral lines of the chemically peculiar Am star Sirius A. A weak surface magnetic field was proposed to account for the observed polarized signal, but the shape of the phase-averaged signature, dominated by a prominent positive lobe, is not expected in the standard theory of the Zeeman effect. We aim at verifying the presence of weak circularly polarized signatures in two other bright Am stars, beta UMa and theta Le...

  7. Discovery of secular variations in the atmospheric abundances of magnetic Ap stars

    CERN Document Server

    Bailey, J D; Bagnulo, S

    2013-01-01

    The stars of the middle main sequence have relatively quiescent outer layers, and unusual chemical abundance patterns may develop in their atmospheres. The presence of chemical peculiarities reveal the action of such subsurface phenomena as gravitational settling and radiatively driven levitation of trace elements, and their competition with mixing processes such as turbulent diffusion. We want to establish whether abundance peculiarities change as stars evolve on the main sequence, and provide observational constraints to diffusion theory. We have performed spectral analysis of 15 magnetic Bp stars that are members of open clusters (and thus have well-known ages), with masses between about 3 and 4 M_sun. For each star, we measured the abundances of He, O, Mg, Si, Ti, Cr, Fe, Pr and Nd. We have discovered the systematic time evolution of trace elements through the main-sequence lifetime of magnetic chemically peculiar stars as their atmospheres cool and evolve toward lower gravity. During the main sequence li...

  8. Weak magnetic fields in Ap/Bp stars: Evidence for a dipole field lower limit and a tentative interpretation of the magnetic dichotomy

    CERN Document Server

    Aurière, M; Silvester, J; Lignières, F; Bagnulo, S; Bale, K; Dintrans, B; Donati, J F; Folsom, C P; Gruberbauer, M; Hoa, A Hui Bon; Jeffers, S; Johnson, N; Landstreet, J D; Lebre, A; Lüftinger, T; Marsden, S; Mouillet, D; Naseri, S; Paletou, F; Petit, P; Power, J; Rincon, F; Strasser, S; Toque, N

    2007-01-01

    We have investigated a sample of 28 well-known spectroscopically-identified magnetic Ap/Bp stars, with weak, poorly-determined or previously undetected magnetic fields, with the aim of exploring the weak part of the magnetic field distribution of Ap/Bp stars. Using the MuSiCoS and NARVAL spectropolarimeters we have obtained 282 LSD Stokes V signatures of our 28 sample stars. All stars were detected, showing clearly that when observed with sufficient precision, all firmly classified Ap/Bp stars show detectable surface magnetic fields. To better characterise the surface magnetic field intensities and geometries of the sample, we have inferred the dipolar field intensity and the magnetic obliquity. The distribution of derived dipole strengths for these stars exhibits a plateau at about 1 kG, falling off to larger and smaller field strengths. Remarkably, in this sample of stars selected for their presumably weak magnetic fields, we find only 2 stars for which the derived dipole strength is weaker than 300 G. We i...

  9. Validation study of the BetaStar plus lateral flow assay for detection of beta-lactam antibiotics in milk.

    Science.gov (United States)

    Abouzied, Mohamed; Driksna, Dana; Walsh, Coilin; Sarzynski, Michael; Walsh, Aaron; Ankrapp, David; Klein, Frank; Rice, Jennifer; Mozola, Mark

    2012-01-01

    A validation study designed to meet the requirements of the AOAC Research Institute and the U.S. Food and Drug Administration, Center for Veterinary Medicine (FDA/CVM) was conducted for a receptor and antibody-based, immunochromatographic method (BetaStar Plus) for detection of beta-lactam antibiotic residues in raw, commingled bovine milk. The assay was found to detect amoxicillin, ampicillin, ceftiofur, cephapirin, cloxacillin, and penicillin G at levels below the FDA tolerance/safe levels, but above the maximum sensitivity thresholds established by the National Conference on Interstate Milk Shipments (NCIMS). Results of the part I (internal) and part II (independent laboratory) dose-response studies employing spiked samples were in close agreement. The test was able to detect all six drugs at the approximate 90/95% sensitivity levels when presented as incurred residues in milk collected from cows that had been treated with the specific drug. Selectivity of the assay was 100%, as no false-positive results were obtained in testing of 1031 control milk samples. Results of ruggedness experiments established the operating parameter tolerances for the BetaStar Plus assay. Results of cross-reactivity testing established that the assay detects certain other beta-lactam drugs (dicloxacillin and ticarcillin), but it does not cross-react with any of 30 drugs belonging to other classes. Abnormally high bacterial or somatic cell counts in raw milk produced no interference with the ability of the test to detect beta-lactams at tolerance/safe levels. PMID:22970593

  10. Discovery of Secular Evolution of the Atmospheric Abundances of Ap Stars

    Science.gov (United States)

    Bailey, J. D.; Landstreet, J. D.; Bagnulo, S.

    2015-01-01

    The stars of the middle main-sequence have relatively quiescent outer layers, and unusual chemical abundance patterns may develop in their atmospheres, revealing the action of such subsurface phenomena as gravitational settling and radiatively driven levitation of trace elements, and their competition with mixing processes such as turbulent diffusion. We report the discovery of the time evolution of such chemical tracers through the main-sequence lifetime of magnetic chemically peculiar stars.

  11. The Nainital–Cape Survey: A Search for Variability in Ap and Am Stars

    Indian Academy of Sciences (India)

    Santosh Joshi

    2005-06-01

    The ``Nainital–Cape Survey” program for searching photometric variability in chemically peculiar (CP) stars was initiated in 1997 at ARIES, Nainital. We present here the results obtained to date. The Am stars HD 98851, HD 102480, HD 13079 and HD 113878 were discovered to exhibit Scuti type variability. Photometric variability was also discovered in HD 13038, for which the type of peculiarity and variability is not fully explained. The null results of this survey are also presented and discussed.

  12. Stokes IQUV magnetic Doppler imaging of Ap stars - III. Next generation chemical abundance mapping of α2 CVn

    Science.gov (United States)

    Silvester, J.; Kochukhov, O.; Wade, G. A.

    2014-10-01

    In a previous paper, we presented an updated magnetic field map for the chemically peculiar star α2 CVn using ESPaDOnS and Narval time-resolved high-resolution Stokes IQUV spectra. In this paper, we focus on mapping various chemical element distributions on the surface of α2 CVn. With the new magnetic field map and new chemical abundance distributions, we can investigate the interplay between the chemical abundance structures and the magnetic field topology on the surface of α2 CVn. Previous attempts at chemical abundance mapping of α2 CVn relied on lower resolution data. With our high-resolution (R = 65 000) data set, we present nine chemical abundance maps for the elements O, Si, Cl, Ti, Cr, Fe, Pr, Nd and Eu. We also derive an updated magnetic field map from Fe and Cr lines in Stokes IQUV and O and Cl in Stokes IV. These new maps are inferred from line profiles in Stokes IV using the magnetic Doppler imaging code INVERS10. We examine these new chemical maps and investigate correlations with the magnetic topology of α2 CVn. We show that chemical abundance distributions vary between elements, with two distinct groups of elements; one accumulates close to the negative part of the radial field, whilst the other group shows higher abundances located where the radial magnetic field is of the order of 2 kG regardless of the polarity of the radial field component. We compare our results with previous works which have mapped chemical abundance structures of Ap stars. With the exception of Cr and Fe, we find no clear trend between what we reconstruct and other mapping results. We also find a lack of agreement with theoretical predictions. This suggests that there is a gap in our theoretical understanding of the formation of horizontal chemical abundance structures and the connection to the magnetic field in Ap stars.

  13. Periodic Radio Continuum Emission Associated with the beta Cephei Star V2187 Cyg

    CERN Document Server

    Tapia, Mauricio; Tovmassian, Gagik; Rodriguez-Gomez, Vicente; Gonzalez-Buitrago, Diego; Zharikov, Sergei; Ortiz-Leon, Gisela N

    2014-01-01

    We present new optical time-resolved photometry and medium-resolution spectroscopy of V2187 Cyg. We confirm its classification as a beta Cephei star based on sinusoidal light variations with a period of 0.2539 days and mean amplitudes of 0.037 and 0.042 magnitudes in "i" and "V", respectively. We classified the spectrum of this star B2-3V with no evidence of variations in the profiles of its absorption lines in timescales of hours or days. The stellar spectrum is totally absent of emission lines. We detected unexpected faint radio continuum emission (between 0.4 and 0.8 mJy at 6-cm) showing a sinusoidal variation with a period of 12.8 days. The radio spectrum is thermal. We searched in the Very Large Array archive for radio continuum emission toward other 15 beta Cephei stars. None of these additional stars, some of them much closer to the Sun than V2187 Cyg, was detected, indicating that radio emission is extremely uncommon toward beta Cephei stars.

  14. Associations of a polymorphic AP-2 binding site in the 5'-flanking region of the bovine beta-lactoglobulin gene with milk proteins.

    Science.gov (United States)

    Kuss, A W; Gogol, J; Geidermann, H

    2003-06-01

    Studies on a polymorphic position (R10) in an Activator-Protein-2 (AP-2) binding site of the bovine beta-Lactoglobulin (beta-Lg) gene promoter region and quantitative traits of individual milk proteins were based on material from 79 German Holstein Friesian (HF) and 61 Simmental (Sm) cows. At least four milk samples per cow were analyzed with alkaline Urea-PAGE in combination with densitometry for quantification of individual milk proteins. The two alleles of the R10 single nucleotide polymorphism (SNP) carry either G or C in position -435 bp of the beta-Lg promoter region. G- and C-alleles were found in Sm with nearly equal frequencies, while in HF the C-allele frequency was higher (0.73) than that of the G-allele. In both breeds, the R10 G-homozygotes had higher (P beta-Lg secreted per day and proportion of beta-Lg in milk protein compared with the C-homozygotes. A similar association was found for alpha-lactalbumin, whereas the relative proportions and daily secreted amounts of caseins (alphaS1, beta, kappa) showed lower values in beta-Lg R10 G-homozygotes. A positive association (P beta-Lg locus to a candidate gene for this trait. The association between the SNP in the AP-2 binding site of the beta-Lg gene and its gene product can be explained as the result of differences in protein binding activity, and, therefore, allele specific differences in gene expression. Thus, our study clearly links a DNA polymorphism of molecular function very closely with in vivo expression parameters of the same locus.

  15. HD 41641: a classical $\\delta$ Sct-type pulsator with chemical signatures of an Ap star

    CERN Document Server

    Escorza, A; Tkachenko, A; Van Reeth, T; Ryabchikova, T; Neiner, C; Poretti, E; Rainer, M; Michel, E; Baglin, A; Aerts, C

    2016-01-01

    Among the known groups of pulsating stars, $\\delta$ Sct stars are one of the least understood. The theoretical models do not predict the oscillation frequencies that observations reveal. Complete asteroseismic studies are necessary to improve these models and better understand the internal structure of these targets. In this paper, we study the $\\delta$ Sct star HD 41641 with the ultimate goal of understanding its oscillation pattern. The target has been simultaneously observed by the CoRoT space telescope and the HARPS high-resolution spectrograph. The photometric data set was analyzed with the software package PERIOD04, while FAMIAS was used to analyze the line profile variations. The method of spectrum synthesis was used for spectroscopically determining the fundamental atmospheric parameters and the individual chemical abundances. A total of 90 different frequencies was identified and analyzed. An unambiguous identification of the azimuthal order of the surface geometry could be provided for the dominant ...

  16. On the incidence of magnetic fields in slowly-pulsating B, Beta Cephei and B-type emission line stars

    OpenAIRE

    Silvester, J.; Neiner, C.; Henrichs, H. F.; Wade, G. A.; Petit, V.; Alecian, E.; Huat, A. -L.; Martayan, C.; Power, J.; Thizy, O.

    2009-01-01

    We have obtained 40 high-resolution circular spectropolarimetric measurements of 12 slowly-pulsating B (SPB) stars, 8 Beta Cephei stars and two Be stars with the ESPaDOnS and NARVAL spectropolarimeters. The aim of these observations is to evaluate recent claims of a high incidence of magnetic field detections in stars of these types obtained using low-resolution spectropolarimetry by Hubrig (2006), Hubrig (2007) and Hubrig (2009). The precision achieved is generally comparable to or superior ...

  17. Discovery of secular variations in the atmospheric abundances of magnetic Ap stars

    Science.gov (United States)

    Bailey, J. D.; Landstreet, J. D.; Bagnulo, S.

    2014-01-01

    Context. The stars of the middle main sequence have relatively quiescent outer layers, and unusual chemical abundance patterns may develop in their atmospheres. The presence of chemical peculiarities reveal the action of such subsurface phenomena as gravitational settling and radiatively driven levitation of trace elements, and their competition with mixing processes such as turbulent diffusion. At present, little is known about the time evolution of these anomalous abundances, nor about the role that diffusion may play in maintaining them, during the main sequence lifetime of such a star. Aims: We want to establish whether abundance peculiarities change as stars evolve on the main sequence, and provide observational constraints to diffusion theory. Methods: We have performed spectral analysis of 15 magnetic Bp stars that are members of open clusters (and thus have well-known ages), with masses between about 3 and 4 M⊙. For each star, we measured the abundances of He, O, Mg, Si, Ti, Cr, Fe, Pr and Nd. Results: We have discovered the systematic time evolution of trace elements through the main-sequence lifetime of magnetic chemically peculiar stars as their atmospheres cool and evolve towards lower gravity. During the main sequence lifetime, we observe clear and systematic variations in the atmospheric abundances of He, Ti, Cr, Fe, Pr and Nd. For all these elements, except He, the atmospheric abundances decrease with age. The abundances of Fe-peak elements converge towards solar values, while the rare-earth elements converge towards values at least 100 times more abundant than in the Sun. Helium is always underabundant compared to the Sun, evolving from about 1% up to 10% of the solar He abundance. We have attempted to interpret the observed abundance variations in the context of radiatively driven diffusion theory, which appears to provide a framework to understand some, but not all, of the anomalous abundance levels and variations that we observe. Based in part

  18. Stability of the $\\beta$-equilibrated dense matter and core-crust transition in neutron stars

    CERN Document Server

    Atta, Debasis

    2014-01-01

    The stability of the $\\beta$-equilibrated dense nuclear matter is analyzed with respect to the thermodynamic stability conditions. Based on the density dependent M3Y effective nucleon-nucleon interaction, the effects of the symmetry energy is investigated on the proton fraction in neutron stars and the location of the inner edge of their crusts and core-crust transition density and pressure. The high-density behavior of symmetric and asymmetric nuclear matter satisfies the constraints from the observed flow data of heavy-ion collisions. The neutron star properties studied using $\\beta$-equilibrated neutron star matter obtained from this effective interaction for a pure hadronic model agree with the recent observations of the massive compact stars. The density, pressure and proton fraction at the inner edge separating the liquid core from the solid crust of neutron stars are determined to be $\\rho_t$=0.094 fm$^{-3}$, P$_t$= 0.5037 MeV fm$^{-3}$ and x$_{p(t)}$=0.0309, respectively.

  19. EK Eridani: the tip of the iceberg of giants which have evolved from magnetic Ap stars

    CERN Document Server

    Aurière, M; Petit, P; Charbonnel, C; Dintrans, B; Lignières, F; Roudier, T; Alecian, E; Donati, J F; Landstreet, J D; Wade, G A

    2008-01-01

    We observe the slowly-rotating, active, single giant, EK Eri, to study and infer the nature of its magnetic field directly. We used the spectropolarimeter NARVAL at the Telescope Bernard Lyot, Pic du Midi Observatory, and the Least Square Deconvolution method to create high signal-to-noise ratio Stokes V profiles. We fitted the Stokes V profiles with a model of the large-scale magnetic field. We studied the classical activity indicators, the CaII H and K lines, the CaII infrared triplet, and H\\alpha line. We detected the Stokes V signal of EK Eri securely and measured the longitudinal magnetic field Bl for seven individual dates spanning 60% of the rotational period. The measured longitudinal magnetic field of EK Eri reached about 100 G and was as strong as fields observed in RSCVn or FK Com type stars: this was found to be extraordinary when compared with the weak fields observed at the surfaces of slowly-rotating MS stars or any single red giant previously observed with NARVAL. From our modeling, we infer t...

  20. Using Beta Cen to Probe the Photosphere-Wind Connection to B Stars

    Science.gov (United States)

    MacFarlane, Joseph J.

    2005-01-01

    The goal of the project was to probe the connection between the photospheric pulsations and the X-ray production in the stellar winds of B stars. The B1 III star Beta Centauri is a Beta Cephei variable with a high X-ray count rate, and was observed by XMM. Analysis of XMM X-ray spectra showed characteristic plasma temperatures of 0.1, 0.2 and 0.6 keV. Analysis of He-like forbidden-to-intercombination lines was performed to determine the dominant locations of the X-ray emission. At Prism, work focused on developing and upgrading spectral models to calculate forbidden-to-intercombination line ratios using more detailed atomic models than the simple models typically used in the analysis of X-ray spectral lines, thereby allowing us to assess the effects of a broader variety of populating and depopulating channels for energy levels contributing to the observed X-ray line emission. Based on Ne IX lines, the source location was determined to be no farther than 4 stellar radii. Examination of the time variability of the XMM data for Beta Cen showed no significant correlation with the known optical pulsation period for the star, and also did not find any significant periods of variation at X-ray wavelengths.

  1. Asteroseismology of the Beta Cephei star Nu Eridani: photometric observations and pulsational frequency analysis

    CERN Document Server

    Handler, G; Jerzykiewicz, M; Krisciunas, K; Tshenye, T; Rodríguez, E; Costa, V; Zhou, A Y; Medupe, R; Phorah, W M; Garrido, R; Amado, P J; Paparo, M; Zsuffa, D; Ramokgali, L; Crowe, R; Purves, N; Avila, R; Knight, R; Brassfield, E; Kilmartin, P M; Cottrell, P L

    2004-01-01

    We undertook a multisite photometric campaign for the Beta Cephei star Nu Eridani. More than 600 hours of differential photoelectric uvyV photometry were obtained with 11 telescopes during 148 clear nights. The frequency analysis of our measurements shows that the variability of Nu Eri can be decomposed into 23 sinusoidal components, eight of which correspond to independent pulsation frequencies between 5 - 8 c/d. Some of these are arranged in multiplets, which suggests rotational m-mode splitting of nonradial pulsation modes as the cause. If so, the rotation period of the star must be between 30 - 60 d. One of the signals in the light curves of Nu Eri has a very low frequency of 0.432 c/d. It can be a high-order combination frequency or, more likely, an independent pulsation mode. In the latter case Nu Eri would be both a Beta Cephei star and a slowly pulsating B (SPB) star. The photometric amplitudes of the individual pulsation modes of Nu Eri appear to have increased by about 20 per cent over the last 40 y...

  2. A line-profile analysis of the large-amplitude beta Cephei star xi1 Canis Majoris

    NARCIS (Netherlands)

    Saesen, S.; Briquet, M.; Aerts, C.C.

    2006-01-01

    We present a detailed line-profile study of the beta Cephei star xi1 Canis Majoris, for which we have assembled numerous high-resolution spectra over a period of 4.5 years. It is the first time that the line-profile variations of this star have been analysed. We focused on the Si III line profiles c

  3. 14 Ceti: A probable Ap-star-descendant entering the Hertzsprung gap

    CERN Document Server

    Auriere, M; Petit, P; Charbonnel, C; Van Eck, S; Donati, J -F; Lignieres, F; Roudier, T

    2012-01-01

    14 Ceti is a subgiant star of F spectral class that displays variations in the S-index of its CaII H & K lines and an X-ray emission that is stronger than the mean observed for its spectral class, which may be due to some magnetic activity. We attempt to Zeeman-detect and study the magnetic field of 14 Ceti and to infer its origin. We used the spectropolarimeter Narval at the Telescope Bernard Lyot, Pic du Midi Observatory, and the least squares deconvolution method to create high signal-to-noise ratio Stokes V profiles. We derived the surface-averaged longitudinal magnetic field Bl. We also measured the S-index, and the radial velocity for each observation. 14 Ceti is Zeeman-detected for the 30 observed dates spanning from August 2007 to January 2012. The average longitudinal magnetic field does not reverse its sign, reaches about -35 G, and shows some month-long-timescale variations in our 2008 and 2011-2012 observations. The S-index follows the same long-term trend as Bl. 14 Ceti is confirmed as a sing...

  4. Saccharomyces cerevisiae Apl2p, a homologue of the mammalian clathrin AP beta subunit, plays a role in clathrin-dependent Golgi functions.

    Science.gov (United States)

    Rad, M R; Phan, H L; Kirchrath, L; Tan, P K; Kirchhausen, T; Hollenberg, C P; Payne, G S

    1995-04-01

    Clathrin-coated vesicles mediate selective intracellular protein traffic from the plasma membrane and the trans-Golgi network. At these sites, clathrin-associated protein (AP) complexes have been implicated in both clathrin coat assembly and collection of cargo into nascent vesicles. We have found a gene on yeast chromosome XI that encodes a homologue of the mammalian AP beta subunits. Disruptions of this gene, APl2, and a previously identified beta homologue, APl1, have been engineered in cells expressing wild-type (CHC1) or temperature sensitive (chc1-ts) alleles of the clathrin heavy chain gene. APl1 or APl2 disruptions (apl1 delta or apl2 delta) yield no discernable phenotypes in CHC1 strains, indicating that the Apl proteins are not essential for clathrin function. However, the apl2 delta, but not the apl1 delta, allele enhances the growth and alpha-factor pheromone maturation defects of chc1-ts cells. Disruption of APl2 also partially suppresses the vacuolar sorting defect that occurs in chc1-ts cells immediately after imposition of the non-permissive temperature. These Golgi-specific effects of apl2 delta in chc1-ts cells provide evidence that Apl2p is a component of an AP complex that interacts with clathrin at the Golgi apparatus. PMID:7615679

  5. Stokes IQUV magnetic Doppler imaging of Ap stars - II. Next generation magnetic Doppler imaging of α2 CVn

    Science.gov (United States)

    Silvester, J.; Kochukhov, O.; Wade, G. A.

    2014-05-01

    We present updated magnetic field maps of the chemically peculiar B9p star α2 CVn created using a series of time-resolved observations obtained using the high-resolution spectropolarimeters ESPaDOnS and Narval. We compare these new magnetic field maps with the original magnetic Doppler imaging maps based on spectra recorded with the MuSiCoS spectropolarimeter and taken a decade earlier. These new maps are inferred from line profiles in all four Stokes parameters using the magnetic Doppler imaging code INVERS10. With the addition of new lines exhibiting Stokes IQUV signatures, we have a unique insight into how the derived magnetic surface structure may be affected by the atomic lines chosen for inversion. We report new magnetic maps of α2 CVn created using strong iron lines (directly comparable to the published MuSiCoS maps), weak iron lines and chromium lines, all of which yield a magnetic field structure roughly consistent with that obtained previously. We then derive an updated magnetic structure map for α2 CVn based on the complete sample of Fe and Cr lines, which we believe to produce a more representative model of the magnetic topology of α2 CVn. In agreement with the previous mapping, this new updated magnetic map shows a dipolar-like field which has complex sub-structure which cannot be explained by a simple low-order multipolar geometry. Our new maps show that regardless of the atomic line or species choice, the reconstructed magnetic field is consistent with that published previously, suggesting that the reconstructed field is a realistic representation of the magnetic field of α2 CVn. α2 CVn is the first Ap star for which multiple, high-resolution magnetic maps have been derived, providing important observational evidence for the stability of both the large- and small-scale magnetic field.

  6. Detection of ultra-weak magnetic fields in Am stars: beta UMa and theta Leo

    CERN Document Server

    Blazère, A; Lignières, F; Aurière, M; ballot, J; Böhm, T; Folsom, C P; Gaurat, M; Jouve, L; Ariste, A Lopez; Neiner, C; Wade, G A

    2016-01-01

    An extremely weak circularly polarized signature was recently discovered in spectral lines of the chemically peculiar Am star Sirius A. A weak surface magnetic field was proposed to account for the observed polarized signal, but the shape of the phase-averaged signature, dominated by a prominent positive lobe, is not expected in the standard theory of the Zeeman effect. We aim at verifying the presence of weak circularly polarized signatures in two other bright Am stars, beta UMa and theta Leo, and investigating the physical origin of Sirius-like polarized signals further. We present here a set of deep spectropolarimetric observations of beta UMa and theta Leo, observed with the NARVAL spectropolarimeter. We analyzed all spectra with the Least Squares Deconvolution multiline procedure. To improve the signal-to-noise ratio and detect extremely weak signatures in Stokes V profiles, we co-added all available spectra of each star (around 150 observations each time). Finally, we ran several tests to evaluate wheth...

  7. Abundance of nine beta Cephei stars (Morel+, 2006) g spectroscopy with Ta/Al DROIDs: performance for different geometries

    NARCIS (Netherlands)

    Morel, T.; Butler, K.; Aerts, C.C.; Neiner, C.; Briquet, M.; Hijmering, R.A.; Jerjen, I.; Verhoeve, P.; Martin, D.D.E.; Peacock, A.; Kozorezov, A.G.; Venn, R.

    2006-01-01

    The equivalent widths (EWs) were measured on high-resolution spectra obtained with various echelle spectrographs (see Table 2 of paper for further details). Our EWs are systematically larger than the values quoted by Gies & Lambert (1992ApJ...387..673G) for the seven stars in common, but a similar t

  8. Star formation triggered by SN explosions: an application to the stellar association of $\\beta$ Pictoris

    CERN Document Server

    Melioli, C; De la Reza, R; Raga, A

    2006-01-01

    In the present study, considering the physical conditions that are relevant in interactions between supernova remnants (SNRs) and dense molecular clouds for triggering star formation we have built a diagram of SNR radius versus cloud density in which the constraints above delineate a shaded zone where star formation is allowed. We have also performed fully 3-D radiatively cooling numerical simulations of the impact between SNRs and clouds under different initial conditions in order to follow the initial steps of these interactions. We determine the conditions that may lead either to cloud collapse and star formation or to complete cloud destruction and find that the numerical results are consistent with those of the SNR-cloud density diagram. Finally, we have applied the results above to the $\\beta-$Pictoris stellar association which is composed of low mass Post-T Tauri stars with an age of 11 Myr. It has been recently suggested that its formation could have been triggered by the shock wave produced by a SN e...

  9. CMOS APS 器件及其在星敏感器中的应用%Application of CMOS APS in Star Tracker

    Institute of Scientific and Technical Information of China (English)

    李杰; 刘金国; 刘亚侠; 郝志航

    2004-01-01

    介绍了CMOS有源像元图像传感器(APS)的原理与结构特点,阐述了CMOS APS与CCD比较应用于星敏感器的潜在优势,详细介绍了CMOS图像传感器在星敏感器中的应用现状,并对基于CMOS APS与基于CCD的星敏感器的测量精度结果进行对比,展望了CMOS APS星敏感器的发展前景.

  10. On the incidence of magnetic fields in slowly-pulsating B, Beta Cephei and B-type emission line stars

    CERN Document Server

    Silvester, J; Henrichs, H F; Wade, G A; Petit, V; Alecian, E; Huat, A -L; Martayan, C; Power, J; Thizy, O

    2009-01-01

    We have obtained 40 high-resolution circular spectropolarimetric measurements of 12 slowly-pulsating B (SPB) stars, 8 Beta Cephei stars and two Be stars with the ESPaDOnS and NARVAL spectropolarimeters. The aim of these observations is to evaluate recent claims of a high incidence of magnetic field detections in stars of these types obtained using low-resolution spectropolarimetry by Hubrig (2006), Hubrig (2007) and Hubrig (2009). The precision achieved is generally comparable to or superior to that obtained by Hubrig et al., although our new observations are distinguished by their resolution of metallic and He line profiles, and their consequent sensitivity to magnetic fields of zero net longitudinal component. In the SPB stars we confirm the detection of magnetic field in one star (16 Peg), but find no evidence of the presence of fields in the remaining 11. In the Beta Cep stars, we detect a field in xi^1 CMa, but not in any of the remaining 7 stars. Finally, neither of the two B-type emission line stars sh...

  11. uvby(-$\\beta$) photometry of high-velocity and metal-poor stars X. Stars of very low metal abundance: observations, reddenings, metallicities, classifications, distances, and relative ages

    CERN Document Server

    Schuster, W J; Michel, R; Nissen, P E; García, G

    2004-01-01

    uvby(--$\\beta$) photometry has been obtained for an additional 411 very metal-poor stars selected from the HK survey, and used to derive basic parameters such as interstellar reddenings, metallicities, photometric classifications, distances, and relative ages... These very metal-poor stars are compared to M92 in the c_0,(b-y)_0 diagram, and evidence is seen for field stars 1-3 Gyrs younger than this globular cluster. The significance of these younger very metal-poor stars is discussed in the context of Galactic evolution, mentioning such possibilities as hierarchical star-formation/mass-infall of very metal-poor material and/or accretion events whereby this material has been acquired from other (dwarf) galaxies with different formation and chemical-enrichment histories

  12. Discovery of a brown dwarf companion to the A3V star \\beta{} Circini

    CERN Document Server

    Smith, L C; Peña, C Contreras; Kurtev, R; Marocco, F; Jones, H R A; Beamin, J C; Napiwotzki, R; Borissova, J; Burningham, B; Faherty, J; Pinfield, D J; Gromadzki, M; Ivanov, V D; Minniti, D; Stimson, W; Villanueva, V

    2015-01-01

    We report the discovery of an L dwarf companion to the A3V star \\beta{} Circini. VVV J151721.49-585131.5, or \\beta{} Cir B, was identified in a proper motion and parallax catalogue of the Vista Variables in the V\\'{i}a L\\'{a}ctea survey as having near infrared luminosity and colour indicative of an early L dwarf, and a proper motion and parallax consistent with that of \\beta{} Cir. The projected separation of $\\sim$3.6' corresponds to $6656$ au, which is unusually wide. The most recent published estimate of the age of the primary combined with our own estimate based on newer isochrones yields an age of $370-500$ Myr. The system therefore serves as a useful benchmark at an age greater than that of the Pleiades brown dwarfs and most other young L dwarf benchmarks. We have obtained a medium resolution echelle spectrum of the companion which indicates a spectral type of L1.0$\\pm$0.5 and lacks the typical signatures of low surface gravity seen in younger brown dwarfs. This suggests that signs of low surface gravit...

  13. Using Beta Cen to Probe the Photosphere-wind Connection in B Stars

    Science.gov (United States)

    Miller, Nathan A.

    2005-01-01

    In this project we began by identifying the large number of emission lines visible in the XMM-Newton RGS spectra of Beta Cen. A comprehensive analysis of the temperature structure of the hot gas was carried out by simultaneously fitting the data from all the instruments on the spacecraft. This resulted in a measured temperature range of 0.1-0.6 keV. In more detailed analysis, three characteristic plasma temperatures were found: 0.1, 0.2, and 0.6 keV. The research carried out at UW-Eau Claire primarily focused on two aspects of the data: the analysis of the forbidden line to intercombination line ratio for He-like ions and the time variability of the overall X-ray flux as detected in the direct X-ray images of the star. The analysis of the lines from He-like ions indicate that the Ne IX lines are formed no farther than about 4 stellar radii from the star's photosphere, while the N VI lines are formed within 11 stellar radii of the photosphere. X-ray flux variability would be particularly interesting for this star because it is a known Beta Cep-type variable as seen in optical light: similar variation in the X-ray region would forge an interesting link between the two wavebands. Initial analysis of the X-ray flux was complicated by spikes in the count rates early in the observation. Detailed analysis of the spectral characteristics these count rate anomalies indicated that these flares were probably not intrinsic to the star, rather they were contaminations of the data due to the passage of the satellite through soft proton clouds in the Earth's magnetosphere. An analysis of the light curve of the uncontaminated portions of the light curve did not reveal any variation on the known optical period of variation for this star, and a general search for periodic variability also did not find any significant periods of variation.

  14. Spitzer/MIPS Observations of Stars in the Beta Pictoris Moving Group

    CERN Document Server

    Rebull, L M; Werner, M W; Mannings, V G; Chen, C; Stauffer, J R; Smith, P S; Song, I; Hines, D; Low, F J

    2008-01-01

    We present Multiband Imaging Photometer for Spitzer (MIPS) observations at 24 and 70 microns for 30 stars, and at 160 microns for a subset of 12 stars, in the nearby (~30 pc), young (~12 Myr) Beta Pictoris Moving Group (BPMG). In several cases, the new MIPS measurements resolve source confusion and background contamination issues in the IRAS data for this sample. We find that 7 members have 24 micron excesses, implying a debris disk fraction of 23%, and that at least 11 have 70 micron excesses (disk fraction of >=37%). Five disks are detected at 160 microns (out of a biased sample of 12 stars observed), with a range of 160/70 flux ratios. The disk fraction at 24 and 70 microns, and the size of the excesses measured at each wavelength, are both consistent with an "inside-out" infrared excess decrease with time, wherein the shorter-wavelength excesses disappear before longer-wavelength excesses, and consistent with the overall decrease of infrared excess frequency with stellar age, as seen in Spitzer studies of...

  15. Evolution of Intermediate-mass X-Ray Binaries Driven by the Magnetic Braking of AP/BP Stars. I. Ultracompact X-Ray Binaries

    Science.gov (United States)

    Chen, Wen-Cong; Podsiadlowski, Philipp

    2016-10-01

    It is generally believed that ultracompact X-ray binaries (UCXBs) evolved from binaries consisting of a neutron star accreting from a low-mass white dwarf (WD) or helium star where mass transfer is driven by gravitational radiation. However, the standard WD evolutionary channel cannot produce the relatively long-period (40–60 minutes) UCXBs with a high time-averaged mass-transfer rate. In this work, we explore an alternative evolutionary route toward UCXBs, where the companions evolve from intermediate-mass Ap/Bp stars with an anomalously strong magnetic field (100–10,000 G). Including the magnetic braking caused by the coupling between the magnetic field and an irradiation-driven wind induced by the X-ray flux from the accreting component, we show that intermediate-mass X-ray binaries (IMXBs) can evolve into UCXBs. Using the MESA code, we have calculated evolutionary sequences for a large number of IMXBs. The simulated results indicate that, for a small wind-driving efficiency f = 10‑5, the anomalous magnetic braking can drive IMXBs to an ultra-short period of 11 minutes. Comparing our simulated results with the observed parameters of 15 identified UCXBs, the anomalous magnetic braking evolutionary channel can account for the formation of seven and eight sources with f = 10‑3, and 10‑5, respectively. In particular, a relatively large value of f can fit three of the long-period, persistent sources with a high mass-transfer rate. Though the proportion of Ap/Bp stars in intermediate-mass stars is only 5%, the lifetime of the UCXB phase is ≳2 Gyr, producing a relatively high number of observable systems, making this an alternative evolutionary channel for the formation of UCXBs.

  16. The Relation Between [OIII]/H$\\beta$ and Specific Star Formation Rate in Galaxies at $z \\sim 2$

    CERN Document Server

    Dickey, Claire Mackay; Oesch, Pascal; Whitaker, Katherine; Momcheva, Ivelina; Nelson, Erica; Leja, Joel; Brammer, Gabriel; Franx, Marijn; Skelton, Rosalind

    2016-01-01

    Recent surveys have identified a seemingly ubiquitous population of galaxies with elevated [OIII]/H$\\beta$ emission line ratios at $z > 1$, though the nature of this phenomenon continues to be debated. The [OIII]/H$\\beta$ line ratio is of interest because it is a main component of the standard diagnostic tools used to differentiate between active galactic nuclei (AGN) and star-forming galaxies, as well as the gas-phase metallicity indicators $O_{23}$ and $R_{23}$. Here, we investigate the primary driver of increased [OIII]/H$\\beta$ ratios by median-stacking rest-frame optical spectra for a sample of star-forming galaxies in the 3D-HST survey in the redshift range $z\\sim1.4-2.2$. Using $N = 4220$ star-forming galaxies, we stack the data in bins of mass and specific star formation rates (sSFR) respectively. After accounting for stellar Balmer absorption, we measure [OIII]$\\lambda5007$\\AA/H$\\beta$ down to $\\mathrm{M} \\sim 10^{9.2} \\ \\mathrm{M_\\odot}$ and sSFR $\\sim 10^{-9.6} \\ \\mathrm{yr}^{-1}$, more than an ord...

  17. The Bursty Star Formation Histories of Low-mass Galaxies at $0.4Star Formation Rates Measured from FUV and H$\\beta$

    CERN Document Server

    Guo, Yicheng; Faber, S M; Koo, David C; Krumholz, Mark R; Trump, Jonathan R; Willner, S P; Amorín, Ricardo; Barro, Guillermo; Bell, Eric F; Gardner, Jonathan P; Gawiser, Eric; Hathi, Nimish P; Koekemoer, Anton M; Pacifici, Camilla; Pérez-González, Pablo G; Ravindranath, Swara; Reddy, Naveen; Teplitz, Harry I; Yesuf, Hassen

    2016-01-01

    We investigate the burstiness of star formation histories (SFHs) of galaxies at $0.4star formation rates (SFRs) measured from FUV (1500 \\AA) and H$\\beta$ (FUV--to--H$\\beta$ ratio). Our sample contains 164 galaxies down to stellar mass (M*) of $10^{8.5} M_\\odot$ in the CANDELS GOODS-N region, where TKRS Keck/DEIMOS spectroscopy and HST/WFC3 F275W images from CANDELS and HDUV are available. When the ratio of FUV- and H$\\beta$-derived SFRs is measured, dust extinction correction is negligible (except for very dusty galaxies) with the Calzetti attenuation curve. The FUV--to--H$\\beta$ ratio of our sample increases with the decrease of M* and SFR. The median ratio is $\\sim$1 at M* $\\sim 10^{10} M_\\odot$ (or SFR = 20 $M_\\odot$/yr) and increases to $\\sim$1.6 at M* $\\sim 10^{8.5} M_\\odot$ (or SFR $\\sim 0.5 M_\\odot$/yr). At M* $< 10^{9.5} M_\\odot$, our median FUV--to--H$\\beta$ ratio is higher than that of local galaxies at the same M*, implying a redshift evolution. Bursty SFH on a ...

  18. The fundamental parameters of the roAp star HD 24712. A rapidly oscillator at the red edge of the instability strip

    Science.gov (United States)

    Perraut, K.; Brandão, I.; Cunha, M.; Shulyak, D.; Mourard, D.; Nardetto, N.; ten Brummelaar, T. A.

    2016-05-01

    Context. There is still a debate about the nature of the mechanism that causes the pulsation excitation of the rapidly oscillating Ap stars that oscillate above the highest theoretically acoustic frequency. HD 24712 is a good test case for such a study because it is bright, its parallax accurately determined, and its frequency spectrum is well known. Aims: Visible long-baseline interferometry is a unique technique for measuring accurate angular diameters of targets as small as the brightest roAp stars, and thus estimating accurate radii by a method as independent as possible of atmosphere models. Methods: We used the visible spectrograph VEGA at the CHARA long-baseline optical array to observe HD 24712, and we derived its limb-darkened diameter. We also estimated its bolometric flux from spectroscopic data in the literature and determined its radius, luminosity, and effective temperature. Results: We determined a limb-darkened angular diameter of 0.335 ± 0.009 mas for HD 24712 and derived a radius of R = 1.772 ± 0.057 R⊙, a luminosity of L = 7.2 ± 1.8 L⊙, and an effective temperature of Teff = 7235 ± 280 K, which is in very close agreement with the values provided by the self-consistent stratified model developed for this star. We used these fundamental parameters to set HD 24712 in the Hertzsprung-Russell diagram. Its position is marginally consistent with the region where high radial order modes are predicted to be excited by the κ-mechanism. Conclusions: We conclude that oscillations in this star are most likely not driven by the κ-mechanism. Based on observations made with the VEGA/CHARA spectro-interferometer.

  19. Searching for young Jupiter analogs around AP Col: L-band high-contrast imaging of the closest pre-main sequence star

    CERN Document Server

    Quanz, Sascha P; Janson, Markus; Avenhaus, Henning; Meyer, Michael R; Hillenbrand, Lynne A

    2012-01-01

    The nearby M-dwarf AP Col was recently identified by Riedel et al. 2011 as a pre-main sequence star (age 12 - 50 Myr) situated only 8.4 pc from the Sun. The combination of its youth, distance, and intrinsically low luminosity make it an ideal target to search for extrasolar planets using direct imaging. We report deep adaptive optics observations of AP Col taken with VLT/NACO and Keck/NIRC2 in the L-band. Using aggressive speckle suppression and background subtraction techniques, we are able to rule out companions with mass m >= 0.5 - 1M_Jup for projected separations a>4.5 AU, and m >= 2 M_Jup for projected separations as small as 3 AU, assuming an age of 40 Myr using the COND theoretical evolutionary models. Using a different set of models the mass limits increase by a factor of ~2. The observations presented here are the deepest mass-sensitivity limits yet achieved within 20 AU on a star with direct imaging. While Doppler radial velocity surveys have shown that Jovian bodies with close-in orbits are rare ar...

  20. SEARCHING FOR YOUNG JUPITER ANALOGS AROUND AP COL: L-BAND HIGH-CONTRAST IMAGING OF THE CLOSEST PRE-MAIN-SEQUENCE STAR

    Energy Technology Data Exchange (ETDEWEB)

    Quanz, Sascha P.; Avenhaus, Henning; Meyer, Michael R. [Institute for Astronomy, ETH Zurich, Wolfgang-Pauli-Strasse 27, 8093 Zurich (Switzerland); Crepp, Justin R.; Hillenbrand, Lynne A. [Department of Astrophysics, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Janson, Markus, E-mail: quanz@astro.phys.ethz.ch [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States)

    2012-08-01

    The nearby M-dwarf AP Col was recently identified by Riedel et al. as a pre-main-sequence star (age 12-50 Myr) situated only 8.4 pc from the Sun. The combination of its youth, distance, and intrinsically low luminosity make it an ideal target to search for extrasolar planets using direct imaging. We report deep adaptive optics observations of AP Col taken with VLT/NACO and Keck/NIRC2 in the L band. Using aggressive speckle suppression and background subtraction techniques, we are able to rule out companions with mass m {>=} 0.5-1 M{sub Jup} for projected separations a > 4.5 AU, and m {>=} 2 M{sub Jup} for projected separations as small as 3 AU, assuming an age of 40 Myr using the COND theoretical evolutionary models. Using a different set of models, the mass limits increase by a factor of {approx}>2. The observations presented here are the deepest mass-sensitivity limits yet achieved within 20 AU on a star with direct imaging. While Doppler radial velocity surveys have shown that Jovian bodies with close-in orbits are rare around M-dwarfs, gravitational microlensing studies predict that 17{sup +6}{sub -9}% of these stars host massive planets with orbital separations of 1-10 AU. Sensitive high-contrast imaging observations, like those presented here, will help to validate results from complementary detection techniques by determining the frequency of gas giant planets on wide orbits around M-dwarfs.

  1. An ancient repeat sequence in the ATP synthase beta-subunit gene of forcipulate sea stars.

    Science.gov (United States)

    Foltz, David W

    2007-11-01

    A novel repeat sequence with a conserved secondary structure is described from two nonadjacent introns of the ATP synthase beta-subunit gene in sea stars of the order Forcipulatida (Echinodermata: Asteroidea). The repeat is present in both introns of all forcipulate sea stars examined, which suggests that it is an ancient feature of this gene (with an approximate age of 200 Mya). Both stem and loop regions show high levels of sequence constraint when compared to flanking nonrepetitive intronic regions. The repeat was also detected in (1) the family Pterasteridae, order Velatida and (2) the family Korethrasteridae, order Velatida. The repeat was not detected in (1) the family Echinasteridae, order Spinulosida, (2) the family Astropectinidae, order Paxillosida, (3) the family Solasteridae, order Velatida, or (4) the family Goniasteridae, order Valvatida. The repeat lacks similarity to published sequences in unrestricted GenBank searches, and there are no significant open reading frames in the repeat or in the flanking intron sequences. Comparison via parametric bootstrapping to a published phylogeny based on 4.2 kb of nuclear and mitochondrial sequence for a subset of these species allowed the null hypothesis of a congruent phylogeny to be rejected for each repeat, when compared separately to the published phylogeny. In contrast, the flanking nonrepetitive sequences in each intron yielded separate phylogenies that were each congruent with the published phylogeny. In four species, the repeat in one or both introns has apparently experienced gene conversion. The two introns also show a correlated pattern of nucleotide substitutions, even after excluding the putative cases of gene conversion.

  2. APS星敏感器探测灵敏度研究%Study on detection sensitivity of APS star tracker

    Institute of Scientific and Technical Information of China (English)

    刘金国; 李杰; 郝志航

    2006-01-01

    从噪声中信号的检测理论着手,推导了恒星信号在有源像元传感器(APS)像面的响应电子数的表示方法,介绍了APS的主要噪声及噪声模型计算,得出了ASP星敏感器的信噪比,并用信噪比阈值推导出APS星敏感器的探测灵敏度模型.通过对典型APS IBIS5的实例计算,得出在常规光学系统设计参数下,当信噪比阈值为8.1,探测概率为99.9%时,探测灵敏度可达到6.5星等.

  3. Evolution of intermediate-mass X-ray binaries driven by magnetic braking of Ap/Bp stars: I. ultracompact X-ray binaries

    CERN Document Server

    Chen, Wen-Cong

    2016-01-01

    It is generally believed that Ultracompact X-ray binaries (UCXBs) evolved from binaries consisting of a neutron star accreting from a low-mass white dwarf or helium star where mass transfer is driven by gravitational radiation. However, the standard white-dwarf evolutionary channel cannot produce the relatively long-period ($40 - 60$\\,min) UCXBs with high time-averaged mass-transfer rate. In this work, we explore an alternative evolutionary route toward UCXBs where the companions evolve from intermediate-mass Ap/Bp stars with an anomalously strong magnetic field ($100 - 10000$\\,G). Including the magnetic braking caused by the coupling between the magnetic field and an irradiation-driven wind induced by the X-ray flux from the accreting component, we show that intermediate-mass X-ray binaries (IMXBs) can evolve into UCXBs. Using the \\emph{MESA} code, we have calculated evolutionary sequences for a large number of IMXBs. The simulated results indicate that, for a small wind-driving efficiency $f=10^{-5}$, the a...

  4. CMOS APS噪声对星斑质心定位精度的影响%CMOS APS Noise Effect on Position Accuracy of Star Tracker

    Institute of Scientific and Technical Information of China (English)

    史少龙; 尹达一

    2013-01-01

    CCD作为星敏感器探测器的技术已经比较成熟,但其瓶颈限制也日渐显露.本文以IBIS5-B-1300A探测器为例,具体分析CMOS APS各种噪声对星敏感器星像质心定位精度的影响,在理论上分析CMOS探测器所能达到的质心定位精度上限,并通过建模仿真验证理论分析结果,得出弥散斑束腰宽度为0.7,开窗大小为5×5时质心算法精度最高,固定模式噪声(FPN)对质心定位精度影响最大等结论,为星敏感器探测器的选型以及提高系统星点定位精度的潜力提供理论上的依据和支持.%The technology of CCD as a star sensor starlight detector has been very mature,but the bottleneck is becoming exposed.On the basis of parameters of IBIS5-B-1300A,the article analyzes CMOS APS noise effects on position accuracy of star sensor,obtains the maximum star position accuracy which a CMOS APS sensor can achieve and verifies the theoretical analysis results through modeling and simulation.Then two conclusions are drawn.First,when gauss dispersion radius is 0.7 and the windows size is 5 × 5,we can obtain optimized subpixel accuracy; Second,Fixed Pattern Noise(FPN) has the greatest effect on the accuracy of centroid algorithm.This article provides a theoretical basis and support for the selection of the starlight detector for a star sensor system.

  5. Asteroseismic analysis of the roAp star alpha Circini: 84 days of high-precision photometry from the WIRE satellite

    CERN Document Server

    Bruntt, H; Cunha, M S; Brandao, I M; Handler, G; Bedding, T R; Medupe, T; Buzasi, D L; Mashigo, D; Zhang, I; Van Wyk, F

    2009-01-01

    We present a detailed study of the pulsation of alpha Circini, the brightest of the rapidly oscillating Ap stars. We have obtained 84 days of high-precision photometry from four runs with the star tracker on the WIRE satellite. Simultaneously, we collected ground-based Johnson B observations on 16 nights at the South African Astronomical Observatory. In addition to the dominant oscillation mode at 2442 microHz, we detect two new modes that lie symmetrically around the principal mode to form a triplet. The average separation between these modes is 30.173+-0.004 microHz and they are nearly equidistant with the separations differing by only 3.9 nHz. We compare the observed frequencies with theoretical pulsation models based on constraints from the recently determined interferometric radius and effective temperature, and the recently updated Hipparcos parallax. We show that the theoretical large separations for models of alpha Cir with global parameters within the 1-sigma observational uncertainties vary between ...

  6. On the use of rotational splitting asymmetries to probe the internal rotation profile of stars. Application to $\\beta$ Cephei stars

    CERN Document Server

    Suárez, J C; Goupil, M J; Janot-Pacheco, E

    2010-01-01

    Rotationally-split modes can provide valuable information about the internal rotation profile of stars. This has been used for years to infer the internal rotation behavior of the Sun. The present work discusses the potential additional information that rotationally splitting asymmetries may provide when studying the internal rotation profile of stars. We present here some preliminary results of a method, currently under development, which intends: 1) to understand the variation of the rotational splitting asymmetries in terms of physical processes acting on the angular momentum distribution in the stellar interior, and 2) how this information can be used to better constrain the internal rotation profile of the stars. The accomplishment of these two objectives should allow us to better use asteroseismology as a test-bench of the different theories describing the angular momentum distribution and evolution in the stellar interiors.

  7. Identification of Main Sequence Stars with Mid-Infrared Excesses Using GLIMPSE: Beta-Pictoris Analogs?

    CERN Document Server

    Uzpen, B; Olsen, K A G; Clemens, D P; Laurance, T L; Meade, M R; Babler, B L; Indebetouw, R; Whitney, B A; Watson, C; Wolfire, M G; Wolff, M J; Benjamin, R A; Bania, T M; Cohen, M; Devine, K E; Dickey, J M; Heitsch, F; Jackson, J M; Marston, A P; Mathis, J S; Mercer, E P; Stauffer, J R; Stolovy, S R; Backman, D E; Churchwell, E

    2005-01-01

    Spitzer IRAC 3.6-8 micron photometry obtained as part of the GLIMPSE survey has revealed mid-infrared excesses for 33 field stars with known spectral types in a 1.2 sq. degree field centered on the southern Galactic HII region RCW49. These stars comprise a subset of 184 stars with known spectral classification, most of which were pre-selected to have unusually red IR colors. We propose that the mid-IR excesses are caused by circumstellar dust disks that are either very late remnants of stellar formation or debris disks generated by planet formation. Of these 33 stars, 29 appear to be main-sequence stars based on optical spectral classifications. Five of the 29 main-sequence stars are O or B stars with excesses that can be plausibly explained by thermal bremsstrahlung emission, and four are post main-sequence stars. The lone O star is an O4V((f)) at a spectrophotometric distance of 3233+ 540- 535 pc and may be the earliest member of the Westerlund 2 cluster. Of the remaining 24 main-sequence stars, 18 have SED...

  8. Erratum to Star formation triggered by SN explosions: an application to the stellar association of $\\beta$Pictoris

    CERN Document Server

    Melioli, C; Leão, M R M; De la Reza, R; Raga, A

    2007-01-01

    In the present study, considering the physical conditions that are relevant interactions between supernova remnants (SNRs) and dense molecular clouds for triggering star formation we have built a diagram of SNR radius versus cloud density in which the constraints above delineate a shaded zone where star formation is allowed. We have also performed fully 3-D radiatively cooling numerical simulations of the impact between SNRs and clouds under different initial conditions in order to follow the initial steps of these interactions. We determine the conditions that may lead either to cloud collapse and star formation or to complete cloud destruction and find that the numerical results are consistent with those of the SNR-cloud density diagram. Finally, we have applied the results above to the $\\beta-$ Pictoris stellar association which is composed of low mass Post-T Tauri stars with an age of 11 Myr. It has been recently suggested that its formation could have been triggered by the shock wave produced by a SN exp...

  9. Stokes $IQUV$ magnetic Doppler imaging of Ap stars - III. Next generation chemical abundance mapping of Alpha 2 CVn

    CERN Document Server

    Silvester, James; Wade, Gregg A

    2014-01-01

    In a previous paper we presented an updated magnetic field map for the chemically peculiar star Alpha 2 CVn using ESPaDOnS and Narval time-resolved high-resolution Stokes $IQUV$ spectra. In this paper we focus on mapping various chemical element distributions on the surface of Alpha 2 CVn. With the new magnetic field map and new chemical abundance distributions we can investigate the interplay between the chemical abundance structures and the magnetic field topology on the surface of Alpha 2 CVn. Previous attempts at chemical abundance mapping of Alpha 2 CVn relied on lower resolution data. With our high resolution (R=65,000) dataset we present nine chemical abundance maps for the elements O, Si, Cl, Ti, Cr, Fe, Pr, Nd and Eu. We also derive an updated magnetic field map from Fe and Cr lines in Stokes $IQUV$ and O and Cl in Stokes $IV$. These new maps are inferred from line profiles in Stokes $IV$ using the magnetic Doppler imaging code Invers10. We examine these new chemical maps and investigate correlations...

  10. Stokes $IQUV$ Magnetic Doppler Imaging of Ap stars II: Next Generation Magnetic Doppler Imaging of $\\alpha^2$ CVn

    CERN Document Server

    Silvester, J; Wade, G A

    2014-01-01

    We present updated magnetic field maps of the chemically peculiar B9p star $\\alpha^2$ CVn created using a series of time resolved observations obtained using the high resolution spectropolarimeters ESPaDOnS and Narval. We compare these new magnetic field maps with the original magnetic Doppler imaging maps based on spectra recorded with the MuSiCoS spectropolarimeter and taken a decade earlier. These new maps are inferred from line profiles in all four Stokes parameters using the magnetic Doppler imaging code INVERS10. With the addition of new lines exhibiting Stokes $IQUV$ signatures we have a unique insight into how the derived magnetic surface structure may be affected by the atomic lines chosen for inversion. We report new magnetic maps of $\\alpha^2$ CVn created using strong iron lines (directly comparable to the published MuSiCoS maps), weak iron lines and chromium lines, all of which yield a magnetic field structure roughly consistent with that obtained previously. We then derive an updated magnetic str...

  11. Three-dimensional magnetic and abundance mapping of the cool Ap star HD 24712 I. Spectropolarimetric observations in all four Stokes parameters

    CERN Document Server

    Rusomarov, N; Piskunov, N; Jeffers, S V; Johns-Krull, C M; Keller, C U; Makaganiuk, V; Rodenhuis, M; Snik, F; Stempels, H C; Valenti, J A

    2013-01-01

    High-resolution spectropolarimetric observations provide simultaneous information about stellar magnetic field topologies and three-dimensional distributions of chemical elements. Here we present analysis of a unique full Stokes vector spectropolarimetric data set, acquired for the cool magnetic Ap star HD 24712. The goal of our work is to examine circular and linear polarization signatures inside spectral lines and to study variation of the stellar spectrum and magnetic observables as a function of rotational phase. HD 24712 was observed with the HARPSpol instrument at the 3.6-m ESO telescope over a period of 2010-2011. The resulting spectra have S/N ratio of 300-600 and resolving power exceeding 100000. The multiline technique of least-squares deconvolution (LSD) was applied to combine information from the spectral lines of Fe-peak and rare-earth elements. We used the HARPSPol spectra of HD 24712 to study the morphology of the Stokes profile shapes in individual spectral lines and in LSD Stokes profiles cor...

  12. Cometary Dust in the Debris of HD 31648 and HD163296: Two "Baby" Beta pictoris Stars

    Science.gov (United States)

    Sitko, Michael L.; Grady, Carol A.; Lynch, David K.; Russell, Ray W.; Hanner, Martha S.

    1999-01-01

    The debris disks surrounding the pre-main-sequence stars HD 31648 and HD 163296 were observed spectroscopically between 3 and 14 microns. Both stars possess a silicate emission feature at 10 Am that resembles that of the star P Pictoris and those observed in solar system comets. The structure of the band is consistent with a mixture of olivine and pyroxene material, plus an underlying continuum of unspecified origin. The similarity in both size and structure of the silicate band suggests that the material in these systems had a processing history similar to that in our own solar system prior to the time that the grains were incorporated into comets.

  13. Chandra spectroscopy of the hot star beta Crucis and the discovery of a pre-main-sequence companion

    CERN Document Server

    Cohen, David H; Gagné, Marc; Jensen, Eric L N; Miller, Nathan A

    2008-01-01

    In order to test the O star wind-shock scenario for X-ray production in less luminous stars with weaker winds, we made a pointed 74 ks observation of the nearby early B giant, beta Cru (B0.5 III), with the Chandra HETGS. We find that the X-ray spectrum is quite soft, with a dominant thermal component near 3 million K, and that the emission lines are resolved but quite narrow, with half-widths of 150 km/s. The forbidden-to-intercombination line ratios of Ne IX and Mg XI indicate that the hot plasma is distributed in the wind, rather than confined near the photosphere. It is difficult to understand the X-ray data in the context of the standard wind-shock paradigm for OB stars, primarily because of the narrow lines, but also because of the high X-ray production efficiency. A scenario in which the bulk of the outer wind is shock heated is broadly consistent with the data, but not very well motivated theoretically. It is possible that magnetic channeling could explain the X-ray properties, although no field has be...

  14. Endoplasmic reticulum stress mediating downregulated StAR and 3-beta-HSD and low plasma testosterone caused by hypoxia is attenuated by CPU86017-RS and nifedipine

    Directory of Open Access Journals (Sweden)

    Liu Gui-Lai

    2012-01-01

    Full Text Available Abstract Background Hypoxia exposure initiates low serum testosterone levels that could be attributed to downregulated androgen biosynthesizing genes such as StAR (steroidogenic acute regulatory protein and 3-beta-HSD (3-beta-hydroxysteroid dehydrogenase in the testis. It was hypothesized that these abnormalities in the testis by hypoxia are associated with oxidative stress and an increase in chaperones of endoplasmic reticulum stress (ER stress and ER stress could be modulated by a reduction in calcium influx. Therefore, we verify that if an application of CPU86017-RS (simplified as RS, a derivative to berberine could alleviate the ER stress and depressed gene expressions of StAR and 3-beta-HSD, and low plasma testosterone in hypoxic rats, these were compared with those of nifedipine. Methods Adult male Sprague-Dawley rats were randomly divided into control, hypoxia for 28 days, and hypoxia treated (mg/kg, p.o. during the last 14 days with nifedipine (Nif, 10 and three doses of RS (20, 40, 80, and normal rats treated with RS isomer (80. Serum testosterone (T and luteinizing hormone (LH were measured. The testicular expressions of biomarkers including StAR, 3-beta-HSD, immunoglobulin heavy chain binding protein (Bip, double-strand RNA-activated protein kinase-like ER kinase (PERK and pro-apoptotic transcription factor C/EBP homologous protein (CHOP were measured. Results In hypoxic rats, serum testosterone levels decreased and mRNA and protein expressions of the testosterone biosynthesis related genes, StAR and 3-beta-HSD were downregulated. These changes were linked to an increase in oxidants and upregulated ER stress chaperones: Bip, PERK, CHOP and distorted histological structure of the seminiferous tubules in the testis. These abnormalities were attenuated significantly by CPU86017-RS and nifedipine. Conclusion Downregulated StAR and 3-beta-HSD significantly contribute to low testosterone in hypoxic rats and is associated with ER stress

  15. Numerical Evidence for Dark Star Formation: A Comment on "Weakly Interacting Massive Particle Dark Matter and First Stars: Suppression of Fragmentation in Primordial Star Formation" by Smith et al. 2012, ApJ 761, 154

    CERN Document Server

    Gondolo, Paolo; Spolyar, Douglas; Bodenheimer, Peter

    2013-01-01

    (abridged) This comment is intended to show that simulations by Smith et al. (S12) support the Dark Star (DS) scenario and even remove some potential obstacles. Our previous work illustrated that the initial hydrogen densities of the first equilibrium DSs are high, ~10^{17}/cm^3 for the case of 100 GeV WIMPs, with a stellar radius of ~2-3 AU. Subsequent authors have somehow missed the fact that equilibrium DSs have the high densities they do. S12 have numerically simulated the effect of dark matter annihilation on the contraction of a protostellar gas cloud en route to forming the first stars. They show results at a density ~5 10^{14}/cm^3, slightly higher than the value at which annihilation heating prevails over cooling. However, they are apparently unable to reach the ~10^{17}/cm^3 density of our hydrostatic DS solutions. We are in complete agreement with their physical result that the gas keeps collapsing to densities > 5 10^{14}/cm^3, as it must before equilibrium DSs can form. However we are in disagree...

  16. Multisite spectroscopic seismic study of the beta Cep star V2052 Oph: inhibition of mixing by its magnetic field

    CERN Document Server

    Briquet, M; Aerts, C; Morel, T; Mathis, S; Reese, D R; Lehmann, H; Costero, R; Echevarria, J; Handler, G; Kambe, E; Hirata, R; Masuda, S; Wright, D; Yang, S; Pintado, O; Mkrtichian, D; Lee, B -C; Han, I; Bruch, A; De Cat, P; Uytterhoeven, K; Lefever, K; Vanautgaerden, J; de Batz, B; Frémat, Y; Henrichs, H; Geers, V C; Martayan, C; Hubert, A M; Thizy, O; Tijani, A

    2012-01-01

    We used extensive ground-based multisite and archival spectroscopy to derive observational constraints for a seismic modelling of the magnetic beta Cep star V2052 Ophiuchi. The line-profile variability is dominated by a radial mode (f_1=7.14846 d^{-1}) and by rotational modulation (P_rot=3.638833 d). Two non-radial low-amplitude modes (f_2=7.75603 d^{-1} and f_3=6.82308 d^{-1}) are also detected. The four periodicities that we found are the same as the ones discovered from a companion multisite photometric campaign (Handler et al. 2012) and known in the literature. Using the photometric constraints on the degrees l of the pulsation modes, we show that both f_2 and f_3 are prograde modes with (l,m)=(4,2) or (4,3). These results allowed us to deduce ranges for the mass (M \\in [8.2,9.6] M_o) and central hydrogen abundance (X_c \\in [0.25,0.32]) of V2052 Oph, to identify the radial orders n_1=1, n_2=-3 and n_3=-2, and to derive an equatorial rotation velocity v_eq \\in [71,75] km s^{-1}. The model parameters are in...

  17. On the incidence of magnetic fields in slowly pulsating B, beta Cephei and B-type emission-line stars

    NARCIS (Netherlands)

    J. Silvester; C. Neiner; H.F. Henrichs; G.A. Wade; V. Petit; E. Alecian; A.L. Huat; C. Martayan; J. Power; O. Thizy

    2009-01-01

    We have obtained 40 high-resolution circular spectropolarimetric measurements of 12 slowly pulsating B (SPB) stars, eight β Cephei stars and two Be stars with the Echelle Spectropolarimetric Device for the Observation of Stars at CFHT (ESPaDOnS) and Narval spectropolarimeters. The aim of these obser

  18. Multitechnique testing of the viscous decretion disk model I. The stable and tenuous disk of the late-type Be star $\\beta$ CMi

    CERN Document Server

    Klement, R; Rivinius, T; Panoglou, D; Vieira, R G; Bjorkman, J E; Štefl, S; Tycner, C; Faes, D M; Korčáková, D; Müller, A; Zavala, R T; Curé, M

    2015-01-01

    The viscous decretion disk (VDD) model is able to explain most of the currently observable properties of the circumstellar disks of Be stars. However, more stringent tests, focusing on reproducing multitechnique observations of individual targets via physical modeling, are needed to study the predictions of the VDD model under specific circumstances. In the case of nearby, bright Be star $\\beta$ CMi, these circumstances are a very stable low-density disk and a late-type (B8Ve) central star. The aim is to test the VDD model thoroughly, exploiting the full diagnostic potential of individual types of observations, in particular, to constrain the poorly known structure of the outer disk if possible, and to test truncation effects caused by a possible binary companion using radio observations. We use the Monte Carlo radiative transfer code HDUST to produce model observables, which we compare with a very large set of multitechnique and multiwavelength observations that include ultraviolet and optical spectra, photo...

  19. A Coherent Study of Emission Lines from Broad-Band Photometry: Specific Star-Formation Rates and [OIII]/H{\\beta} Ratio at 3 < z < 6

    CERN Document Server

    Faisst, A L; Hsieh, B C; Laigle, C; Salvato, M; Tasca, L; Cassata, P; Davidzon, I; Ilbert, O; Fevre, O Le; Masters, D; McCracken, H J; Steinhardt, C; Silverman, J D; De Barros, S; Hasinger, G; Scoville, N Z

    2016-01-01

    We measure the H{\\alpha} and [OIII] emission line properties as well as specific star-formation rates (sSFR) of spectroscopically confirmed 33 cannot be fully explained in a picture of cold accretion driven growth. We find a progressively increasing [OIII]{\\lambda}5007/H{\\beta} ratio out to z~6, consistent with the ratios in local galaxies selected by increasing H{\\alpha} EW (i.e., sSFR). This demonstrates the potential of using "local high-z analogs" to investigate the spectroscopic properties and relations of galaxies in the re-ionization epoch.

  20. The MOSDEF Survey: Dissecting the star-formation rate vs. stellar mass relation using H$\\alpha$ and H$\\beta$ emission lines at z ~ 2

    CERN Document Server

    Shivaei, Irene; Shapley, Alice E; Kriek, Mariska; Siana, Brian; Mobasher, Bahram; Coil, Alison L; Freeman, William R; Sanders, Ryan; Price, Sedona H; de Groot, Laura; Azadi, Mojegan

    2015-01-01

    We present results on the SFR-$M_*$ relation (i.e., the "main sequence") among star-forming galaxies at $1.37\\leq z \\leq2.61$ using the MOSFIRE Deep Evolution Field (MOSDEF) survey. Based on a sample of 261 star-forming galaxies with observations of H$\\alpha$ and H$\\beta$ emission lines, we have estimated robust dust-corrected instantaneous star-formation rates (SFRs) over a large dynamic range in stellar mass ($\\sim 10^{9.0}-10^{11.5}M_\\odot$). We find a tight correlation between SFR(H$\\alpha$) and $M_*$ with an intrinsic scatter of 0.36 dex, 0.05 dex larger than that of UV-based SFRs. This increased scatter is consistent with predictions from numerical simulations of 0.03 - 0.1 dex, and is attributed to H$\\alpha$ more accurately tracing SFR variations. The slope of the $\\log(\\text{SFR})-\\log(M_*)$ relation, using SFR(H$\\alpha$), at $1.4< z<2.6$ and over the stellar mass range of $10^{9.5}$ to $10^{11.5}M_\\odot$ is $0.65\\pm 0.09$. We find that different assumptions for the dust correction, such as usin...

  1. Millimetre Continuum Observations of Southern Massive Star Formation Regions II. SCUBA observations of cold cores and the dust grain emissivity index $\\beta$

    CERN Document Server

    Hill, T; Cunningham, M R; Minier, V; Pierce-Price, D; Thompson, M A; Walsh, A J

    2006-01-01

    We report the results of a submillimetre continuum emission survey targeted toward 78 star formation regions, 72 of which are devoid of methanol maser and UC HII regions, identified in the SEST/SIMBA millimetre continuum survey of Hill et al. (2005). At least 45 per cent of the latter sources, dubbed `mm-only', detected in this survey are also devoid of mid infrared MSX, emission. The 450 and 850micron, continuum emission was mapped using the Submillimetre Common User Bolometer Array (SCUBA) instrument on the James Clerk Maxwell Telescope (JCMT). Emission is detected toward 97 per cent of the 78 sources targeted as well as towards 28 other SIMBA sources lying in the SCUBA fields. We concatenate the results from four (sub)millimetre continuum surveys of massive star formation [Walsh et al. (2003), Hill et al. (2005), Thompson et al. (2006); as well as this work], together with the Galactic Plane map of Pierce-Price et al. (2000) in order to determine the dust grain emissivity index $\\beta$ for each of the sour...

  2. Combining BRITE and ground-based photometry for the Beta Cephei star Nu Eridani: impact on photometric pulsation mode identification and detection of several g modes

    CERN Document Server

    Handler, G; Popowicz, A; Pigulski, A; Kuschnig, R; Zoclonska, E; Moffat, A F J; Weiss, W W; Grant, C C; Pablo, H; Whittaker, G N; Rucinski, S M; Ramiaramanantsoa, T; Zwintz, K; Wade, G A

    2016-01-01

    We report a simultaneous ground and space-based photometric study of the Beta Cephei star Nu Eridani. Half a year of observations have been obtained by four of the five satellites constituting BRITE-Constellation, supplemented with ground-based photoelectric photometry. We show that carefully combining the two data sets virtually eliminates the aliasing problem that often hampers time-series analyses. We detect 40 periodic signals intrinsic to the star in the light curves. Despite a lower detection limit we do not recover all the pressure and mixed modes previously reported in the literature, but we newly detect six additional gravity modes. This behaviour is a consequence of temporal changes in the pulsation amplitudes that we also detected for some of the p modes. We point out that the dependence of theoretically predicted pulsation amplitude on wavelength is steeper in visual passbands than those observationally measured, to the extent that the three dominant pulsation modes of Nu Eridani would be incorrec...

  3. Atividades de quitinase e beta-1,3-glucanase após eliciação das defesas do tomateiro contra a mancha-bacteriana Chitinase and beta-1,3-glucanase activities after the elicitation of tomato defenses against bacterial spot

    Directory of Open Access Journals (Sweden)

    Fábio Rossi Cavalcanti

    2006-12-01

    Full Text Available O objetivo deste trabalho foi avaliar a influência de eliciadores biológicos e químicos sobre as atividades de duas proteínas relacionadas à patogênese (PR, quitinase e beta-1,3-glucanase, em folhas de tomateiro, e avaliar o potencial desses eliciadores na redução do progresso da mancha-foliar causada por Xanthomonas campestris pv. vesicatoria. Plantas de tomateiro da cultivar Santa Cruz Kada foram pulverizadas com: acibenzolar-S-metil (ASM; 0,2 g L-1; formulação biológica proveniente de biomassa cítrica, denominada Ecolife (5 mL L-1; suspensão de quitosana (MCp; 200 g L-1, proveniente de micélio de Crinipellis perniciosa; extrato aquoso de ramos de lobeira (Solanum lycocarpum infectados por C. perniciosa (VLA; 300 g L-1. As plantas foram desafiadas com um isolado virulento da bactéria, quatro dias depois das pulverizações. Plantas pulverizadas com extratos biológicos mostraram redução da mancha-bacteriana. ASM proporcionou 49,3% de proteção, e foi igual à MCp e Ecolife e superior ao VLA. Este último não diferiu significativamente de MCp e Ecolife. Observou-se maior atividade das duas enzimas nas plantas tratadas, principalmente nas primeiras horas após as pulverizações.The objective of this work was to assess the influence of foliar application of resistance inducers and the activation of plant pathogenesis-related (PR proteins, chitinases and beta-1,3-glucanases, against Xanthomonas campestris pv. vesicatoria, and evaluate the potential of these elicitors on the reduction of bacterial leaf spot. Tomato plants of the cultivar Santa Cruz Kada were sprayed with: acibenzolar-S-methyl (0.2 g L-1 ASM; Ecolife, a biological formulation based on citric biomass (5 mL L-1; chitosan suspension from Crinipellis perniciosa mycelium (MCp; 200 g L-1; an aqueous extract from branches of lobeira (Solanum lycocarpum infected with C. perniciosa (VLA; 300 g L-1. Plants were challenged with a virulent bacterial strain four days after

  4. AP Music Theory Applied

    Science.gov (United States)

    Spieker, Matthew H.

    2016-01-01

    Some American high schools include Advanced Placement (AP) Music Theory within their course offerings. Students who pass the AP exam can receive college credit either as a music or humanities credit. An AP class, however, offers music students more than future college credit; it ultimately improves musicianship skills and promotes deeper…

  5. The 2003-4 multisite photometric campaign for the Beta Cephei and eclipsing star 16 (EN) Lacertae with an Appendix on 2 Andromedae, the variable comparison star

    CERN Document Server

    Jerzykiewicz, M; Daszynska-Daszkiewicz, J; Pigulski, A; Poretti, E; Rodriguez, E; Amado, P J; Kolaczkowski, Z; Uytterhoeven, K; Dorokhova, T N; Dorokhov, N I; Lorenz, D; Zsuffa, D; Kim, S -L; Bourge, P -O; Acke, B; De Ridder, J; Verhoelst, T; Drummond, R; Movchan, A I; Lee, J -A; Steslicki, M; Molenda-Zakowicz, J; Garrido, R; Kim, S -H; Michalska, G; Paparo, M; Antoci, V; Aerts, C

    2015-01-01

    A multisite photometric campaign for the Beta Cephei and eclipsing variable 16 Lacertae is reported. 749 h of high-quality differential photoelectric Stromgren, Johnson and Geneva time-series photometry were obtained with ten telescopes during 185 nights. After removing the pulsation contribution, an attempt was made to solve the resulting eclipse light curve by means of the computer program EBOP. Although a unique solution was not obtained, the range of solutions could be constrained by comparing computed positions of the secondary component in the Hertzsprung-Russell diagram with evolutionary tracks. For three high-amplitude pulsation modes, the uvy and the Geneva UBG amplitude ratios are derived and compared with the theoretical ones for spherical-harmonic degrees l <= 4. The highest degree, l = 4, is shown to be incompatible with the observations. One mode is found to be radial, one is l = 1, while in the remaining case l = 2 or 3. The present multisite observations are combined with the archival photo...

  6. Sparse aperture masking at the VLT II. Detection limits for the eight debris disks stars $\\beta$ Pic, AU Mic, 49 Cet, $\\eta$ Tel, Fomalhaut, g Lup, HD181327 and HR8799

    CERN Document Server

    Gauchet, L; Lagrange, A -M; Ehrenreich, D; Bonnefoy, M; Girard, J H; Boccaletti, A

    2016-01-01

    Context. The formation of planetary systems is a common, yet complex mechanism. Numerous stars have been identified to possess a debris disk, a proto-planetary disk or a planetary system. The understanding of such formation process requires the study of debris disks. These targets are substantial and particularly suitable for optical and infrared observations. Sparse Aperture masking (SAM) is a high angular resolution technique strongly contributing to probe the region from 30 to 200 mas around the stars. This area is usually unreachable with classical imaging, and the technique also remains highly competitive compared to vortex coronagraphy. Aims. We aim to study debris disks with aperture masking to probe the close environment of the stars. Our goal is either to find low mass companions, or to set detection limits. Methods. We observed eight stars presenting debris disks ( $\\beta$ Pictoris, AU Microscopii, 49 Ceti, $\\eta$ Telescopii, Fomalhaut, g Lupi, HD181327 and HR8799) with SAM technique on the NaCo ins...

  7. The AP1000 reactor

    International Nuclear Information System (INIS)

    The design of the AP1000 reactor began 20 years ago when Westinghouse launched the AP600 reactor project. In fact by re-assessing AP600's safety margins Westinghouse realized that the its power output could be raised without putting at risk its safety standard. The AP1000 was born, it yields 1100 MWe. The main AP1000's design features is its passive safety (particularly after the Fukushima accident) and its modularity. The passive safety of the AP1000 implies: -) no humane intervention needed for 72 hours at least after the incident; -) no necessity for redundant complex safety systems. The modularity means that the plant, the reactor and other buildings are constructed from a choice of 300 modular units. These units can be built off-site and fit together on site. The modularity allows more construction activities to be led simultaneously and more chances to cope with the construction schedule. The NRC has approved the operation license for 30 years of the first AP1000 being built in the Usa (Vogtle plant in Georgia). 4 AP1000 are being built in China (Sanmen and Haiyang sites) and 6 others are planned in the Usa. Westinghouse is convinced that the AP1000's passive safety makes it more attractive. Let us not forget that Westinghouse was at the origin of the concept of pressurized water reactors, an idea adopted for half the nuclear power stations in the world and for all the plants now active in France. (A.C.)

  8. Gas and dust in the star-forming region rho Oph A: The dust opacity exponent beta and the gas-to-dust mass ratio g2d

    CERN Document Server

    Liseau, R; Lunttila, T; Olberg, M; Rydbeck, G; Bergman, P; Justtanont, K; Olofsson, G; de Vries, B L

    2015-01-01

    We aim at determining the spatial distribution of the gas and dust in star-forming regions and address their relative abundances in quantitative terms. We also examine the dust opacity exponent beta for spatial and/or temporal variations. Using mapping observations of the very dense rho Oph A core, we examined standard 1D and non-standard 3D methods to analyse data of far-infrared and submillimeter (submm) continuum radiation. The resulting dust surface density distribution can be compared to that of the gas. The latter was derived from the analysis of accompanying molecular line emission, observed with Herschel from space and with APEX from the ground. As a gas tracer we used N2H+, which is believed to be much less sensitive to freeze-out than CO and its isotopologues. Radiative transfer modelling of the N2H+(J=3-2) and (J=6-5) lines with their hyperfine structure explicitly taken into account provides solutions for the spatial distribution of the column density N(H2), hence the surface density distribution ...

  9. Variability of Southern T Tauri Stars I The Continuum and the H$\\beta$ Inverse PCygni Profile of GQ LUPI

    CERN Document Server

    Batalha, C; Batalha, N M

    2001-01-01

    We present time series spectrophotometric observations of GQ Lupi, a typical representative of the YY Ori subgroup of T Tauri stars that show conspicuous inverse PCygni profiles. The data set consists of 32 exposures taken over 5 and 8 consecutive nights of May and July 1998, respectively, and covers the spectral range of 3100 \\AA~ $$ 4600 \\AA. The Balmer continuum slope indicates that the spectral energy distribution is governed by a gas of temperature greater than that of the stellar photosphere. We find an anticorrelation between the veiling and the observed Balmer jump. The time series of the redward absorption component behaves similarly to the veiling time series. We model the emitting region by a gas of uniform temperature and density. The models indicate that the gas densities and the respective temperatures are strongly anticorrelated. In addition, the model time series show that the increase in the gas density is mirrored by an increase of the projected emitting area (filling factor). Large/small ga...

  10. Evolution of the H$\\beta$+[OIII] and [OII] luminosity functions and the [OII] star-formation history of the Universe up to $z$ ~ 5 from HiZELS

    CERN Document Server

    Khostovan, Ali Ahmad; Mobasher, Bahram; Best, Philip N; Smail, Ian; Stott, John P; Hemmati, Shoubaneh; Nayyeri, Hooshang

    2015-01-01

    We investigate the evolution of the H$\\beta$+[OIII] and [OII] luminosity functions from $z$ ~ 0.8 to ~ 5 in multiple redshift slices using data from the High-$z$ Emission Line Survey (HiZELS). This is the first time that the H$\\beta$+[OIII] and [OII] luminosity functions have been studied at these redshifts in a self-consistent analysis. This is also the largest sample of [OII] and H$\\beta$+[OIII] emitters (3484 and 3301 emitters, respectively) in this redshift range, with large co-moving volumes ~ $1 \\times 10^6$ Mpc$^{3}$ in two independent volumes (COSMOS and UDS), greatly reducing the effects of cosmic variance. The emitters were selected by a combination of photometric redshift and color-color selections, as well as spectroscopic follow-up, including recent spectroscopic observations using DEIMOS and MOSFIRE on the Keck Telescopes and FMOS on Subaru. We find a strong increase in $L_\\star$ and a decrease in $\\phi_\\star$ with increasing redshift up to $z \\sim 2$ and $z \\sim 5$ for H$\\beta$+[OIII] and [OII]...

  11. APS Science 2006.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M.; Fenner, R. B.; Long, G.; Borland, M.; Decker, G.

    2007-05-24

    In my five years as the Director of the Advanced Photon Source (APS), I have been fortunate to see major growth in the scientific impact from the APS. This year I am particularly enthusiastic about prospects for our longer-term future. Every scientific instrument must remain at the cutting edge to flourish. Our plans for the next generation of APS--an APS upgrade--got seriously in gear this year with strong encouragement from our users and sponsors. The most promising avenue that has emerged is the energy-recovery linac (ERL) (see article on page xx), for which we are beginning serious R&D. The ERL{at}APS would offer revolutionary performance, especially for x-ray imaging and ultrafast science, while not seriously disrupting the existing user base. I am very proud of our accelerator physics and engineering staff, who not only keep the current APS at the forefront, but were able to greatly impress our international Machine Advisory Committee with the quality of their work on the possible upgrade option (see page xx). As we prepare for long-term major upgrades, our plans to develop and optimize all the sectors at APS in the near future are advancing. Several new beamlines saw first light this year, including a dedicated powder diffraction beamline (11-BM), two instruments for inelastic x-ray scattering at sector 30, and the Center for Nanoscale Materials (CNM) Nanoprobe beamline at sector 26. Our partnership in the first x-ray free-electron laser (LCLS) to be built at Stanford contributes to revolutionary growth in ultrafast science (see page xx), and we are developing a pulse chirping scheme to get ps pulses at sector 7 of the APS within a year or so. In this report, you will find selected highlights of scientific research at the APS from calendar year 2006. The highlighted work covers diverse disciplines, from fundamental to applied science. In the article on page xx you can see the direct impact of APS research on technology. Several new products have emerged from

  12. AP statistics crash course

    CERN Document Server

    D'Alessio, Michael

    2012-01-01

    AP Statistics Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Statistics Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Statistics course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: exploring da

  13. APS Science 2009

    International Nuclear Information System (INIS)

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report), the challenge

  14. APS Science 2009.

    Energy Technology Data Exchange (ETDEWEB)

    Gibson, J. M; Mills, D. M.; Gerig, R.

    2010-05-01

    It is my pleasure to introduce the 2009 annual report of the Advanced Photon Source. This was a very good year for us. We operated with high reliability and availability, despite growing problems with obsolete systems, and our users produced a record output of publications. The number of user experiments increased by 14% from 2008 to more than 3600. We congratulate the recipients of the 2009 Nobel Prize in Chemistry-Venkatraman Ramakrishnan (Cambridge Institute for Medical Research), Thomas Steitz (Yale University), and Ada Yonath (Weizmann Institute) - who did a substantial amount of this work at APS beamlines. Thanks to the efforts of our users and staff, and the ongoing counsel of the APS Scientific Advisory Committee, we made major progress in advancing our planning for the upgrade of the APS (APS-U), producing a proposal that was positively reviewed. We hope to get formal approval in 2010 to begin the upgrade. With advocacy from our users and the support of our sponsor, the Office of Basic Energy Sciences in the Department of Energy (DOE) Office of Science, our operating budgets have grown to the level needed to more adequately staff our beamlines. We were also extremely fortunate to have received $7.9 M in American Recovery and Reinvestment Act ('stimulus') funding to acquire new detectors and improve several of our beamlines. The success of the new Linac Coherent Light Source at Stanford, the world's first x-ray free-electron laser, made us particularly proud since the undulators were designed and built by the APS. Among other highlights, we note that more than one-quarter of the 46 Energy Frontier Research Centers, funded competitively across the U.S. in 2009 by the DOE, included the Advanced Photon Source in their proposed work, which shows that synchrotron radiation, and the APS in particular, are central to energy research. While APS research covers everything from fundamental to applied science (reflected by the highlights in this report

  15. Coroutine Sequencing in BETA

    DEFF Research Database (Denmark)

    Kristensen, Bent Bruun; Madsen, Ole Lehrmann; Møller-Pedersen, Birger;

    In object-oriented programming, a program execution is viewed as a physical model of some real or imaginary part of the world. A language supporting object-oriented programming must therefore contain comprehensive facilities for modeling phenomena and concepts form the application domain. Many ap...... applications in the real world consist of objects carrying out sequential processes. Coroutines may be used for modeling objects that alternate between a number of sequential processes. The authors describe coroutines in BETA...

  16. APS Science 2007.

    Energy Technology Data Exchange (ETDEWEB)

    2008-05-30

    This report provides research highlights from the Advanced Photon Source (APS). Although these highlights represent less than 10% of the published work from the APS in 2007, they give a flavor of the diversity and impact of user research at the facility. In the strategic planning the aim is to foster the growth of existing user communities and foresee new areas of research. This coming year finds the APS engaged in putting together, along with the users, a blueprint for the next five years, and making the case for a set of prioritized investments in beamlines, the accelerator, and infrastructure, each of which will be transformational in terms of scientific impact. As this is written plans are being formulated for an important user workshop on October 20-21, 2008, to prioritize strategic plans. The fruit from past investments can be seen in this report. Examples include the creation of a dedicated beamline for x-ray photon correlation spectroscopy at Sector 8, the evolution of dedicated high-energy x-ray scattering beamlines at sectors 1 and 11, a dedicated imaging beamline at Sector 32, and new beamlines for inelastic scattering and powder diffraction. A single-pulse facility has been built in collaboration with Sector 14 (BioCARS) and Phil Anfinrud at the National Institutes of Health, which will offer exceptionally high flux for single-pulse diffraction. The nanoprobe at Sector 26, built and operated jointly by the Argonne Center for Nanoscale Materials and the X-ray Operations and Research (XOR) section of the APS X-ray Science Division, has come on line to define the state of the art in nanoscience.

  17. Hot Stars With Cool Companions

    OpenAIRE

    Gullikson, Kevin; Kraus, Adam; Dodson-Robinson, Sarah

    2014-01-01

    Young intermediate-mass stars have become high-priority targets for direct-imaging planet searches following the recent discoveries of planets orbiting e.g. HR 8799 and Beta Pictoris. Close stellar companions to these stars can affect the formation and orbital evolution of any planets, and so a census of the multiplicity properties of nearby intermediate mass stars is needed. Additionally, the multiplicity can help constrain the important binary star formation physics. We report initial resul...

  18. The APS ceramic chambers

    Energy Technology Data Exchange (ETDEWEB)

    Milton, S.; Warner, D.

    1994-07-01

    Ceramics chambers are used in the Advanced Photon Source (APS) machines at the locations of the pulsed kicker and bumper magnets. The ceramic will be coated internally with a resistive paste. The resistance is chosen to allow the low frequency pulsed magnet field to penetrate but not the high frequency components of the circulating beam. Another design goal was to keep the power density experienced by the resistive coating to a minimum. These ceramics, their associated hardware, the coating process, and our recent experiences with them are described.

  19. CGM ApS Årsberetning til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler.......Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2003. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, ErhvervsfremmeStyrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler....

  20. AP physics B crash course

    CERN Document Server

    Howell, Rebecca

    2012-01-01

    AP Physics B Crash Course - Get a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. Our AP Physics B Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know The Crash Course is based on an in-depth analysis of the AP Physics B course description outline and actual AP test questions. It covers only the information tested on the exam, so you can make the most of your valuable study time. Our easy-to-read format covers: mechanics, kinetic theory, t

  1. Center for Geometrisk Metrologi, CGM ApS

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2002. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000.11.0...

  2. Mean-field study of hot beta-stable protoneutron star matter: Impact of the symmetry energy and nucleon effective mass

    CERN Document Server

    Tan, Ngo Hai; Khoa, Dao T; Margueron, Jerome

    2016-01-01

    A consistent Hartree-Fock study of the equation of state (EOS) of asymmetric nuclear matter at finite temperature has been performed using realistic choices of the effective, density dependent nucleon-nucleon (NN) interaction, which were successfully used in different nuclear structure and reaction studies. Given the importance of the nuclear symmetry energy in the neutron star formation, EOS's associated with different behaviors of the symmetry energy were used to study hot asymmetric nuclear matter. The slope of the symmetry energy and nucleon effective mass with increasing baryon density was found to affect the thermal properties of nuclear matter significantly. Different density dependent NN interactions were further used to study the EOS of hot protoneutron star (PNS) matter of the $npe\\mu\

  3. The Dispersal of Young Stars and the Greater Sco-Cen Association

    CERN Document Server

    Mamajek, E E

    2001-01-01

    We review topics related to the dispersal of young stars from their birth-sites, and focus in particular on the entourage of young stars related to the ongoing star-formation event in the Sco-Cen OB association. We conduct a follow-up kinematic study to that presented in Mamajek, Lawson, & Feigelson (2000; ApJ 544, 356) amongst nearby, isolated, young stars. In addition to the eta Cha and TW Hya groups, we find several more intriguing Sco-Cen outlier candidates: most notably beta Pic, PZ Tel, HD 199143, and HD 100546. We discuss the connection between Sco-Cen and the southern ``150 pc Conspiracy'' molecular clouds, and in particular, Corona Australis. The kinematic evidence suggests that many of the nearby, isolated ~10 Myr-old stars were born near Sco-Cen during the UCL and LCC starbursts 10-15 Myr ago. We hypothesize that these stars inherited 5-10 km/s velocities moving away from Sco-Cen, either through molecular cloud turbulence, or through formation in molecular clouds associated with the expanding S...

  4. AP-42 REVISION: COKE OVENS

    Science.gov (United States)

    The document "Compilation of Air Pollutant Emission Factors" (AP-42) has been published by the U. S. Environmental Protection Agency (EPA) since 1972. Supplements to AP-42 have been routinely published to add new emission source categories and to update existing emission factor...

  5. P alpha-chiral phosphorothioate analogues of bis(5'-adenosyl)tetraphosphate (Ap4A); their enzymatic synthesis and degradation.

    OpenAIRE

    Lazewska, D; Guranowski, A

    1990-01-01

    Synthesis of Sp and Rp diastereomers of Ap4A alpha S has been characterized in two enzymatic systems, the lysyl-tRNA synthetase from Escherichia coli and the Ap4A alpha, beta-phosphorylase from Saccharomyces cerevisiae. The synthetase was able to use both (Sp)ATP alpha S and (Rp)ATP alpha S as acceptors of adenylate thus yielding corresponding monothioanalogues of Ap4A,(Sp) Ap4A alpha S and (Rp)Ap4A alpha S. No dithiophosphate analogue was formed. Relative synthetase velocities of the formati...

  6. Final report for tank 241-AP-101, grab samples 1AP-95-1, 1AP-95-2, 1AP-95-3, 1AP-95-4, 1AP-95-5, and 1AP-95-6

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A.

    1996-03-04

    Six supernate grab samples (1AP-95-1 through 6) and one field blank (1AP-95-7) were taken from tank 241-AP-101, on Nov. 10 and 13, 1995. Analyses were performed in support of the Safety Screening and the Waste Compatibility Safety programs. All analytical results were within the action limits stated in the TSAP.

  7. Meet the APS Journal Editors

    Science.gov (United States)

    2016-05-01

    The Editors of the APS journals invite you to join them for conversation. The Editors will be available to answer questions, hear your ideas, and discuss any comments about the journals. All are welcome. Light refreshments will be served.

  8. APS Education and Diversity Efforts

    Science.gov (United States)

    Prestridge, Katherine; Hodapp, Theodore

    2015-11-01

    American Physical Society (APS) has a wide range of education and diversity programs and activities, including programs that improve physics education, increase diversity, provide outreach to the public, and impact public policy. We present the latest programs spearheaded by the Committee on the Status of Women in Physics (CSWP), with highlights from other diversity and education efforts. The CSWP is working to increase the fraction of women in physics, understand and implement solutions for gender-specific issues, enhance professional development opportunities for women in physics, and remedy issues that impact gender inequality in physics. The Conferences for Undergraduate Women in Physics, Professional Skills Development Workshops, and our new Professional Skills program for students and postdocs are all working towards meeting these goals. The CSWP also has site visit and conversation visit programs, where department chairs request that the APS assess the climate for women in their departments or facilitate climate discussions. APS also has two significant programs to increase participation by underrepresented minorities (URM). The newest program, the APS National Mentoring Community, is working to provide mentoring to URM undergraduates, and the APS Bridge Program is an established effort that is dramatically increasing the number of URM PhDs in physics.

  9. Study of the Cygnus Star-Forming Field

    Science.gov (United States)

    Christopherson, Christopher; Kaltcheva, Nadia

    2016-01-01

    The star-forming complexes in Cygnus extend nearly 30 deg in Galactic longitude and 20 deg in latitude, and most probably include star-formation sites located between 600 and 4000 pc. We combine the catalog by Heiles (2000) with uvbyβ photometric data from the catalog of Paunzen (2015) to collate a sample of O and B-type stars with precise homogeneous distances, color excess and available polarimetry. This allows us to identify star-forming sites at different distances along the line of sight and to investigate their spatial correlation to the interstellar matter. Further, we use this sample to study the orientation of the polarization as revealed by the polarized light of the bright early-type stars and analyze the polarization-extinction correlation for this field. Since dust grains align in the presence of a magnetic field cause the observed polarization at optical wavelengths, the data contain information about the large-scale component of the Galactic magnetic field. In addition, wide-field astrophotography equipment was used to image the Cygnus field in Hydrogen-alpha, Hydrogen-beta and the [OIII] line at 500.7 nm. This allows us to map the overall distribution of ionized material and the interstellar dust and trace large-scale regions where the physical conditions change rapidly due to supernova shock fronts and strong stellar winds. Acknowledgments: This work was supported by NSF grant AST- 1516932 and the Wisconsin Space Grant Consortium, NASA Space Grant College and Fellowship Program, NASA Training Grant #NNX14AP22H.

  10. AP Geography, Environmental Science Thrive

    Science.gov (United States)

    Robelen, Erik W.

    2012-01-01

    Geography may not be particularly known as a hot topic among today's students--even some advocates suggest it suffers from an image problem--but by at least one measure, the subject is starting to come into its own. Across more than 30 topics covered in the Advanced Placement (AP) program, participation in geography is rising faster than any…

  11. Structural Determinants of DNA Binding by a P. falciparum ApiAP2 Transcriptional Regulator

    Energy Technology Data Exchange (ETDEWEB)

    Lindner, Scott E.; De Silva, Erandi K.; Keck, James L.; Llinás, Manuel (Princeton); (UW-MED)

    2010-11-05

    Putative transcription factors have only recently been identified in the Plasmodium spp., with the major family of regulators comprising the Apicomplexan Apetala2 (AP2) proteins. To better understand the DNA-binding mechanisms of these transcriptional regulators, we characterized the structure and in vitro function of an AP2 DNA-binding domain from a prototypical Apicomplexan AP2 protein, PF14{_}0633 from Plasmodium falciparum. The X-ray crystal structure of the PF14{_}0633 AP2 domain bound to DNA reveals a {beta}-sheet fold that binds the DNA major groove through base-specific and backbone contacts; a prominent {alpha}-helix supports the {beta}-sheet structure. Substitution of predicted DNA-binding residues with alanine weakened or eliminated DNA binding in solution. In contrast to plant AP2 domains, the PF14{_}0633 AP2 domain dimerizes upon binding to DNA through a domain-swapping mechanism in which the {alpha}-helices of the AP2 domains pack against the {beta}-sheets of the dimer mates. DNA-induced dimerization of PF14{_}0633 may be important for tethering two distal DNA loci together in the nucleus and/or for inducing functional rearrangements of its domains to facilitate transcriptional regulation. Consistent with a multisite binding mode, at least two copies of the consensus sequence recognized by PF14{_}0633 are present upstream of a previously identified group of sporozoite-stage genes. Taken together, these findings illustrate how Plasmodium has adapted the AP2 DNA-binding domain for genome-wide transcriptional regulation.

  12. APS beamline standard components handbook

    International Nuclear Information System (INIS)

    It is clear that most Advanced Photon Source (APS) Collaborative Access Team (CAT) members would like to concentrate on designing specialized equipment related to their scientific programs rather than on routine or standard beamline components. Thus, an effort is in progress at the APS to identify standard and modular components of APS beamlines. Identifying standard components is a nontrivial task because these components should support diverse beamline objectives. To assist with this effort, the APS has obtained advice and help from a Beamline Standardization and Modularization Committee consisting of experts in beamline design, construction, and operation. The staff of the Experimental Facilities Division identified various components thought to be standard items for beamlines, regardless of the specific scientific objective of a particular beamline. A generic beamline layout formed the basis for this identification. This layout is based on a double-crystal monochromator as the first optical element, with the possibility of other elements to follow. Pre-engineering designs were then made of the identified standard components. The Beamline Standardization and Modularization Committee has reviewed these designs and provided very useful input regarding the specifications of these components. We realize that there will be other configurations that may require special or modified components. This Handbook in its current version (1.1) contains descriptions, specifications, and pre-engineering design drawings of these standard components. In the future, the APS plans to add engineering drawings of identified standard beamline components. Use of standard components should result in major cost reductions for CATs in the areas of beamline design and construction

  13. Radiation effects on active pixel sensors (APS)

    International Nuclear Information System (INIS)

    Active pixel sensor (APS) is a new generation of image sensors which presents several advantages relatively to charge coupled devices (CCDs) particularly for space applications (APS requires only 1 voltage to operate which reduces considerably current consumption). Irradiation was performed using 60Co gamma radiation at room temperature and at a dose rate of 150 Gy(Si)/h. 2 types of APS have been tested: photodiode-APS and photoMOS-APS. The results show that photoMOS-APS is more sensitive to radiation effects than photodiode-APS. Important parameters of image sensors like dark currents increase sharply with dose levels. Nevertheless photodiode-APS sensitivity is one hundred time lower than photoMOS-APS sensitivity

  14. The Classificiation of Kepler B star Variables

    CERN Document Server

    McNamara, Bernard J; McKeever, Jean

    2012-01-01

    The light curves of 252 B-star candidates in the Kepler data base are analyzed in a similar fashion to that done by Balona et al. (2011) to further characterize B star variability, increase the sample of variable B stars for future study, and to identify stars whose power spectra include particularly interesting features such as frequency groupings. Stars are classified as either constant light emitters, $\\beta$ Cep stars, slowly pulsating B stars, hybrid pulsators, binaries or stars whose light curves are dominated by rotation (Bin/Rot), hot subdwarfs, or white dwarfs. One-hundred stars in our sample were found to be either light contants or to be variable at a level of less than 0.02 mmag. We increase the number of candidate B-star variables found in the Kepler data base by Balona et al. (2011) in the following fashion: $\\beta$ Cep stars from 0 to 10, slowly pulsating B stars from 8 to 54, hybrid pulsators from 7 to 21, and Bin/Rot stars from 23 to 82. For comparison purposes, approximately 51 SPBs and 6 hy...

  15. uvbybeta photometry of early type open cluster and field stars

    CERN Document Server

    Handler, G

    2011-01-01

    The beta Cephei stars and slowly pulsating B (SPB) stars are massive main sequence variables. The strength of their pulsational driving strongly depends on the opacity of iron-group elements. As many of those stars naturally occur in young open clusters, whose metallicities can be determined in several fundamental ways, it is logical to study the incidence of pulsation in several young open clusters. To provide the foundation for such an investigation, Str\\"omgren-Crawford uvbybeta photometry of open cluster target stars was carried out to determine effective temperatures, luminosities, and therefore cluster memberships. In the course of three observing runs, uvbybeta photometry for 168 target stars was acquired and transformed into the standard system by measurements of 117 standard stars. The list of target stars also included some known cluster and field beta Cephei stars, as well as beta Cephei and SPB candidates that are targets of the asteroseismic part of the Kepler satellite mission. The uvbybeta phot...

  16. The AP-2 family of transcription factors

    OpenAIRE

    Eckert, Dawid; Buhl, Sandra; Weber, Susanne; Jäger, Richard; Schorle, Hubert

    2005-01-01

    The AP-2 family of transcription factors consists of five different proteins in humans and mice: AP-2α, AP-2β, AP-2γ, AP-2δ and AP-2ε. Frogs and fish have known orthologs of some but not all of these proteins, and homologs of the family are also found in protochordates, insects and nematodes. The proteins have a characteristic helix-span-helix motif at the carboxyl terminus, which, together with a central basic region, mediates dimerization and DNA binding. The amino terminus contains the tra...

  17. Producing Runaway Stars

    Science.gov (United States)

    Kohler, Susanna

    2016-07-01

    LMC. When this speed is combined with the orbital velocity of the LMC itself (another ~380 km/s relative to the Milky Way), this could result in hypervelocity stars moving faster than the escape speed of the Milky Way, as observed.Predicted distribution of hypervelocity stars ejected from the LMC, in galactic coordinates. The red crosses show locations of detected hypervelocity stars, and the green arrow marks the path of the LMC over the last 350 million years. [Boubert Evans 2016]If the LMC is indeed ejecting hypervelocity stars along its orbit, this could explain an observed anisotropy in the hypervelocity stars weve detected, with many of these stars clustering in the constellations of Leo and Sextans. This clustering is consistent with stars ejected ahead of the LMCs orbit.How can we test this model for the production of hypervelocity stars? The authors model predicts the presence of a significant number of hypervelocity stars near the LMC in the southern hemisphere, a region which has been poorly surveyed before now. Surveys such as SkyMapper and Gaia, however, will observe this region and their discoveries (or lack thereof) should provide a useful test of whether hypervelocity stars are accelerated by the LMC.CitationDouglas Boubert and N. Wyn Evans 2016 ApJ 825 L6. doi:10.3847/2041-8205/825/1/L6

  18. Asteroseismology of Pulsating Stars

    Indian Academy of Sciences (India)

    Santosh Joshi; Yogesh C. Joshi

    2015-03-01

    The success of helioseismology is due to its capability of measuring -mode oscillations in the Sun. This allows us to extract information on the internal structure and rotation of the Sun from the surface to the core. Similarly, asteroseismology is the study of the internal structure of the stars as derived from stellar oscillations. In this review we highlight the progress in the observational asteroseismology, including some basic theoretical aspects. In particular, we discuss our contributions to asteroseismology through the study of chemically peculiar stars under the 'Nainital-Cape Survey' project being conducted at ARIES, Nainital, since 1999. This survey aims to detect new rapidly-pulsating Ap (roAp) stars in the northern hemisphere. We also discuss the contribution of ARIES towards the asteroseismic study of the compact pulsating variables. We comment on the future prospects of our project in the light of the new optical 3.6-m telescope to be installed at Devasthal (ARIES). Finally, we present a preliminary optical design of the high-speed imaging photometers for this telescope.

  19. Deletion mutants of AP-1 adaptin subunits display distinct phenotypes in fission yeast.

    Science.gov (United States)

    Ma, Yan; Takeuchi, Mai; Sugiura, Reiko; Sio, Susie O; Kuno, Takayoshi

    2009-08-01

    Adaptins are subunits of the heterotetrameric (beta/mu/gamma/sigma) adaptor protein (AP) complexes that are involved in clathrin-mediated membrane trafficking. Here, we show that in Schizosaccharomyces pombe the deletion strains of each individual subunit of the AP-1 complex [Apl2 (beta), Apl4 (gamma), Apm1 (mu) and Aps1 (sigma)] caused distinct phenotypes on growth sensitivity to temperature or drugs. We also show that the Deltaapm1 and Deltaapl2 mutants displayed similar but more severe phenotypes than those of Deltaaps1 or Deltaapl4 mutants. Furthermore, the Deltaapl2Deltaaps1 and Deltaapl2Deltaapl4 double mutants displayed synthetic growth defects, whereas the Deltaaps1Deltaapl4 and Deltaapl2Deltaapm1 double mutants did not. In pull-down assay, Apm1 binds Apl2 even in the absence of Aps1 and Apl4, and Apl4 binds Aps1 even in the absence of Apm1 and Apl2. Consistently, the deletion of any subunit generally caused the disassociation of the heterotetrameric complex from endosomes, although some subunits weakly localized to endosomes. In addition, the deletion of individual subunits caused similar endosomal accumulation of v-SNARE synaptobrevin Syb1. Altogether, results suggest that the four subunits are all essential for the heterotetrameric complex formation and for the AP-1 function in exit transport from endosomes. PMID:19624755

  20. The APS control system network

    International Nuclear Information System (INIS)

    The APS accelerator control system is a distributed system consisting of operator interfaces, a network, and computer-controlled interfaces to hardware. This implementation of a control system has come to be called the open-quotes Standard Model.close quotes The operator interface is a UNDC-based workstation with an X-windows graphical user interface. The workstation may be located at any point on the facility network and maintain full functionality. The function of the network is to provide a generalized communication path between the host computers, operator workstations, input/output crates, and other hardware that comprise the control system. The crate or input/output controller (IOC) provides direct control and input/output interfaces for each accelerator subsystem. The network is an integral part of all modem control systems and network performance will determine many characteristics of a control system. This paper will describe the overall APS network and examine the APS control system network in detail. Metrics are provided on the performance of the system under various conditions

  1. Knockdown of CDK2AP1 in primary human fibroblasts induces p53 dependent senescence.

    Directory of Open Access Journals (Sweden)

    Khaled N Alsayegh

    Full Text Available Cyclin Dependent Kinase-2 Associated Protein-1 (CDK2AP1 is known to be a tumor suppressor that plays a role in cell cycle regulation by sequestering monomeric CDK2, and targeting it for proteolysis. A reduction of CDK2AP1 expression is considered to be a negative prognostic indicator in patients with oral squamous cell carcinoma and also associated with increased invasion in human gastric cancer tissue. CDK2AP1 overexpression was shown to inhibit growth, reduce invasion and increase apoptosis in prostate cancer cell lines. In this study, we investigated the effect of CDK2AP1 downregulation in primary human dermal fibroblasts. Using a short-hairpin RNA to reduce its expression, we found that knockdown of CDK2AP1 in primary human fibroblasts resulted in reduced proliferation and in the induction of senescence associated beta-galactosidase activity. CDK2AP1 knockdown also resulted in a significant reduction in the percentage of cells in the S phase and an accumulation of cells in the G1 phase of the cell cycle. Immunocytochemical analysis also revealed that the CDK2AP1 knockdown significantly increased the percentage of cells that exhibited γ-H2AX foci, which could indicate presence of DNA damage. CDK2AP1 knockdown also resulted in increased mRNA levels of p53, p21, BAX and PUMA and p53 protein levels. In primary human fibroblasts in which p53 and CDK2AP1 were simultaneously downregulated, there was: (a no increase in senescence associated beta-galactosidase activity, (b decrease in the number of cells in the G1-phase and increase in number of cells in the S-phase of the cell cycle, and (c decrease in the mRNA levels of p21, BAX and PUMA when compared with CDK2AP1 knockdown only fibroblasts. Taken together, this suggests that the observed phenotype is p53 dependent. We also observed a prominent increase in the levels of ARF protein in the CDK2AP1 knockdown cells, which suggests a possible role of ARF in p53 stabilization following CDK2AP1

  2. CMOS Active Pixel Sensor Star Tracker with Regional Electronic Shutter

    Science.gov (United States)

    Yadid-Pecht, Orly; Pain, Bedabrata; Staller, Craig; Clark, Christopher; Fossum, Eric

    1996-01-01

    The guidance system in a spacecraft determines spacecraft attitude by matching an observed star field to a star catalog....An APS(active pixel sensor)-based system can reduce mass and power consumption and radiation effects compared to a CCD(charge-coupled device)-based system...This paper reports an APS (active pixel sensor) with locally variable times, achieved through individual pixel reset (IPR).

  3. Preparing Students for the AP Psychology Exam

    Science.gov (United States)

    Whitlock, Kristin

    2013-01-01

    The Advanced Placement Psychology exam is one of the fastest growing exams offered by the College Board. The average percent of change in the number of students taking this exam over the past five years is 12.4%. With 238,962 students taking the exam in 2013, the AP Psychology exam is the sixth largest exam, surpassing AP Biology and AP World…

  4. An AP Calculus Classroom Amusement Park

    Science.gov (United States)

    Ferguson, Sarah

    2016-01-01

    Throughout the school year, AP Calculus teachers strive to teach course content comprehensively and swiftly in an effort to finish all required material before the AP Calculus exam. As early May approaches and the AP Calculus test looms, students and teachers nervously complete lessons, assignments, and assessments to ensure student preparation.…

  5. Papel da lipoperoxidação na intensificação da remodelação causada pelo betacaroteno após o infarto Rol de la lipoperoxidación en la intensificación de la remodelación ocasionada por el betacaroteno tras infarto Role of lipoperoxidation in the remodeling intensification induced by beta-carotene after infarction

    Directory of Open Access Journals (Sweden)

    Paula S. Azevedo

    2009-07-01

    Full Text Available FUNDAMENTO: Os mecanismos envolvidos na maior remodelação causada pelo betacaroteno após o infarto são desconhecidos. OBJETIVO: Analisar o papel da lipoperoxidação na remodelação ventricular após o infarto do miocárdio, em ratos suplementados com betacaroteno. MÉTODOS: Ratos foram infartados e distribuídos em dois grupos: C (controle e BC (500mg/kg/dieta. Após seis meses, foram realizados ecocardiograma e avaliação bioquímica. Utilizamos o teste t, com significância de 5%. RESULTADOS: Os animais do grupo BC apresentaram maiores médias das áreas diastólicas (C = 1,57 ± 0,4 mm²/g, BC = 2,09 ± 0,3 mm²/g; p FUNDAMENTO: Los mecanismos implicados en la mayor remodelación ocasionada por betacaroteno tras el infarto son desconocidos. OBJETIVO: Analizar el rol que juega la lipoperoxidación en la remodelación ventricular tras el infarto de miocardio, en ratas suplementadas con betacaroteno. MÉTODOS: Se había inducido a un infarto a las ratas y se las distribuyó en grupos: C (control y BC (500mg/kg/dieta. Tras seis meses, se realizaron ecocardiograma y evaluación bioquímica. Utilizamos la prueba t, con significancia del 5%. RESULTADOS: Los animales del grupo BC presentaron mayores promedios de las áreas diastólicas (C = 1,57 ± 0,4 mm²/g, BC = 2,09 ± 0,3 mm²/g; p BACKGROUND: The mechanisms involved in the biggest remodeling caused by the post-infarct beta-carotene are unknown. OBJECTIVE: To analyze the role of lipoperoxidation in the ventricular remodeling after infarct of the myocardium in rats supplemented with beta-carotene. METHODS: Rats were infarcted and divided into two groups: C (control and BC (500mg/kg/regimen. After six months, echocardiogram and biochemical evaluation were performed. The t test was used, with 5% significance. RESULTS: The animals from BC group presented highest means of the diastolic (C = 1.57 ± 0.4 mm²/g, BC = 2.09 ± 0.3 mm²/g; p < 0.001 and systolic (C = 1.05 ± 0.3 mm²/g, BC = 1.61

  6. Testing of Solar Heated Domestic Hot Water System for Solahart Scandinavia ApS

    DEFF Research Database (Denmark)

    Andersen, Elsa

    1997-01-01

    The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report.......The solar heating system marketed by Solahart Scandinavia ApS was tested in the Institutes test facility for SDHWsystems. The test results are described in the report....

  7. Stars and Star Myths.

    Science.gov (United States)

    Eason, Oliver

    Myths and tales from around the world about constellations and facts about stars in the constellations are presented. Most of the stories are from Greek and Roman mythology; however, a few Chinese, Japanese, Polynesian, Arabian, Jewish, and American Indian tales are also included. Following an introduction, myths are presented for the following 32…

  8. Star Product and Star Exponential

    OpenAIRE

    Tomihisa, Toshio; Yoshioka, Akira

    2010-01-01

    Here we extend the star products by means of complex symmetric matrices. In this way we obtain a family of star products. Next we consider the star exponentials with respect to these star products, and finally we obtain several interesting identities.

  9. APS high heat load monochromator

    International Nuclear Information System (INIS)

    This document contains the design specifications of the APS high heat load (HHL) monochromator and associated accessories as of February 1993. It should be noted that work is continuing on many parts of the monochromator including the mechanical design, crystal cooling designs, etc. Where appropriate, we have tried to add supporting documentation, references to published papers, and calculations from which we based our decisions. The underlying philosophy behind performance specifications of this monochromator was to fabricate a device that would be useful to as many APS users as possible, that is, the design should be as generic as possible. In other words, we believe that this design will be capable of operating on both bending magnet and ID beamlines (with the appropriate changes to the cooling and crystals) with both flat and inclined crystal geometries and with a variety of coolants. It was strongly felt that this monochromator should have good energy scanning capabilities over the classical energy range of about 4 to 20 keywith Si (111) crystals. For this reason, a design incorporating one rotation stage to drive both the first and second crystals was considered most promising. Separate rotary stages for the first and second crystals can sometimes provide more flexibility in their capacities to carry heavy loads (for heavily cooled first crystals or sagittal benders of second crystals), but their tuning capabilities were considered inferior to the single axis approach

  10. Induction of anti-beta(2)-glycoprotein I autoantibodies in mice by protein H of Streptococcus pyogenes

    NARCIS (Netherlands)

    Van Os, G. M. A.; Meijers, J. C. M.; Agar, C.; Seron, M. V.; Marquart, J. A.; Akesson, P.; Urbanus, R. T.; Derksen, R. H. W. M.; Herwald, H.; Morgelin, M.; De Groot, P. G.

    2011-01-01

    Background: The antiphospholipid syndrome (APS) is characterized by the persistent presence of anti-beta 2-glycoprotein I (beta 2-GPI) autoantibodies. beta 2-GPI can exist in two conformations. In plasma it is a circular protein, whereas it adopts a fish-hook conformation after binding to phospholip

  11. Atomic diffusion and observations of pulsating A stars

    Science.gov (United States)

    Kurtz, D. W.

    2013-12-01

    Atomic diffusion - important in many contexts in stellar astrophysics and an important thread running through this meeting - is most spectacularly observable in the atmospheres of some A stars. The magnetic Ap stars and the non-magnetic Am stars show directly abundance anomalies caused by gravitational settling and radiative levitation. Over the last decade spectroscopic studies have begun to provide maps of abundance distributions in the magnetic Ap stars in three dimensions. Interestingly, high radial overtone p-mode pulsations in roAp stars have also given three-dimensional views of the stellar atmospheres with studies of rotational and line profile variations of pulsation amplitudes and phases. These detailed looks at the effects of microscopic atmospheric changes in the strongly non-LTE and magnetic upper atmospheric layers of Ap stars provide perhaps the most exciting challenge to atomic diffusion theory in terms of detailed explanation and prediction. Am stars were at one time thought not to pulsate because of gravitational settling of He from the He ii ionization zone that provides the κ-mechanism driving for δ Sct pulsations in A stars. In the last few years we have found with SuperWASP and Kepler observations that many Am stars do pulsate. More than half of all A stars pulsate at Kepler micromagnitude precision, yet there is a subset of A stars that truly do not pulsate at that level. Are these Am stars with the strongest signature of atomic diffusion? Is atomic diffusion the reason for the pulsational stability of these stars? The answers are not yet known.

  12. Structure in the motions of the fastest halo stars

    NARCIS (Netherlands)

    Fiorentin, PR; Helmi, A; Lattanzi, MG; Spagna, A

    2005-01-01

    We analyzed the catalog published by Beers et al. ( 2000, ApJ, 119, 2866) of 2106 non-kinematically selected metal poor stars in the solar neighborhood, with the goal of quantifying the amount of substructure in the motions of the fastest halo stars. We computed the two-point velocity correlation fu

  13. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star.......Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star....

  14. On AP-property of Function Spaces

    Institute of Scientific and Technical Information of China (English)

    SHEN Rong-xin

    2012-01-01

    In this paper,it is discussed the AP-property of function spaces.We prove that for any compact network α for a space X which is closed under finite unions,(1) if Cα(X) is an AP-space and X is paracompact,then X is a Hurewicz space; (2) if Cα (X) is an AP-space which has countable tightness,then Cα(X) is discretely generated.

  15. AP calculus AB & BC crash course

    CERN Document Server

    Rosebush, J

    2012-01-01

    AP Calculus AB & BC Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP Calculus AB & BC Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP Calculus AB & BC course description outline and actual AP test questions. It covers only the information tested on the exams, so you can make the most of your valuable study time. Written by experienced math teachers, our

  16. Massive Stars

    Science.gov (United States)

    Livio, Mario; Villaver, Eva

    2009-11-01

    Participants; Preface Mario Livio and Eva Villaver; 1. High-mass star formation by gravitational collapse of massive cores M. R. Krumholz; 2. Observations of massive star formation N. A. Patel; 3. Massive star formation in the Galactic center D. F. Figer; 4. An X-ray tour of massive star-forming regions with Chandra L. K. Townsley; 5. Massive stars: feedback effects in the local universe M. S. Oey and C. J. Clarke; 6. The initial mass function in clusters B. G. Elmegreen; 7. Massive stars and star clusters in the Antennae galaxies B. C. Whitmore; 8. On the binarity of Eta Carinae T. R. Gull; 9. Parameters and winds of hot massive stars R. P. Kudritzki and M. A. Urbaneja; 10. Unraveling the Galaxy to find the first stars J. Tumlinson; 11. Optically observable zero-age main-sequence O stars N. R. Walborn; 12. Metallicity-dependent Wolf-Raynet winds P. A. Crowther; 13. Eruptive mass loss in very massive stars and Population III stars N. Smith; 14. From progenitor to afterlife R. A. Chevalier; 15. Pair-production supernovae: theory and observation E. Scannapieco; 16. Cosmic infrared background and Population III: an overview A. Kashlinsky.

  17. Tracking debris disks within the Beta Pictoris Moving Group

    Science.gov (United States)

    Debes, J.

    2014-09-01

    Beta Pictoris represents a stunning example of a young planetary system with a debris disk, moving through local space with a host of other co-eval companion stars. These fellow travelers provide additional understanding for placing the Beta Pictoris disk into a proper context with regards to planet formation throughout the galaxy and our own Solar System. I will review the members of the Beta Pictoris moving group and catalog the latest results regarding the presence and understanding of debris disks around these other systems. Since these stars are close and very young, they represent an excellent opportunity for understanding the structure, composition, and grain properties of debris disks.

  18. Hadron star models. [neutron stars

    Science.gov (United States)

    Cohen, J. M.; Boerner, G.

    1974-01-01

    The properties of fully relativistic rotating hadron star models are discussed using models based on recently developed equations of state. All of these stable neutron star models are bound with binding energies as high as about 25%. During hadron star formation, much of this energy will be released. The consequences, resulting from the release of this energy, are examined.

  19. An investigation of the close environment of beta Cep with the VEGA/CHARA interferometer

    OpenAIRE

    Nardetto, N.; Mourard, D.; Tallon-Bosc, I.; Tallon, M.; Berio, P.; Chapellier, E.; Bonneau, D.; Chesneau, O.; Mathias, P; Perraut, K.; Stee, P.; Blazit, A.; Clausse, J.M.; Delaa, O.; Marcotto, A.

    2010-01-01

    High-precision interferometric measurements of pulsating stars help to characterize their close environment. In 1974, a close companion was discovered around the pulsating star beta Cep using the speckle interferometry technique and features at the limit of resolution (20 milli-arcsecond or mas) of the instrument were mentioned that may be due to circumstellar material. Beta Cep has a magnetic field that might be responsible for a spherical shell or ring-like structure around the star as desc...

  20. Coaching Strategies for AP: Building a Successful AP European History Program

    Science.gov (United States)

    Fornaciari, Jim

    2014-01-01

    The October 2013 special issue of "Social Education" dealt with almost all AP social studies subjects, but omitted AP European History. This is one of the most fascinating AP subjects for students and teachers alike. In this article, the author shares his experiences since hewas given the responsibility of building his school's…

  1. Mode selection in pulsating stars

    CERN Document Server

    Smolec, R

    2013-01-01

    In this review we focus on non-linear phenomena in pulsating stars the mode selection and amplitude limitation. Of many linearly excited modes only a fraction is detected in pulsating stars. Which of them and why (the problem of mode selection) and to what amplitude (the problem of amplitude limitation) are intrinsically non-linear and still unsolved problems. Tools for studying these problems are briefly discussed and our understanding of mode selection and amplitude limitation in selected groups of self-excited pulsators is presented. Focus is put on classical pulsators (Cepheids and RR Lyrae stars) and main sequence variables (delta Scuti and beta Cephei stars). Directions of future studies are briefly discussed.

  2. AP Courses Get Audited for Quality

    Science.gov (United States)

    Ashford, Ellie

    2007-01-01

    As the college admissions process has gotten much more competitive, the number of high school students taking Advanced Placement (AP) courses has soared. At the same time, policymakers and education leaders seek to get more minorities and students not on the college track to sign up for AP and other rigorous classes. But as high schools have…

  3. AP-42 ADDITIONS AND REVISIONS - WILDLAND FIRES

    Science.gov (United States)

    This project is aimed at consolidating, selecting, and disseminating the most appropriate data and methods for estimating air emissions from wildfires and prescribed burns. The product will replace a current section of AP-42, but may not take the precise form of an AP-42 secti...

  4. The status of APS, BESSRC, and NEET.

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Dunford, R. W.; Esbensen, H.; Gemmell, D. S.; Kanter, E. P.; Kraessig, B.; Rutt, U.; Southworth, S. H.

    1999-03-10

    We present a brief summary of the current status of the Advanced Photon Source (APS) at Argonne National Laboratory and of the facilities at two of the APS sectors operated by the Basic Energy Sciences Synchrotrons Radiation Center (BESSRC). This is followed by a report on recent measurements at BESSRC on the phenomenon of Nuclear Excitation by Electronic Transition (NEET).

  5. APS undulator radiation: First results

    International Nuclear Information System (INIS)

    The first undulator radiation has been extracted from the Advanced Photon Source (APS). The results from the characterization of this radiation are very satisfactory. With the undulator set at a gap of 15.8 mm (K=1.61), harmonics as high as the 17th were observed using a crystal spectrometer. The angular distribution of the third-harmonic radiation was measured, and the source was imaged using a zone plate to determine the particle beam emittance. The horizontal beam emittance was found to be 6.9 ± 1.0 nm-rad, and the vertical emittance coupling was found to be less than 3%. The absolute spectral flux was measured over a wide range of photon energies, and it agrees remarkably well with the theoretical calculations based on the measured undulator magnetic field profile and the measured beam emittance. These results indicate that both the emittance of the electron beam and the undulator magnetic field quality exceed the original specifications

  6. A Novel Dimeric Inhibitor Targeting Beta2GPI in Beta2GPI/Antibody Complexes Implicated in Antiphospholipid Syndrome

    Energy Technology Data Exchange (ETDEWEB)

    A Kolyada; C Lee; A De Biasio; N Beglova

    2011-12-31

    {beta}2GPI is a major antigen for autoantibodies associated with antiphospholipid syndrome (APS), an autoimmune disease characterized by thrombosis and recurrent pregnancy loss. Only the dimeric form of {beta}2GPI generated by anti-{beta}2GPI antibodies is pathologically important, in contrast to monomeric {beta}2GPI which is abundant in plasma. We created a dimeric inhibitor, A1-A1, to selectively target {beta}2GPI in {beta}2GPI/antibody complexes. To make this inhibitor, we isolated the first ligand-binding module from ApoER2 (A1) and connected two A1 modules with a flexible linker. A1-A1 interferes with two pathologically important interactions in APS, the binding of {beta}2GPI/antibody complexes with anionic phospholipids and ApoER2. We compared the efficiency of A1-A1 to monomeric A1 for inhibition of the binding of {beta}2GPI/antibody complexes to anionic phospholipids. We tested the inhibition of {beta}2GPI present in human serum, {beta}2GPI purified from human plasma and the individual domain V of {beta}2GPI. We demonstrated that when {beta}2GPI/antibody complexes are formed, A1-A1 is much more effective than A1 in inhibition of the binding of {beta}2GPI to cardiolipin, regardless of the source of {beta}2GPI. Similarly, A1-A1 strongly inhibits the binding of dimerized domain V of {beta}2GPI to cardiolipin compared to the monomeric A1 inhibitor. In the absence of anti-{beta}2GPI antibodies, both A1-A1 and A1 only weakly inhibit the binding of pathologically inactive monomeric {beta}2GPI to cardiolipin. Our results suggest that the approach of using a dimeric inhibitor to block {beta}2GPI in the pathological multivalent {beta}2GPI/antibody complexes holds significant promise. The novel inhibitor A1-A1 may be a starting point in the development of an effective therapeutic for antiphospholipid syndrome.

  7. Plan beta: Core or Cusp?

    CERN Document Server

    Richardson, Thomas; Lehnert, Matt

    2013-01-01

    The inner profile of Dark Matter (DM) halos remains one of the central problems in small-scale cosmology. At present, the problem can not be resolved in dwarf spheroidal galaxies due to a degeneracy between the DM profile and the velocity anisotropy beta of the stellar population. We discuss a method which can break the degeneracy by exploiting 3D positions and 1D line-of-sight (LOS) velocities. With the full 3D spatial information, we can determine precisely what fraction of each stars LOS motion is in the radial and tangential direction. This enables us to infer the anisotropy parameter beta directly from the data. The method is particularly effective if the galaxy is highly anisotropic. Finally, we argue that such a test could be applied to Sagittarius and potentially other dwarfs with RR Lyrae providing the necessary depth information.

  8. On the nature of the {delta} Scuti star HD 115520

    Energy Technology Data Exchange (ETDEWEB)

    Pena, J H; Cervantes-Sodi, B; Cano, M; Sorcia, M A [Instituto de AstronomIa, Universidad Nacional Autonoma de Mexico, Mexico D.F., Apdo. Postal 70-264 (Mexico); Fox, L; Alvarez, M [Observatorio Astronomico Nacional, Instituto de Astronomia, Universidad Nacional Autonoma de Mexico, Ensenada B.C., Apdo. Postal 877 (Mexico); Pena, R [Facultad de Ciencias, Universidad Nacional Autonoma de Mexico, Mexico D.F. (Mexico); Munoz, G; Vargas, B [Escuela Superior de Ingenier Mecanica y Electrica, Instituto Politecnico Nacional, Av. IPN s/n, 07738 Mexico, D.F. (Mexico); Sareyan, J P [Observatoire de la Cote d' Azur (France)], E-mail: jhpena@astroscu.unam.mx

    2008-10-15

    Observing Delta Scuti stars is most important as their multi-frequency spectrum of radial pulsations provide strong constraints on the physics of the stars interior; so any new detection and observation of these stars is a valuable contribution to asteroseismology. While performing uvby-beta photoelectric photometry of some RR Lyrae stars acquired in 2005 at the Observatorio Astronomico Nacional, Mexico, we also observed several standard stars, HD115520 among them. After the reduction this star showed indications of variability. In view of this, a new observing run was carried out in 2006 during which we were able to demonstrate its variability and its nature as a Delta Scuti star. New observations in 2007 permitted us to determine its periodic content with more accuracy. This, along with the uvby-beta photoelectric photometry allowed us to deduce its physical characteristics and pulsational modes.

  9. Chemical peculiarities in magnetic and non-magnetic pre-main sequence A and B stars

    CERN Document Server

    Folsom, C P; Wade, G A; Landstreet, J D; Alecian, E

    2013-01-01

    In A- and late B-type stars, strong magnetic fields are always associated with Ap and Bp chemical peculiarities. However, it is not clear at what point in a star's evolution those peculiarities develop. Strong magnetic fields have been observed in pre-main sequence A and B stars (Herbig Ae and Be stars), and these objects have been proposed to be the progenitors of Ap and Bp stars. However, the photospheric chemical abundances of these magnetic Herbig stars have not been studied carefully, and furthermore the chemical abundances of 'normal' non-magnetic Herbig stars remain poorly characterized. To investigate this issue, we have studied the photospheric compositions of 23 Herbig stars, four of which have confirmed magnetic fields. Surprisingly, we found that half the non-magnetic stars in our sample show lambda Bootis chemical peculiarities to varying degrees. For the stars with detected magnetic fields, we find one chemically normal star, one star with lambda Boo peculiarities, one star displaying weak Ap/Bp...

  10. Shooting stars

    Energy Technology Data Exchange (ETDEWEB)

    Maurette, M.; Hammer, C.

    A shooting star passage -even a star shower- can be sometimes easily seen during moonless black night. They represent the partial volatilization in earth atmosphere of meteorites or micrometeorites reduced in cosmic dusts. Everywhere on earth, these star dusts are searched to be gathered. This research made one year ago on the Greenland ice-cap is the object of this article; orbit gathering projects are also presented.

  11. Fênomeno de Raynaud grave associado a terapia com interferon-beta para esclerose múltipla: relato de caso

    OpenAIRE

    CRUZ BORIS AFONSO; QUEIROZ EUSTÁQUIO DE; SIMONE VILELA NUNESi; CRUZ FILHO ACHILES; CAMPOS GILBERTO BELISARIO; MONTEIRO ERNESTO LENTZ DE CARVALHO; CRIVELLARI HUMBERTO

    2000-01-01

    Interferon-B (IFN-beta) é usado no tratamento de esclerose múltipla (EM). Descrevemos o caso de uma mulher com EM que apresentou fenômeno de Raynaud grave, livedo reticular e necrose digital duas semanas após tratamento com IFN-beta. Os sintomas melhoraram após suspensão do IFN-beta e início de anticoagulação associada a ciclofosfamida e corticóide. Fenômeno de Raynaud é um efeito colateral provável da terapia com IFN-beta para EM.

  12. Generic effluent monitoring system certification for AP-40 exhauster stack

    Energy Technology Data Exchange (ETDEWEB)

    Glissmeyer, J.A.; Davis, W.E.; Bussell, J.H.; Maughan, A.D.

    1997-09-01

    Tests were conducted to verify that the Generic Effluent Monitoring System (GEMS), as applied to the AP-40 exhauster stack, meets all applicable regulatory performance criteria for air sampling systems at nuclear facilities. These performance criteria address both the suitability of the air sampling probe location and the transport of the sample to the collection devices. The criteria covering air sampling probe location ensure that the contaminants in the stack are well mixed with the airflow at the probe location such that the extracted sample represents the whole. The sample transport criteria ensure that the sampled contaminants are quantitatively delivered to the collection device. The specific performance criteria are described in detail in the report. The tests demonstrated that the GEMS/AP-40 system meets all applicable performance criteria. The contaminant mixing tests were conducted by Pacific Northwest National Laboratory (PNNL) at the wind tunnel facility, 331-H Building, using a mockup of the actual stack. The particle sample transport tests were conducted by PNNL at the Numatec Hanford Company`s 305 Building. The AP-40 stack is typical of several 10-in. diameter stacks that discharge the filtered ventilation air from tank farms at the U.S. Department of Energy`s Hanford Site in Richland, Washington. The GEMS design features a probe with a single shrouded sampling nozzle, a sample delivery line, and sample collection system. The collection system includes a filter holder to collect the sample of record and an in-line detector head and filter for monitoring beta radiation-emitting particles. Unrelated to the performance criteria, it was found that the record sample filter holder exhibited symptoms of sample bypass around the particle collection filter. This filter holder should either be modified or replaced with a different type. 10 refs., 8 figs., 6 tabs.

  13. No detection of large-scale magnetic fields at the surfaces of Am and HgMn stars

    CERN Document Server

    Auriere, M; Lignieres, F; Hui-Bon-Hoa, A; Landstreet, J D; Iliev, I; Donati, J -F; Petit, P; Roudier, T; Theado, S

    2010-01-01

    We investigate the magnetic dichotomy between Ap/Bp and other A-type stars by carrying out a deep spectropolarimetric study of Am and HgMn stars. Using the NARVAL spectropolarimeter at the Telescope Bernard Lyot (Observatoire du Pic du Midi, France), we obtained high-resolution circular polarisation spectroscopy of 12 Am stars and 3 HgMn stars. Using Least Squares Deconvolution (LSD), no magnetic field is detected in any of the 15 observed stars. Uncertaintiies as low as 0.3 G (respectively 1 G) have been reached for surface-averaged longitudinal magnetic field measurements for Am (respectively HgMn) stars. Associated with the results obtained previously for Ap/Bp stars, our study confirms the existence of a magnetic dichotomy among A-type stars. Our data demonstrate that there is at least one order of magnitude difference in field strength between Zeeman detected stars (Ap/Bp stars) and non Zeeman detected stars (Am and HgMn stars). This result confirms that the spectroscopically-defined Ap/Bp stars are the ...

  14. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded

  15. Tank 241-AP-107, grab samples, 7AP-99-1, 7AP-99-3 and 7AP-99-4 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    BELL, K.E.

    1999-08-12

    This document is the format IV, final report for the tank 241-AP-107 (AP-107) grab samples taken in May 1999 to address waste compatibility concerns. Chemical, radiochemical, and physical analyses on the tank AP-107 samples were performed as directed in Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999. Any deviations from the instructions provided in the tank sampling and analysis plan (TSAP) were discussed in this narrative. Interim data were provided earlier to River Protection Project (RPP) personnel, however, the data presented here represent the official results. No notification limits were exceeded.

  16. AP English language & composition crash course

    CERN Document Server

    Hogue, Dawn

    2012-01-01

    AP English Language & Composition Crash Course - Gets You a Higher Advanced Placement Score in Less Time Crash Course is perfect for the time-crunched student, the last-minute studier, or anyone who wants a refresher on the subject. AP English Language & Composition Crash Course gives you: Targeted, Focused Review - Study Only What You Need to Know Crash Course is based on an in-depth analysis of the AP English Language & Composition course description outline and actual Advanced Placement test questions. It covers only the information tested on the exam, so you can make the most of your valua

  17. Post-transcriptional control of negative acute phase genes by transforming growth factor beta.

    OpenAIRE

    Morrone, G; Cortese, R; Sorrentino, V

    1989-01-01

    During the acute phase (AP) reaction the expression of a series of liver-specific genes coding for secretory proteins is either stimulated or suppressed by different cytokines released by activated monocytes. Transforming growth factor beta (TGF-beta) is a cytokine that, first identified for its ability to regulate cellular growth, has been gradually recognized to modulate several other functions. We have investigated the effect of TGF-beta on the expression of acute phase genes in liver cell...

  18. Antibodies to endothelial cells and to beta 2-glycoprotein I in the antiphospholipid syndrome: prevalence and isotype distribution.

    Science.gov (United States)

    Navarro, M; Cervera, R; Teixidó, M; Reverter, J C; Font, J; López-Soto, A; Monteagudo, J; Escolar, G; Ingelmo, M

    1996-06-01

    The aim of this study was to analyse the prevalence and isotype distribution of antibodies to endothelial cells (aEC) and to beta 2-glycoprotein I (a beta 2GPI) in the antiphospholipid syndrome (APS). Fifteen patients with an APS [nine associated with systemic lupus erythematosus (SLE) and six "primary'] and 15 with SLE without an APS were prospectively studied. The aEC were determined by an enzyme-linked immunosorbent assay (ELISA) using endothelial cells derived from human umbilical vein and the a beta 2GPI by ELISA using highly purified beta 2GPI. A positive titre of aEC was detected in 20 out of 30 patients (67%), but in none of the control group. Ten patients had both IgG and IgM isotypes, five had IgG only and five had only IgM. Thirteen patients with the APS (87%) were found to have a positive titre of aEC, while only seven with SLE but without a history of APS (47%) had aEC (P < 0.05). Nine patients with the APS (60%) had a positive titre of a beta 2GPI (four had both IgG and IgM isotypes, one had IgG only and four had only IgM), while none of the patients without an APS (0%) had these antibodies (P < 0.001). A significant association was also found between the presence of aPL and aEC (P < 0.05), as well as between aPL and a beta 2GPI (P < 0.001). Both aEC and a beta 2GPI can be found in the APS. This reinforces the theory that APS represents a complex autoimmune disorder in which several autoantibodies co-exist with aPL.

  19. BETA-S, Multi-Group Beta-Ray Spectra

    International Nuclear Information System (INIS)

    1 - Description of program or function: BETA-S calculates beta-decay source terms and energy spectra in multigroup format for time-dependent radionuclide inventories of actinides, fission products, and activation products. Multigroup spectra may be calculated in any arbitrary energy-group structure. The code also calculates the total beta energy release rate from the sum of the average beta-ray energies as determined from the spectral distributions. BETA-S also provides users with an option to determine principal beta-decaying radionuclides contributing to each energy group. The CCC-545/SCALE 4.3 (or SCALE4.2) code system must be installed on the computer before installing BETA-S, which requires the SCALE subroutine library and nuclide-inventory generation from the ORIGEN-S code. 2 - Methods:Well-established models for beta-energy distributions are used to explicitly represent allowed, and 1., 2. - and 3. -forbidden transition types. Forbidden non-unique transitions are assumed to have a spectral shape of allowed transitions. The multigroup energy spectra are calculated by numerically integrating the energy distribution functions using an adaptive Simpson's Rule algorithm. Nuclide inventories are obtained from a binary interface produced by the ORIGEN-S code. BETA-S calculates the spectra for all isotopes on the binary interface that have associated beta-decay transition data in the ENSDF-95 library, developed for the BETA-S code. This library was generated from ENSDF data and contains 715 materials, representing approximately 8500 individual beta transition branches. 3 - Restrictions on the complexity of the problem: The algorithms do not treat positron decay transitions or internal conversion electrons. The neglect of positron transitions in inconsequential for most applications involving aggregate fission products, since most of the decay modes are via electrons. The neglect of internal conversion electrons may impact on the accuracy of the spectrum in the low

  20. Planetary companions in K giants beta Cancri, mu Leonis, and beta Ursae Minoris

    CERN Document Server

    Lee, B -C; Park, M -G; Mkrtichian, D E; Hatzes, A P; Kim, K -M

    2014-01-01

    Auns. The aim of our paper is to investigate the low-amplitude and long-period variations in evolved stars with a precise radial velocity (RV) survey. Methods. The high-resolution, the fiber-fed Bohyunsan Observatory Echelle Spectrograph (BOES) was used from 2003 to 2013 for a radial velocity survey of giant stars as part of the exoplanet search program at Bohyunsan Optical Astronomy Observatory (BOAO). Results. We report the detection of three new planetary companions orbiting the K giants beta Cnc, mu Leo, and beta UMi. The planetary nature of the radial velocity variations is supported by analyzes of ancillary data. The HIPPARCOS photometry shows no variations with periods close to those in RV variations and there is no strong correlation between the bisector velocity span (BVS) and the radial velocities for each star. Furthermore, the stars show weak or no core reversal in Ca II H lines indicating that they are inactive stars. The companion to beta Cnc has a minimum mass of 7.8 M_Jup in a 605-day orbit wi...

  1. Pentoxifylline Treatment in Acute Pancreatitis (AP)

    Science.gov (United States)

    2016-09-14

    Acute Pancreatitis (AP); Gallstone Pancreatitis; Alcoholic Pancreatitis; Post-ERCP/Post-procedural Pancreatitis; Trauma Acute Pancreatitis; Hypertriglyceridemia Acute Pancreatitis; Idiopathic (Unknown) Acute Pancreatitis; Medication Induced Acute Pancreatitis; Cancer Acute Pancreatitis; Miscellaneous (i.e. Acute on Chronic Pancreatitis)

  2. Confirmation of the magnetic nature of the delta Scuti star HD 21190

    Science.gov (United States)

    Hubrig, S.; Scholler, M.

    2016-06-01

    HD 21190 is a known delta Scuti star showing Ap star characteristics and a variability period of 3.6h discovered by the Hipparcos mission. Our previous spectropolarimetric observations with FORS1 at the VLT showed the presence of a rather weak magnetic field of the order of a few tens of Gauss. New spectropolarimetric measurements with FORS2 at the VLT reveal that the magnetic field in this star is much stronger, about -250G, indicating that also Ap stars can pulsate in the delta Scuti range.

  3. 51 Eri and GJ 3305: A 10-15 Myr old binary star system at 30 parsecs

    CERN Document Server

    Feigelson, E D; Stark, M; Townsley, L; Garmire, G P; State, P; State, Penn

    2005-01-01

    Following the suggestion of Zuckerman et al. (2001, ApJ, 562, L87), we consider the evidence that 51 Eri (spectral type F0) and GJ 3305 (M0), historically classified as unrelated main sequence stars in the solar neighborhood, are instead a wide physical binary system and members of the young beta Pic moving group (BPMG). The BPMG is the nearest (d < 50 pc) of several groups of young stars with ages around 10 Myr that are kinematically convergent with the Oph-Sco-Cen Association (OSCA), the nearest OB star association. Combining SAAO optical photometry, Hobby-Eberly Telescope high-resolution spectroscopy, Chandra X-ray data, and UCAC2 catalog kinematics, we confirm with high confidence that the system is indeed extremely young. GJ 3305 itself exhibits very strong magnetic activity but has rapidly depleted most of its lithium. The 51 Eri/GJ 3305 system is the westernmost known member of the OSCA, lying 110 pc from the main subgroups. The system is similar to the BPMG wide binary HD 172555/CD -64d1208 and the...

  4. Radio stars.

    Science.gov (United States)

    Hjellming, R M; Wade, C M

    1971-09-17

    Up to the present time six classes of radio stars have been established. The signals are almost always very faint and drastically variable. Hence their discovery has owed as much to serendipity as to the highly sophisticated equipment and techniques that have been used. When the variations are regular, as with the pulsars, this characteristic can be exploited very successfully in the search for new objects as well as in the detailed study of those that are already known. The detection of the most erratically variable radio stars, the flare stars and the x-ray stars, is primarily a matter of luck and patience. In the case of the novas, one at least knows where and oughly when to look for radio emission. A very sensitive interferometer is clearly the best instrument to use in the initial detection of a radio star. The fact that weak background sources are frequently present makes it essential to prove that the position of a radio source agrees with that of a star to within a few arc seconds. The potential of radio astronomy for the study of radio stars will not be realized until more powerful instruments than those that are available today can be utilized. So far, we have been able to see only the most luminous of the radio stars. PMID:17836594

  5. Star Imager

    DEFF Research Database (Denmark)

    Madsen, Peter Buch; Jørgensen, John Leif; Thuesen, Gøsta;

    1997-01-01

    The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol.......The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol....

  6. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star.......Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star....

  7. Tank 241-AP-106, Grab samples, 6AP-98-1, 6AP-98-2 and 6AP-98-3 Analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    FULLER, R.K.

    1999-02-23

    This document is the final report for tank 241-AP-106 grab samples. Three grab samples 6AP-98-1, 6AP-98-2 and 6AP-98-3 were taken from riser 1 of tank 241-AP-106 on May 28, 1998 and received by the 222-S Laboratory on May 28, 1998. Analyses were performed in accordance with the ''Compatability Grab Sampling and Analysis Plan'' (TSAP) (Sasaki, 1998) and the ''Data Quality Objectives for Tank Farms Waste Compatability Program (DQO). The analytical results are presented in the data summary report. No notification limits were exceeded. The request for sample analysis received for AP-106 indicated that the samples were polychlorinated biphenyl (PCB) suspects. The results of this analysis indicated that no PCBs were present at the Toxic Substance Control Act (TSCA) regulated limit of 50 ppm. The results and raw data for the PCB analysis are included in this document.

  8. Lactogenic differentiation of HC11 cells is not accompanied by downregulation of AP-2 transcription factor genes

    Directory of Open Access Journals (Sweden)

    Schorle Hubert

    2008-06-01

    Full Text Available Abstract Background During pregnancy the mammary epithelium undergoes a complex developmental process which culminates in the generation of the milk-secreting epithelium. Secretory epithelial cells display lactogenic differentiation which is characterized by the expression of milk protein genes, such as beta-casein or whey acidic protein (WAP. Transcription factors AP-2alpha and AP-2gamma are downregulated during lactation, and their overexpression in transgenic mice impaired the secretory differentiation of the mammary epithelium, resulting in lactation failure. To explore whether the downregulation of AP-2alpha and AP-2gamma is of functional significance for lactogenic differentiation, we analyzed the expression of the AP-2 family members during the lactogenic differentiation of HC11 mammary epithelial cells in vitro. Differentiation of HC11 cells was induced following established protocols by applying the lactogenic hormones prolactin, dexamethasone and insulin. Findings HC11 cells express all AP-2 family members except AP-2delta. Using RT-PCR we could not detect a downregulation of any of these genes during the lactogenic differentiation of HC11 cells in vitro. This finding was confirmed for AP-2alpha and AP-2gamma using Northern analysis. Differentiating HC11 cells displayed lower expression levels of milk protein genes than mammary glands of mid-pregnant or lactating mice. Conclusion The extent of lactogenic differentiation of HC11 cells in vitro is limited compared to mammary epithelium undergoing secretory differentiation in vivo. Downregulation of AP-2 transcription factor genes is not required for lactogenic differentiation of HC11 cells but may functionally be involved in aspects of lactogenic differentiation in vivo that are not reflected by the HC11 system.

  9. Magnetic fields of neutron stars

    CERN Document Server

    Reisenegger, Andreas

    2013-01-01

    Neutron stars contain the strongest magnetic fields known in the Universe. In this paper, I discuss briefly how these magnetic fields are inferred from observations, as well as the evidence for their time-evolution. I show how these extremely strong fields are actually weak in terms of their effects on the stellar structure, as is also the case for magnetic stars on the upper main sequence and magnetic white dwarfs, which have similar total magnetic fluxes. I propose a scenario in which a stable hydromagnetic equilibrium (containing a poloidal and a toroidal field component) is established soon after the birth of the neutron star, aided by the strong compositional stratification of neutron star matter, and this state is slowly eroded by non-ideal magnetohydrodynamic processes such as beta decays and ambipolar diffusion in the core of the star and Hall drift and breaking of the solid in its crust. Over sufficiently long time scales, the fluid in the neutron star core will behave as if it were barotropic, becau...

  10. Magnetic fields in non-convective regions of stars

    CERN Document Server

    Braithwaite, J

    2015-01-01

    We review the current state of knowledge of magnetic fields inside stars, concentrating on recent developments concerning magnetic fields in stably stratified (zones of) stars, leaving out convective dynamo theories and observations of convective envelopes. We include the observational properties of A, B and O-type main-sequence stars, which have radiative envelopes, and the fossil field model which is normally invoked to explain the strong fields sometimes seen in these stars. Observations seem to show that Ap-type stable fields are excluded in stars with convective envelopes. Most stars contain both radiative and convective zones, and there are potentially important effects arising from the interaction of magnetic fields at the boundaries between them, the solar cycle being one of the better known examples. Related to this, we discuss whether the Sun could harbour a magnetic field in its core. Recent developments regarding the various convective and radiative layers near the surfaces of early-type stars and...

  11. Revision of the Phenomenological Characteristics of the Algol-Type Stars Using the NAV Algorithm

    CERN Document Server

    Tkachenko, Mariia G; Chinarova, Lidia L

    2015-01-01

    Phenomenological characteristics of the sample of the Algol-type stars are revised using a recently developed NAV ("New Algol Variable") algorithm (2012Ap.....55..536A, 2012arXiv 1212.6707A) and compared to that obtained using common methods of Trigonometric Polynomial Fit (TP) or local Algebraic Polynomial (A) fit of a fixed or (alternately) statistically optimal degree (1994OAP.....7...49A, 2003ASPC..292..391A). The computer program NAV is introduced, which allows to determine the best fit with 7 "linear" and 5 "non-linear" parameters and their error estimates. The number of parameters is much smaller than for the TP fit (typically 20-40, depending on the width of the eclipse, and is much smaller (5-20) for the W UMa and beta Lyrae - type stars. This causes more smooth approximation taking into account the reflection and ellipsoidal effects (TP2) and generally different shapes of the primary and secondary eclipses. An application of the method to two-color CCD photometry to the recently discovered eclipsing...

  12. Horndeski's Stars

    CERN Document Server

    Cisterna, Adolfo; Rinaldi, Massimiliano

    2015-01-01

    We consider the sector of Horndeski's gravity characterized by a coupling between the kinetic scalar field term and the Einstein tensor. Our goal is to find realistic neutron star configurations in this framework. We show that, in a certain limit, there exist solutions that are identical to the Schwarzschild metric outside the star but change considerably inside, where the scalar field is not trivial. We study numerically the equations and find the region of the parameter space where neutron stars exist. We determine their internal pressure and mass-radius relation, and we compare them with standard general relativity models.

  13. Precision age indicators that exploit chemically peculiar stars

    CERN Document Server

    Worthey, Guy

    2015-01-01

    We would like to find a way to improve the determination of galaxy star formation history from integrated light spectroscopy. To this end, several classes of chemically peculiar (CP) stars arise during the course of normal evolution in single stars and noninteracting binary stars. An aging stellar population has periods of time in which CP stars contribute to the integrated light, and others in which the contributions fade. The HgMn stars, for example, occupy a narrow temperature range of 10500 to 16000 K, which maps to a narrow range of ages. Wolf-Rayet stars, He-poor stars, Bp-Ap stars, Am-Fm stars, and C stars all become very common in a normal stellar population at various ages between zero and several Gyr, fading in and out in a way that is analogous to features used in stellar spectral classification. We examine population fractions and light fractions in order to assess the feasibility of using CP stars as age tracers. We find that, even though CP stars do not usually dominate in number, there are enou...

  14. Star formation

    Energy Technology Data Exchange (ETDEWEB)

    Woodward, P.R.

    1978-09-27

    Theoretical models of star formation are discussed beginning with the earliest stages and ending in the formation of rotating, self-gravitating disks or rings. First a model of the implosion of very diffuse gas clouds is presented which relies upon a shock at the edge of a galactic spiral arm to drive the implosion. Second, models are presented for the formation of a second generation of massive stars in such a cloud once a first generation has formed. These models rely on the ionizing radiation from massive stars or on the supernova shocks produced when these stars explode. Finally, calculations of the gravitational collapse of rotating clouds are discussed with special focus on the question of whether rotating disks or rings are the result of such a collapse. 65 references.

  15. Star formation

    International Nuclear Information System (INIS)

    Theoretical models of star formation are discussed beginning with the earliest stages and ending in the formation of rotating, self-gravitating disks or rings. First a model of the implosion of very diffuse gas clouds is presented which relies upon a shock at the edge of a galactic spiral arm to drive the implosion. Second, models are presented for the formation of a second generation of massive stars in such a cloud once a first generation has formed. These models rely on the ionizing radiation from massive stars or on the supernova shocks produced when these stars explode. Finally, calculations of the gravitational collapse of rotating clouds are discussed with special focus on the question of whether rotating disks or rings are the result of such a collapse. 65 references

  16. Carbon Stars

    Indian Academy of Sciences (India)

    T. Lloyd Evans

    2010-12-01

    In this paper, the present state of knowledge of the carbon stars is discussed. Particular attention is given to issues of classification, evolution, variability, populations in our own and other galaxies, and circumstellar material.

  17. Rock Stars

    Institute of Scientific and Technical Information of China (English)

    张国平

    2000-01-01

    Around the world young people are spending unbelievable sums of money to listen to rock music. Forbes Magazine reports that at least fifty rock stars have incomes between two million and six million dollars per year.

  18. Tank 241-AP-107, grab samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Steen, F.H.

    1997-12-22

    This document is the final report for tank 241-AP-107 grab samples. Three grab samples were collected from riser 1 on September 11, 1997. Analyses were performed on samples 7AP-97-1, 7AP-97-2 and 7AP-97-3 in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1997) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Rev. 1: Fowler, 1995; Rev. 2: Mulkey and Nuier, 1997). The analytical results are presented in the data summary report (Table 1). A notification was made to East Tank Farms Operations concerning low hydroxide in the tank and a hydroxide (caustic) demand analysis was requested. The request for sample analysis (RSA) (Attachment 2) received for AP-107 indicated that the samples were polychlorinated biphenyl (PCB) suspects. Therefore, prior to performing the requested analyses, aliquots were made to perform PCB analysis in accordance with the 222-S Laboratory administrative procedure, LAP-101-100. The results of this analysis indicated that no PCBs were present at 50 ppm and analysis proceeded as non-PCB samples. The results and raw data for the PCB analysis will be included in a revision to this document. The sample breakdown diagrams (Attachment 1) are provided as a cross-reference for relating the tank farm customer identification numbers with the 222-S Laboratory sample numbers and the portion of sample analyzed.

  19. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Frigaard, Peter

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star....

  20. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Andersen, Thomas Lykke

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star....

  1. Center for Geometrisk Metrologi CGM ApS, Årsberetning 2001 til DANAK

    DEFF Research Database (Denmark)

    De Chiffre, Leonardo

    Denne årsberetning omfatter CGM ApS' akkrediterede virksomhed i kalenderåret 2001. Årsberetningen er udarbejdet til DANAK (Dansk Akkreditering, Erhvervsfremme Styrelsen), som led i opfyldelsen af laboratoriets informationspligt i henhold til gældende regler (Teknisk Forskrift Nr. TF4 af 2000.11.0...

  2. Building an AP Social Studies Program with Non-Traditional AP Students

    Science.gov (United States)

    Ashmead, Amanda; Blanchette, Sue

    2013-01-01

    Equal access to education, that is to a high quality education, has increasingly come to mean access to an Advanced Placement program. In recent years, there has been steady attention paid to opening access to AP programs. The 9th annual College Board report (2013) stated "students who succeed on an AP Exam during high school typically…

  3. A note on weighted Ap(G)-modules

    OpenAIRE

    ÖZTOP, Serap

    2011-01-01

    Let G be a locally compact abelian group and w be a weight function on G. In this paper, we show that the space Ap,w(G) is a Banach module over the Figà-Talamanca Herz algebra Ap(G) and study the multiplier space from Ap(G) to Ap,w(G).

  4. AP1000, a nuclear central of advanced design; AP1000, una central nuclear de diseno avanzado

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Viais J, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)]. e-mail: nhm@nuclear.inin.mx

    2005-07-01

    The AP1000 is a design of a nuclear reactor of pressurized water (PWR) of 1000 M We with characteristic of safety in a passive way; besides presenting simplifications in the systems of the plant, the construction, the maintenance and the safety, the AP1000 is a design that uses technology endorsed by those but of 30 years of operational experience of the PWR reactors. The program AP1000 of Westinghouse is focused to the implementation of the plant to provide improvements in the economy of the same one and it is a design that is derived directly of the AP600 designs. On September 13, 2004 the US-NRC (for their initials in United States- Nuclear Regulatory Commission) approved the final design of the AP1000, now Westinghouse and the US-NRC are working on the whole in a complete program for the certification. (Author)

  5. Color Superconducting Quark Matter in Neutron Stars

    OpenAIRE

    Heiselberg, H.

    1999-01-01

    Color superconductivity in quark matter is studied for electrically charge neutral neutron star matter in $\\beta$-equilibrium. Both bulk quark matter and mixed phases of quark and nuclear matter are treated. The electron chemical potential and strange quark mass affect the various quark chemical potentials and therefore also the color superconductivity due to dicolor pairing or color-flavor locking.

  6. Ectopic expression of FaesAP3, a Fagopyrum esculentum (Polygonaceae) AP3 orthologous gene rescues stamen development in an Arabidopsis ap3 mutant.

    Science.gov (United States)

    Fang, Zheng-wu; Qi, Rui; Li, Xiao-fang; Liu, Zhi-xiong

    2014-10-25

    Arabidopsis thaliana APETALA3 (AP3) and Antirrhinum majus DEFICIENS (DEF) MADS box genes are required to specify petal and stamen identity. AP3 and DEF are members of the euAP3 lineage, which arose by gene duplication coincident with radiation of the core eudicots. In order to investigate the molecular mechanisms underlying organ development in early diverging clades of core eudicots, we isolated and identified an AP3 homolog, FaesAP3, from Fagopyrum esculentum (buckwheat, Polygonaceae), a multi-food-use pseudocereal with healing benefits. Protein sequence alignment and phylogenetic analyses revealed that FaesAP3 grouped into the euAP3 lineage. Expression analysis showed that FaesAP3 was transcribed only in developing stamens, and differed from AP3 and DEF, which expressed in developing petals and stamens. Moreover, ectopic expression of FaesAP3 rescued stamen development without complementation of petal development in an Arabidopsis ap3 mutant. Our results suggest that FaesAP3 is involved in the development of stamens in buckwheat. These results also suggest that FaesAP3 holds some potential for biotechnical engineering to create a male sterile line of F. esculentum. PMID:25149019

  7. Expression of a novel beta adaptin subunit mRNA splice variant in human testes

    Institute of Scientific and Technical Information of China (English)

    Xin-Dong Zhang; Lan-Lan Yin; Ying Zheng; Li Lu; Zuo-Min Zhou; Jia-Hao Sha

    2005-01-01

    Aim: To identify a novel isoform of adaptin 2 beta subunit (named Ap2β-NY) and to investigate its relationship with testicular development and spermatogenesis. Methods: Using a human testis cDNA microarray, a clone (Ap2β-NY),which was strongly expressed in adult testes but weakly expressed in embryo testes, was sequenced and analyzed.Using polymerase chain reaction (PCR), the tissue distribution and expression time pattern of Ap2β-NY were determined.Results: Ap2β-NY was identified and has been deposited in the GenBank (AY341427). The expression level of Ap2β-NY in the adult testis was about 3-fold higher than that in the embryo testis. PCR analysis using multi-tissue cDNA indicated that Ap2β-NY was highly expressed in the testis, spleen, thymus, prostate, ovary, blood leukocyte and brain, but not in the heart, placenta, lung, liver, skeletal muscle, kidney and pancreas. In addition, Ap2β-NY was variably expressed in the testes of patients with spermatogenesis-disturbance and spermatogenesis-arrest but not expressed in those of Sertoli-cell-only syndrome, which implied that, in the testis, Ap2β-NY was restrictively expressed in germ cells. Conclusion: Ap2β-NY is an isoform of Ap2β and may be involved in regulating the process of spermatogenesis and testis development.

  8. An analysis of AP600 design features

    Energy Technology Data Exchange (ETDEWEB)

    Park, Jong Kyoon; Jang, Moon Heui; Hwang, Yung Dong [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)] [and others

    1994-01-01

    In the aspect of engineering, passive safety system concept has improved the safety degree of nuclear power plant. Therefore, the objective of this study is to check on the possibility of the capacity upgrade of nuclear power plant in the case of adopting the passive safety system concept of AP 600. The characteristics of AP 600 are the advanced functions in ECCS, heat removal of containment building and residual heat removal under the passive safety system concept. The result of this study will become the basic data of capacity upgrade of nuclear power plant and will be widely used in second year project. (Author).

  9. Formalistic approaches to A&P

    Institute of Scientific and Technical Information of China (English)

    赵倩

    2014-01-01

    A&P is a famous short story. Its simple words, the unique point of view and skillful writing technique are expressed successfully. Besides, the first-person narrator is also a good point. From Sammy’s eyes, readers can learn the character’s characteristics. Another point is the usage of symbol, the name of the store, A&P, it shows that people’s life is rich, but their spirit is barren. This article tries to analyze it by formalistic approaches.

  10. Fênomeno de Raynaud grave associado a terapia com interferon-beta para esclerose múltipla: relato de caso Severe Raynaud's phenomenon associated with interferon-beta therapy for multiple sclerosis: case report

    OpenAIRE

    BORIS AFONSO CRUZ; EUSTÁQUIO DE QUEIROZ; SIMONE VILELA NUNESi; ACHILES CRUZ FILHO; GILBERTO BELISARIO CAMPOS; ERNESTO LENTZ DE CARVALHO MONTEIRO; HUMBERTO CRIVELLARI

    2000-01-01

    Interferon-B (IFN-beta) é usado no tratamento de esclerose múltipla (EM). Descrevemos o caso de uma mulher com EM que apresentou fenômeno de Raynaud grave, livedo reticular e necrose digital duas semanas após tratamento com IFN-beta. Os sintomas melhoraram após suspensão do IFN-beta e início de anticoagulação associada a ciclofosfamida e corticóide. Fenômeno de Raynaud é um efeito colateral provável da terapia com IFN-beta para EM.Interferon-beta (IFN-beta) is administered for treatment of mu...

  11. A new highly efficient beta-glucosidase from the novel species, Aspergillus saccharolyticus

    DEFF Research Database (Denmark)

    Sørensen, Annette

    extract of strain AP was compared with Novozym 188 and Cellic CTec. In terms of cellobiose hydrolysis, the extract of strain AP was found to be a valid substitute for Novozym 188, corresponding to the previous result where filter cake inoculated with the fungus was directly used in hydrolysis...... region, partial beta-tubuline gene, and partial calmodulin gene placed strain AP on a separate branch in phylogenetic trees prepared with other black aspergilli, and universally primed PCR furthermore readily distinguished strain AP data from other black aspergilli. We named the novel species A....... The extract from this fungus, mentioned above, was fractionated by ion exchange chromatography, obtaining fractions pure enough that a specific SDS-page gel protein band of high beta-glucosidase activity could be excised and analyzed by LC-MS/MS. Using the peptide matches for design of degenerate primers...

  12. Levered and unlevered Beta

    OpenAIRE

    Fernandez, Pablo

    2003-01-01

    We prove that in a world without leverage cost the relationship between the levered beta ( L) and the unlevered beta ( u) is the No-costs-of-leverage formula: L = u + ( u - d) D (1 - T) / E. We also analyze 6 alternative valuation theories proposed in the literature to estimate the relationship between the levered beta and the unlevered beta (Harris and Pringle (1985), Modigliani and Miller (1963), Damodaran (1994), Myers (1974), Miles and Ezzell (1980), and practitioners) and prove that all ...

  13. Realized Beta GARCH

    DEFF Research Database (Denmark)

    Hansen, Peter Reinhard; Lunde, Asger; Voev, Valeri Radkov

    2014-01-01

    as the beta. We apply the model to a large set of assets and find the conditional betas to be far more variable than usually found with rolling-window regressions based exclusively on daily returns. In the empirical part of the paper, we examine the cross-sectional as well as the time variation...... of the conditional beta series during the financial crises....

  14. Glycopeptide profiling of beta-2-glycoprotein I by mass spectrometry reveals attenuated sialylation in patients with antiphospholipid syndrome

    DEFF Research Database (Denmark)

    Kondo, Akira; Miyamoto, Toshiaki; Yonekawa, Osamu;

    2009-01-01

    or exposing the Gly40-Arg43 motif towards the anti-beta2GPI autoantibody. To test this hypothesis we used mass spectrometry (MS) for comparative glycopeptide profiling of human beta2GPI obtained from blood serum from four healthy test subjects and six APS patients. It revealed significant differences...... structures, as compared to controls. These data indicate that some APS patients have beta2GPI molecules with a reduced number of negatively charged sialic acid units in the glycan structure at Asn-143. This alteration of the electrostatic properties of the glycan moiety may attenuate the intramolecular...

  15. Two Successful Approaches to Teaching AP Government

    Science.gov (United States)

    Ladd, Brian; Stepp, Heidi

    2013-01-01

    Amador Valley High School, in Pleasanton, California, uses two unique approaches to teaching Advanced Placement Government and Politics. AP Government consists of six units: Constitutional Underpinnings; Political Behavior and Political Beliefs; Mass Media, Interest Groups, and Political Parties; Institutions of Government; Civil Liberties and…

  16. 2000 Johnston Site 3A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 3A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on July 3, 2000. With a start point (meter 0) at...

  17. 2000 Johnston Site 2A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 2A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 30, 2000. With a start point (meter 0) at...

  18. The Demographic Wave: Rethinking Hispanic AP Trends

    Science.gov (United States)

    Edwards, Kelcey; Sawtell, Ellen

    2013-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Las Vegas, NV in July 2013. This presentation reviews new research examining the AP® experience of Hispanic graduates over the past decade. Topics include an in-depth look at the AP Spanish Language and Culture gateway hypothesis and trends in family characteristics such as parent…

  19. 2006 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  20. 2000 Johnston Site 1A-P

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Underwater Site 1A-P was established at Johnston Atoll by Dr. James Maragos, U.S. Fish & Wildlife Service, on June 29, 2000. With a start point (meter 0) at...

  1. Structuring the AP Art History Course

    Science.gov (United States)

    Herscher, Walter R.

    2013-01-01

    While AP (Advanced Placement) Art History may be taught within the art department in many schools, social studies teachers are equally capable of teaching the course well. They have the historical background to discuss the reasons for changes in art styles. A teacher's preparation is similar to teaching a course stressing political history,…

  2. Prospecting for planets in circumstellar dust - Sifting the evidence from Beta Pictoris

    Science.gov (United States)

    Diner, D. J.; Appleby, J. F.

    1986-01-01

    IRAS and near-IR coronographic data for the A5V star Beta Pic are analyzed for evidence of planetary formation. The light scattered from the central star in the system is integrated along the distance to the star to determine the disk magnitude at various distances from the star. A modified gamma distribution is applied to evaluate the scattering coefficient to test a hypothesis that the inner 30 AU of the disk has been swept out by planets. The scattering from the region around Beta Pic is compared with scattering around other A5V stars. Finally, the IR data at 0.89 micron is compared with scattering at the coronograph wavelengths. No evidence is found to support the hypothesis of clearing in the inner disk, although large particle densities can be found very close to Beta Pic. The study illustrates the effectiveness of using scattered light and IR data to discover and characterize matter distributions circumstellar disks.

  3. Rainbow's Stars

    CERN Document Server

    Garattini, Remo

    2016-01-01

    In recent years, a growing interest on the equilibrium of compact astrophysical objects like white dwarf and neutron stars has been manifested. In particular, various modifications due to Planck scale energy effects have been considered. In this paper we analyze the modification induced by Gravity's Rainbow on the equilibrium configurations described by the Tolman-Oppenheimer-Volkoff (TOV) equation. Our purpose is to explore the possibility that the Rainbow Planck-scale deformation of space-time could support the existence of different compact stars.

  4. A survey for pulsations in A-type stars using SuperWASP

    Science.gov (United States)

    Holdsworth, Daniel L.

    2015-12-01

    "It is sound judgement to hope that in the not too distant future we shall be competent to understand so simple a thing as a star." - Sir Arthur Stanley Eddington, The Internal Constitution of Stars, 1926 A survey of A-type stars is conducted with the SuperWASP archive in the search for pulsationally variable stars. Over 1.5 million stars are selected based on their (J-H) colour. Periodograms are calculated for light curves which have been extracted from the archive and cleaned of spurious points. Peaks which have amplitudes greater than 0.5 millimagnitude are identified in the periodograms. In total, 202 656 stars are identified to show variability in the range 5-300 c/d. Spectroscopic follow-up was obtained for 38 stars which showed high-frequency pulsations between 60 and 235 c/d, and a further object with variability at 636 c/d. In this sample, 13 were identified to be normal A-type δ Sct stars, 14 to be pulsating metallic-lined Am stars, 11 to be rapidly oscillating Ap (roAp) stars, and one to be a subdwarf B variable star. The spectra were used not only to classify the stars, but to determine an effective temperature through Balmer line fitting. Hybrid stars have been identified in this study, which show pulsations in both the high- and low-overtone domains; an observation not predicted by theory. These stars are prime targets to perform follow-up observations, as a confirmed detection of this phenomenon will have significant impact on the theory of pulsations in A-type stars. The detected number of roAp stars has expanded the known number of this pulsator class by 22 per cent. Within these results both the hottest and coolest roAp star have been identified. Further to this, one object, KIC 7582608, was observed by the Kepler telescope for 4 yr, enabling a detailed frequency analysis. This analysis has identified significant frequency variations in this star, leading to the hypothesis that this is the first close binary star of its type. The observational

  5. Tank 241-AP-106, grab samples, 6AP-96-1 through 6AP-96-3 analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Esch, R.A., Westinghouse Hanford

    1996-12-11

    This document is the final report for tank 241-AP-106 grab samples. This document presents the analytical results for three samples (6AP-96-1, 6AP-96-2 and 6AP-96-3) taken from riser 1 @ 150{degrees} of tank 241-AP-1 06 on September 12, 1996. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) (Sasaki, 1996) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler, 1995).

  6. Rapidly varying A-type stars in the SuperWASP archive

    CERN Document Server

    Holdsworth, Daniel L

    2013-01-01

    The searches for transiting exoplanets have produced a vast amount of time-resolved photometric data of many millions of stars. One of the leading ground-based surveys is the SuperWASP project. We present the initial results of a survey of over 1.5 million A-type stars in the search for high frequency pulsations using SuperWASP photometry. We are able to detect pulsations down to the 0.5 mmag level in the broad-band photometry. This has enabled the discovery of several rapidly oscillating Ap stars and over 200 delta Scuti stars with frequencies above 50 d$^{-1}$, and at least one pulsating sdB star. Such a large number of results allows us to statistically study the frequency overlap between roAp and delta Scuti stars and probe to higher frequency regimes with existing data.

  7. The Clathrin Adaptor AP-1A Mediates Basolateral Polarity

    OpenAIRE

    Gravotta, Diego; Carvajal-Gonzalez, Jose Maria; Mattera, Rafael; Deborde, Sylvie; Banfelder, Jason R.; Bonifacino, Juan S.; Rodriguez-Boulan, Enrique

    2012-01-01

    Clathrin and the epithelial-specific clathrin adaptor AP-1B mediate basolateral trafficking in epithelia. However, several epithelia lack AP-1B and mice knocked-out for AP-1B are viable, suggesting the existence of additional mechanisms that control basolateral polarity. Here, we demonstrate a distinct role of the ubiquitous clathrin adaptor AP-1A in basolateral protein sorting. Knock-down of AP-1A causes missorting of basolateral proteins in MDCK cells but only after knock-down of AP-1B, sug...

  8. Star Product and Applications

    OpenAIRE

    Iida, Mari; Yoshioka, Akira

    2011-01-01

    A family of star products parametrized by complex matrices is defined. Especially commutative associative star products are treated, and star exponentials with respect to these star products are considered. Jacobi's theta functions are given as infinite sums of star exponentials. As application, several concrete identities are obtained by properties of the star exponentials.

  9. Dynamics of intracellular clathrin/AP1 and clathrin/AP3 containing carriers

    OpenAIRE

    2012-01-01

    Clathrin/AP1 and clathrin/AP3 coated vesicular carriers originate from endosomes and the TGN. We report here the real-time visualization of these structures in living cells reliably tracked by using rapid, three-dimensional imaging with a spinning-disk confocal microscope. We imaged relatively sparse, diffraction-limited, fluorescent objects containing chimeric fluorescent protein (clathrin light chain, σ adaptor subunits or dynamin2) with a spatial precision of up to ~ 30 nm and a temporal r...

  10. Stars Underground

    CERN Multimedia

    Jean Leyder

    1996-01-01

    An imaginary voyage in time where we were witness of the birth of the universe itself, the time of the Big-Bang 15 billion years ago. Particules from the very first moments of time : protons, neutrons and electrons, and also much more energetic one. These particules are preparing to interact collider and generating others which will be the birth to the stars ........

  11. Pulsating stars

    CERN Document Server

    Catelan, M?rcio

    2014-01-01

    The most recent and comprehensive book on pulsating stars which ties the observations to our present understanding of stellar pulsation and evolution theory.  Written by experienced researchers and authors in the field, this book includes the latest observational results and is valuable reading for astronomers, graduate students, nuclear physicists and high energy physicists.

  12. Comparative analysis between radiographic views for knee osteoarthrosis (bipedal AP versus monopedal AP

    Directory of Open Access Journals (Sweden)

    Rodrigo Pires e Albuquerque

    2013-08-01

    Full Text Available OBJECTIVE: A comparative analysis by applying the criteria of the original classification Ahlbäck in the anteroposterior (AP bipedal knee in extension and anteroposterior (AP monopodal knee in symptomatic knee arthrosis. With this analysis we intend to observe the agreement, any advantage or difference between the incidence and degree of joint involvement between the orthopedic surgeons and radiologists with the referring physician. METHODS: From January 2012 to March 2012, was a prospective study of 60 symptomatic arthrosis knees (60 patients, clinically selected group of outpatient knee and radiographic proposals submitted to the search. Of the 60 patients, 39 were female and 21 male, mean age 64 years (ranging from 50 to 84 years. Of the 60 knees studied, 37 corresponded to the right side and 23 on the left side. Statistical analysis was performed by Kappa statistics, which evaluates the interobserver agreement for qualitative data. RESULTS: According to the scale of Ahlbäck, there was a significant agreement (p < 0.0001 intra-observer in the classification of knee osteoarthritis among the five evaluators. There was a significant agreement (p < 0.0001 with inter-observer referring physician in the incidence of AP monopodal and AP bipedal for the four raters. CONCLUSION: The study found no difference between the incidence in the AP monopodal versus AP bipedal in osteoarthritis of the knee.

  13. Sequential comparison of therapy with beta-blockers and calcium channel blockers with celiprolol therapy in patients with angina pectoris, hypertension, or both

    NARCIS (Netherlands)

    Cleophas, TJM; Niemeyer, MG; Bernink, PJLM; Zwinderman, KH; Wijk, AV; Wall, EEVD

    1996-01-01

    Unlike patients with either hypertension (HT) of angina pectoris (AP) alone, patients with both HT and AP usually have a reduced left ventricular compliance and may, therefore, have an impaired capability to cope with acute hemodynamic changes generated by standard beta-blockers or calcium channel b

  14. The AP-1A and AP-1B clathrin adaptor complexes define biochemically and functionally distinct membrane domains

    OpenAIRE

    Fölsch, Heike; Pypaert, Marc; Maday, Sandra; Pelletier, Laurence; Mellman, Ira

    2003-01-01

    Most epithelial cells contain two AP-1 clathrin adaptor complexes. AP-1A is ubiquitously expressed and involved in transport between the TGN and endosomes. AP-1B is expressed only in epithelia and mediates the polarized targeting of membrane proteins to the basolateral surface. Both AP-1 complexes are heterotetramers and differ only in their 50-kD μ1A or μ1B subunits. Here, we show that AP-1A and AP-1B, together with their respective cargoes, define physically and functionally distinct membra...

  15. Magnetic fields and UV-line variability in $\\beta$ Cephei

    CERN Document Server

    Schnerr, R S; Owocki, S P; ud-Doula, A; Townsend, R H D

    2006-01-01

    We present results of numerical simulations of wind variability in the magnetic B1 IVe star $\\beta$ Cephei. 2D-MHD simulations are used to determine the structure of the wind. From these wind models we calculate line profiles for different aspect angles to simulate rotation. The results are compared with the observed UV wind line profiles.

  16. Magnetic Fields and UV-line Variability in beta Cephei

    NARCIS (Netherlands)

    R.S. Schnerr; H.F. Henrichs; S.P. Owocki; A. ud-Doula; R.H.D. Townsend

    2007-01-01

    We present results of numerical simulations of wind variability in the magnetic B1 IVe star beta Cephei. 2D-MHD simulations are used to determine the structure of the wind. From these wind models we calculate line profiles for different aspect angles to simulate rotation. The results are compared wi

  17. APS storage ring vacuum system performance

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) storage ring was designed to operated with 7-GeV, 100-mA positron beam with lifetimes > 20 hours. The lifetime is limited by residual gas scattering and Touschek scattering at this time. Photon-stimulated desorption and microwave power in the rf cavities are the main gas loads. Comparison of actual system gas loads and design calculations will be given. In addition, several special features of the storage ring vacuum system will be presented

  18. Cultural Diversity in AP Art History

    Science.gov (United States)

    Bolte, Frances R.

    2006-01-01

    Teaching AP Art History is like running on a treadmill that is moving faster than a teacher can run. Many teachers are out of breath before the end of the term and wonder how in the world they can cover every chapter. Because time is short and art from pre-history through to the present, including the non-European traditions, must be covered, this…

  19. Helium stratification in HD 145792: a new Helium strong star

    OpenAIRE

    Catanzaro, G

    2007-01-01

    In this paper we report on the real nature of the star HD 145792, classified as He weak in {\\it ``The General Catalogue of Ap and Am stars''}. By means of high resolution spectroscopic data, we refined the atmospheric parameters of the star, obtaining: T$_{\\rm eff}$ = 14400 $\\pm$ 400 K, $\\log g$ = 4.06 $\\pm$ 0.08 and $\\xi$ = 0 $^{+0.6}$ km s$^{-1}$. These values resulted always lower than those derived by different authors with pure photometric approaches. Using our values we u...

  20. ROSAT and EUVE observations of B stars

    Science.gov (United States)

    Cassinelli, Joseph P.

    1994-11-01

    Recent observations of the X-ray and EUV emission of non-supergiant B stars are summarized. As compared with O stars, the X-rays of most of the near-main-sequence B stars are soft, and the stars show a departure from the Lx = 1007Lbol relation. Using line driven wind models to provide an estimate of the density distribution, it is concluded that a major fraction of the wind emission measure is hot, whereas in shocked wind theory less than 10 percent of the wind emission measure should be hot. The X-ray observations suggest that all of the B stars are X-ray emitters with a basal X-ray luminosity of about 10-8.5Lbol. For the Be stars, the X-ray emission is that which is expected from a normal B-star wind coming from the poles, as in the Wind Compressed Disk (WCD) model of Be-stars. None of the stars, including the beta Cep stars, show noticeable variability in their X-rays. Extreme Ultraviolet Explorer (EUVE) observations of epsilon CMa B2 II, find it to be the brightest object in the EUV sky at 500 to 700 A. It shows a Lyman continuum flux that is a factor of 30 higher than line blanketed model atmospheres. The EUVE spectra show emission lines both from high stages of ionization ( Fe IX to Fe XVI) and from low stages ( HeII and O III). The He II Lyman alpha results from recombination follwing X-ray photoionization in the wind, and the O III resonance line is found to be present because of the Bowen fluorescence mechanism. Thus, there is and intersting coupling between the wind production by the EUV photospheric emission, the production of X-ray and line EUV emission by winds, and the production of fluorescence by recombination in the wind; all of these processes are now observable in B stars.

  1. AP-42 ADDITIONS AND REVISIONS - RESIDENTIAL WOOD COMBUSTION

    Science.gov (United States)

    This project develops emission factors, etc., for residential fireplaces and woodstoves which are incorporated into AP-42. AP42 is a massive collection of material which describes processes which generate air emissions and presents emission factors and control effectiveness infor...

  2. Dicty_cDB: FC-AP07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP07 (Link to dictyBase) - - - Contig-U15932-1 FC-AP07P (Li...nk to Original site) FC-AP07F 546 FC-AP07Z 446 FC-AP07P 992 - - Show FC-AP07 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP07Q.Seq.d/ Representative seq. ID FC-AP...07P (Link to Original site) Representative DNA sequence >FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP...ificant alignments: (bits) Value FC-AP07 (FC-AP07Q) /CSM/FC/FC-AP/FC-AP07Q.Seq.d/ 1148 0.0 SSM404 (SSM404Q)

  3. Dicty_cDB: FC-AP08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP08 (Link to dictyBase) - - - Contig-U16116-1 FC-AP08P (Li...nk to Original site) FC-AP08F 125 FC-AP08Z 352 FC-AP08P 477 - - Show FC-AP08 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP08Q.Seq.d/ Representative seq. ID FC-AP...08P (Link to Original site) Representative DNA sequence >FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP... (VSA612Q) /CSM/VS/VSA6-A/VSA612Q.Seq.d/ 624 e-178 FC-AP08 (FC-AP08Q) /CSM/FC/FC-AP/FC-AP

  4. AP Deployment Research Based on Physical Distance and Channel Isolation

    OpenAIRE

    Dangui Yan; Chengchang Zhang; Honghua Liao; Lisheng Yang; Ping Li; Guogang Yang

    2014-01-01

    Aiming at the problem of inefficiency of wireless local area networks (WLAN) access point (AP) deployment in urban environment, a new algorithm for AP deployment based on physical distance and channel isolation (DPDCI) is proposed. First, it detects the position information of deployed APs and then calculates the interference penalty factor combined with physical distance and channel isolation, and finally gets the optimal location and channel of the new AP through the genetic algorithm. Comp...

  5. Neutron Star Properties with Hyperons

    OpenAIRE

    Whittenbury, D. L.; Carroll, J D; Thomas, A. W.; Tsushima, K; Stone, J. R.

    2012-01-01

    In the light of the recent discovery of a neutron star with a mass accurately determined to be almost two solar masses, it has been suggested that hyperons cannot play a role in the equation of state of dense matter in $\\beta$-equilibrium. We re-examine this issue in the most recent development of the quark-meson coupling model. Within a relativistic Hartree-Fock approach and including the full tensor structure at the vector-meson-baryon vertices, we find that not only must hyperons appear in...

  6. Featured Image: Star Clusters in M51

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    This beautiful mosaic of images of the Whirlpool galaxy (M51) and its companion was taken with the Advanced Camera for Surveys on the Hubble Space Telescope. This nearby, grand-design spiral galaxy has a rich population of star clusters, making it both a stunning target for imagery and an excellent resource for learning about stellar formation and evolution. In a recent study, Rupali Chandar (University of Toledo) and collaborators cataloged over 3,800 compact star clusters within this galaxy. They then used this catalog to determine the distributions for the clusters ages, masses, and sizes, which can provide important clues as to how star clusters form, evolve, and are eventually disrupted. You can read more about their study and what they discovered in the paper below.CitationRupali Chandar et al 2016 ApJ 824 71. doi:10.3847/0004-637X/824/2/71

  7. Betting Against Beta

    DEFF Research Database (Denmark)

    Frazzini, Andrea; Heje Pedersen, Lasse

    We present a model with leverage and margin constraints that vary across investors and time. We find evidence consistent with each of the model’s five central predictions: (1) Since constrained investors bid up high-beta assets, high beta is associated with low alpha, as we find empirically for U.......S. equities, 20 international equity markets, Treasury bonds, corporate bonds, and futures; (2) A betting-against-beta (BAB) factor, which is long leveraged low beta assets and short high-beta assets, produces significant positive risk-adjusted returns; (3) When funding constraints tighten, the return...... of the BAB factor is low; (4) Increased funding liquidity risk compresses betas toward one; (5) More constrained investors hold riskier assets....

  8. Betting against Beta

    DEFF Research Database (Denmark)

    Frazzini, Andrea; Heje Pedersen, Lasse

    2014-01-01

    We present a model with leverage and margin constraints that vary across investors and time. We find evidence consistent with each of the model's five central predictions: (1) Because constrained investors bid up high-beta assets, high beta is associated with low alpha, as we find empirically...... for US equities, 20 international equity markets, Treasury bonds, corporate bonds, and futures. (2) A betting against beta (BAB) factor, which is long leveraged low-beta assets and short high-beta assets, produces significant positive risk-adjusted returns. (3) When funding constraints tighten......, the return of the BAB factor is low. (4) Increased funding liquidity risk compresses betas toward one. (5) More constrained investors hold riskier assets....

  9. Roughing up Beta

    DEFF Research Database (Denmark)

    Bollerslev, Tim; Li, Sophia Zhengzi; Todorov, Viktor

    Motivated by the implications from a stylized equilibrium pricing framework, we investigate empirically how individual equity prices respond to continuous, or \\smooth," and jumpy, or \\rough," market price moves, and how these different market price risks, or betas, are priced in the cross......-section of expected returns. Based on a novel highfrequency dataset of almost one-thousand individual stocks over two decades, we find that the two rough betas associated with intraday discontinuous and overnight returns entail significant risk premiums, while the intraday continuous beta is not priced in the cross......-section. An investment strategy that goes long stocks with high jump betas and short stocks with low jump betas produces significant average excess returns. These higher risk premiums for the discontinuous and overnight market betas remain significant after controlling for a long list of other firm characteristics...

  10. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Frigaard, Peter; Brorsen, Michael

    Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004.......Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004....

  11. Extreme Star Formation

    OpenAIRE

    Turner, JL

    2010-01-01

    Extreme star formation includes star formation in starbursts and regions forming super star clusters. We survey the current problems in our understanding of the star formation process in starbursts and super star clusters - initial mass functions, cluster mass functions, star formation efficiencies, and radiative feedback into molecular clouds - that are critical to our understanding of the formation and survival of large star clusters, topics that will be the drivers of the observations of t...

  12. Planck stars

    CERN Document Server

    Rovelli, Carlo

    2014-01-01

    A star that collapses gravitationally can reach a further stage of its life, where quantum-gravitational pressure counteracts weight. The duration of this stage is very short in the star proper time, yielding a bounce, but extremely long seen from the outside, because of the huge gravitational time dilation. Since the onset of quantum-gravitational effects is governed by energy density --not by size-- the star can be much larger than planckian in this phase. The object emerging at the end of the Hawking evaporation of a black hole can can then be larger than planckian by a factor $(m/m_{\\scriptscriptstyle P})^n$, where $m$ is the mass fallen into the hole, $m_{\\scriptscriptstyle P}$ is the Planck mass, and $n$ is positive. The existence of these objects alleviates the black-hole information paradox. More interestingly, these objects could have astrophysical and cosmological interest: they produce a detectable signal, of quantum gravitational origin, around the $10^{-14} cm$ wavelength.

  13. The hot Gamma-Doradus and Maia stars

    CERN Document Server

    Balona, L A; Joshi, Yogesh C; Joshi, S; Sharma, K; Semenko, E; Pandey, G; Chakradhari, N K; Mkrtichian, David; Hema, B P; Nemec, J M

    2016-01-01

    The hot $\\gamma$~Doradus stars have multiple low frequencies characteristic of $\\gamma$~Dor or SPB variables, but are located between the red edge of the SPB and the blue edge of the $\\gamma$~Dor instability strips where all low-frequency modes are stable in current models of these stars. Though $\\delta$~Sct stars also have low frequencies, there is no sign of high frequencies in hot $\\gamma$~Dor stars. We obtained spectra to refine the locations of some of these stars in the H-R diagram and conclude that these are, indeed, anomalous pulsating stars. The Maia variables have multiple high frequencies characteristic of $\\beta$~Cep and $\\delta$~Sct stars, but lie between the red edge of the $\\beta$~Cep and the blue edge of the $\\delta$~Sct instability strips. We compile a list of all Maia candidates and obtain spectra of two of these stars. Again, it seems likely that these are anomalous pulsating stars which are currently not understood.

  14. Early Stage of Chemically Peculiar Stars

    Science.gov (United States)

    Netopil, M.; Fossati, L.; Zwintz, K.; Paunzen, E.; Bagnulo, S.; Pintado, O. I.

    2015-04-01

    Chemically peculiar stars are known to be the main sequence objects and are characterized by a wide variety of element abundance patterns. They display abundance peculiarities of various chemical elements from helium to mercury in their photospheres. These are explained by the diffusion processes driven by the competition between the radiative levitation and gravitational settling. Current estimates suggest that about 10% of all the stars in the corresponding spectral range (B to F-type) belong to various CP groups. The most populous groups are the metallic line (Am) stars and the magnetic Bp/Ap objects. The reason and the time-scale for the rise of chemical peculiarities is still not known, so is for the role of the magnetic field. The investigation of very young CP stars can help to shed more light on these issues and to test the diffusion theory. However, so far only one pre-main sequence (PMS) Bp star is known. We present here the discovery of a PMS CP candidate, which very probably belongs to the group of Am CP stars.

  15. Star formation history in forming dwarf galaxies

    Science.gov (United States)

    Berczik, P.; Kravchuk, S. G.

    The processes of formation and evolution of isolated dwarf galaxies over the Hubble timescale is followed by means of SPH techniques. As an initial protogalaxy perturbation we consider an isolated, uniform, solid -- body rotated sphere involved into the Hubble flow and made of dark and baryonic matter in a 10:1 ratio. The simulations are carried out for the set of models having spin parameters lambda in the range from 0.01 to 0.08 and the total mass of dark matter 1011 M_odot . Our model includes gasdynamics, radiative processes, star formation, supernova feedback and simplified chemistry. The application of modified star formation criterion which accounts for chaotic motions and the time lag between initial development of suitable conditions for star formation and star formation itself (Berczik P.P, Kravchuk S.G. 1997, Ap.Sp.Sci.) provides the realistic description of the process of galaxy formation and evolution. Two parameters: total mass and initial angular momentum of the dwarf protogalaxy play the crucial role in its star formation activity. After the 15 Gyr of the evolution the rapidly rotated dwarf galaxies manifest themselves as an extremly gasrich, heavy element deficient objects showing the initial burst of star formation activity in several spatially separated regions. Slowly rotating objects manifest themselves finally as typical evolved dwarf galaxies.

  16. Pharmakologische Charakterisierung der vasoaktiven Eigenschaften von Ap7A und Ap8A an der isolierten perfundierten Rattenniere

    OpenAIRE

    Blaschke, Daniela

    2010-01-01

    Recently, diadenosine heptaphosphate and diadenosine octaphosphate have been isolated in human platelets. With thrombin-induced platelet aggregation, Ap7A and Ap8A are released from the platelets into the extracellular space. Like other dinucleoside polyphosphates, maybe they play an important role in the control of vascular tone and platelet aggregation. Here we describe the effects on regulation of vascular tone of Ap7A and Ap8A in isolated perfused rat kidney. Our experiments demonstrate t...

  17. Dicty_cDB: FC-AP01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP01 (Link to dictyBase) - - - Contig-U15092-1 FC-AP01Z (Li...nk to Original site) - - FC-AP01Z 591 - - - - Show FC-AP01 Library FC (Link to library) Clone ID FC-AP01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP01Q.Seq.d/ Representative seq. ID FC-AP...01Z (Link to Original site) Representative DNA sequence >FC-AP01 (FC-AP01Q) /CSM/FC/FC-AP/FC-AP01Q.Seq....EELNISGPLSRNKLKWADFLNLTMNTNHARG HRHGRSPSKIFWRAVRGMLPHKTPRGQAALDNMKVFEGVPAPYDKVKRVVVPSALRVVKL NTTRKYTVLSRLSQE

  18. Dicty_cDB: FC-AP10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP10 (Link to dictyBase) - - - Contig-U15819-1 FC-AP10Z (Li...nk to Original site) - - FC-AP10Z 497 - - - - Show FC-AP10 Library FC (Link to library) Clone ID FC-AP10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP10Q.Seq.d/ Representative seq. ID FC-AP...10Z (Link to Original site) Representative DNA sequence >FC-AP10 (FC-AP10Q) /CSM/FC/FC-AP/FC-AP10Q.Seq....SGDWWDAELKGRRGKVPSNYLQLIKNAAPPRAGGPPVPTGNRA PTTTTTSGGSTRGGFNNGPSTAPSGRGAAPPSSRGGMAPRGGSVAPPSSRGGIAPRGGIA PRGGMAPRGGMAP

  19. 77 FR 24480 - Application for New Awards; Advanced Placement (AP) Test Fee Program-Reopening the AP Test Fee...

    Science.gov (United States)

    2012-04-24

    .... ACTION: Notice reopening the AP Test Fee fiscal year 2012 competition. Catalog of Federal Domestic Assistance (CFDA) Number: 84.330B. SUMMARY: On February 15, 2012, we published in the Federal Register (77 FR... Application for New Awards; Advanced Placement (AP) Test Fee Program--Reopening the AP Test Fee Fiscal...

  20. A high false positive rate for Kepler planetary candidates of giant stars using asterodensity profiling

    Energy Technology Data Exchange (ETDEWEB)

    Sliski, David H.; Kipping, David M., E-mail: dsliski@cfa.harvard.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2014-06-20

    Asterodensity profiling (AP) is a relatively new technique for studying transit light curves. By comparing the mean stellar density derived from the transit light curve to that found through an independent method, AP provides information on several useful properties such as orbital eccentricity and blended light. We present an AP survey of 41 Kepler Objects of Interest (KOIs), with a single transiting candidate, for which the target star's mean stellar density has been measured using asteroseismology. The ensemble distribution of the AP measurements for the 31 dwarf stars in our sample shows excellent agreement with the spread expected if the KOIs were genuine and have realistic eccentricities. In contrast, the same test for the 10 giants in our sample reveals significant incompatibility at >4σ confidence. While extreme eccentricities could be invoked, this hypothesis requires four of the KOIs to contact their host star at periastron passage, including the recently claimed confirmation of Kepler-91b. After carefully examining several hypotheses, we conclude that the most plausible explanation is that the transiting objects orbit a different star to that measured with asteroseismology—cases we define as false-positives. Based on the AP distribution, we estimate a false-positive rate (FPR) for Kepler's giant stars with a single transiting object of FPR ≅ 70% ± 30%.

  1. When stars collide

    NARCIS (Netherlands)

    Glebbeek, E.; Pols, O.R.

    2007-01-01

    When two stars collide and merge they form a new star that can stand out against the background population in a star cluster as a blue straggler. In so called collision runaways many stars can merge and may form a very massive star that eventually forms an intermediate mass blackhole. We have perfor

  2. Measure of the stars

    Energy Technology Data Exchange (ETDEWEB)

    Henbest, N.

    1984-12-13

    The paper concerns the Hertzsprung-Russel (H-R) diagram, which is graph relating the brightness to the surface temperature of the stars. The diagram provides a deep insight into the fundamental properties of the stars. Evolution of the stars; the death of a star; distances; and dating star clusters, are all briefly discussed with reference to the H-R diagram.

  3. AP600 containment purge radiological analysis

    Energy Technology Data Exchange (ETDEWEB)

    O`Connor, M.; Schulz, J.; Tan, C. [Bechtel Power Corporation (United States)] [and others

    1995-02-01

    The AP600 Project is a passive pressurized water reactor power plant which is part of the Design Certification and First-of-a-Kind Engineering effort under the Advanced Light Water Reactor program. Included in this process is the design of the containment air filtration system which will be the subject of this paper. We will compare the practice used by previous plants with the AP600 approach to meet the goals of industry standards in sizing the containment air filtration system. The radiological aspects of design are of primary significance and will be the focus of this paper. The AP600 Project optimized the design to combine the functions of the high volumetric flow rate, low volumetric flow rate, and containment cleanup and other filtration systems into one multi-functional system. This achieves a more simplified, standardized, and lower cost design. Studies were performed to determine the possible concentrations of radioactive material in the containment atmosphere and the effectiveness of the purge system to keep concentrations within 10CFR20 limits and within offsite dose objectives. The concentrations were determined for various reactor coolant system leakage rates and containment purge modes of operation. The resultant concentrations were used to determine the containment accessibility during various stages of normal plant operation including refueling. The results of the parametric studies indicate that a dual train purge system with a capacity of 4,000 cfm per train is more than adequate to control the airborne radioactivity levels inside containment during normal plant operation and refueling, and satisfies the goals of ANSI/ANS-56.6-1986 and limits the amount of radioactive material released to the environment per ANSI/ANS 59.2-1985 to provide a safe environment for plant personnel and offsite residents.

  4. Proactive AP Selection Method Considering the Radio Interference Environment

    Science.gov (United States)

    Taenaka, Yuzo; Kashihara, Shigeru; Tsukamoto, Kazuya; Yamaguchi, Suguru; Oie, Yuji

    In the near future, wireless local area networks (WLANs) will overlap to provide continuous coverage over a wide area. In such ubiquitous WLANs, a mobile node (MN) moving freely between multiple access points (APs) requires not only permanent access to the Internet but also continuous communication quality during handover. In order to satisfy these requirements, an MN needs to (1) select an AP with better performance and (2) execute a handover seamlessly. To satisfy requirement (2), we proposed a seamless handover method in a previous study. Moreover, in order to achieve (1), the Received Signal Strength Indicator (RSSI) is usually employed to measure wireless link quality in a WLAN system. However, in a real environment, especially if APs are densely situated, it is difficult to always select an AP with better performance based on only the RSSI. This is because the RSSI alone cannot detect the degradation of communication quality due to radio interference. Moreover, it is important that AP selection is completed only on an MN, because we can assume that, in ubiquitous WLANs, various organizations or operators will manage APs. Hence, we cannot modify the APs for AP selection. To overcome these difficulties, in the present paper, we propose and implement a proactive AP selection method considering wireless link condition based on the number of frame retransmissions in addition to the RSSI. In the evaluation, we show that the proposed AP selection method can appropriately select an AP with good wireless link quality, i.e., high RSSI and low radio interference.

  5. Forward-Looking Betas

    DEFF Research Database (Denmark)

    Christoffersen, Peter; Jacobs, Kris; Vainberg, Gregory

    -looking. This paper introduces a radically different approach to estimating market betas. Using the tools in Bakshi and Madan (2000) and Bakshi, Kapadia and Madan (2003) we employ the information embedded in the prices of individual stock options and index options to compute our forward-looking market beta...

  6. An international multicentre-laboratory evaluation of a new assay to detect specifically lupus anticoagulants dependent on the presence of anti-beta2-glycoprotein autoantibodies

    NARCIS (Netherlands)

    de laat, B.; Derksen, R. H. W. M.; Reber, G.; Musial, J.; Swadzba, J.; Bozic, B.; Cucnik, S.; Regnault, V.; Forastiero, R.; Woodhams, B. J.; de Groot, Ph. G.

    2011-01-01

    Background: Antiphospholipid syndrome (APS) is diagnosed by the simultaneous presence of vascular thrombosis and/or pregnancy morbidity and detection of antiphospholipid antibodies in plasma. Objectives: We have shown that prolongation of clotting time by anti-beta2-glycoprotein I (beta2GPI) antibod

  7. Ozone mitigation tests at the APS

    Energy Technology Data Exchange (ETDEWEB)

    Kuzay, T.M.; Collins, J.T.; Pisharody, M.; Job, P.K.; Wang Zhibi

    1996-09-01

    Ozone is generated in the APS experimental stations whenever the x-ray beam has a chance to interact with air. Ozone concentrations in an experimental station have to be below a certain defined limit (current OSHA regulations specify 0.08 ppm as the maximum limit) before an experimenter can reenter the hutch. This limit is said to be currently under study for a downward adjustment. One method of depleting the ozone generated in an experimental station is mitigation through either adsorption or direct destruction. In recent tests, both methods were tried using commercially available units. Test results and some analytical predictions are presented.

  8. Wiley AP english language and composition

    CERN Document Server

    Woods, Geraldine

    2013-01-01

    Two full-length practice tests to help you score your highest Review questions with complete answers and explanations for the most popular themes on the test Study strategies and expert test-taking tips to keep you calm and focused on test day Review key exam topics and themes to maximize your score Preparing for the AP English Language and Composition test? This test-prep guide helps you perfect the skills you need to achieve your best possible score. You'll find winning test-taking tips, multiple-choice strategies, and essay guidelines, as well as great advice on getting the

  9. Path Deviation Equations in AP-Geometry

    CERN Document Server

    Wanas, M I

    2005-01-01

    Recently, it has been shown that Absolute Parallelism (AP) geometry admits paths that are naturally quantized. These paths have been used to describe the motion of spinning particles in a background gravitational field. In case of a weak static gravitational field limits, the paths are applied successfully to interpret the discrepancy in the motion of thermal neutrons in the Earth's gravitational field (COW-experiment). The aim of the present work is to explore the properties of the deviation equations corresponding to these paths. In the present work the deviation equations are derived and compared to the geodesic deviation equation of the Riemannian geometry.

  10. Measuring the surface magnetic fields of magnetic stars with unresolved Zeeman splitting

    CERN Document Server

    Bailey, J D

    2014-01-01

    High-dispersion, archival spectra of magnetic Ap stars with resolved Zeeman components in Stokes I are used to derive a simple relation that can be utilised to estimate the mean surface field strengths of stars with v sin i > 10 km/s. For each star, the mean surface field, as measured from the observed splitting in Fe II at 6149 A, is compared to the differential broadening of spectral lines with large and small Lande factors in order to produce a relation to estimate the field strengths of magnetic stars with unresolved Zeeman patterns. The method is shown to be reliable for rotational velocities up to about 50 km/s for field strengths down to about 5 kG. These results should allow for better constraints to be placed on the mean surface magnetic fields of Ap stars where Zeeman patterns are unresolved.

  11. Equation of State of Protoneutron Star with Trapped Neutrinos

    Institute of Scientific and Technical Information of China (English)

    ZHANG Hua; JIA Huan-Yu

    2006-01-01

    The influence of trapped neutrinos on the proto-neutron star is studied in the framework of relativistic mean-field theory. The results show that trapped neutrinos increase proton fraction and make the equation of state of neutron star matter softer when neglecting hyperonic freedom, while suppress the appearance of hyperons and make the equation of state stiffer when including hyperons in the protoneutron star. The maximum mass, compared with cold neutron star which is in beta equilibrium, decreases by 0.06M☉ for non-strange protoneutron star while increases by 0.21M☉ for protoneutron star with hyperons when the relative number of trapped neutrino is 0.4.

  12. SN 2005ap: A Most Brilliant Explosion

    CERN Document Server

    Quimby, Robert M; Wheeler, J Craig; Höflich, Peter; Akerlof, Carl W; Rykoff, Eli S

    2007-01-01

    We present unfiltered photometric observations with ROTSE-III and optical spectroscopic follow-up with the HET and Keck of the most luminous supernova yet identified, SN 2005ap. The spectra taken about 3 days before and 6 days after maximum light show narrow emission lines (likely originating in the dwarf host) and absorption lines at a redshift of z=0.2832, which puts the peak unfiltered magnitude at -22.7 +/- 0.1 absolute. Broad P-Cygni features corresponding to H-alpha, CIII, NIII, and OIII, are further detected with a photospheric velocity of ~20,000 km/s. Unlike other highly luminous supernovae such as 2006gy and 2006tf that show slow photometric evolution, the light curve of SN 2005ap indicates a 1-3 week rise to peak followed by a relatively rapid decay. The spectra also lack the distinct emission peaks from moderately broadened (FWHM ~ 2,000 km/s) Balmer lines seen in SN 2006gy and SN 2006tf. We briefly discuss the origin of the extraordinary luminosity from a strong interaction as may be expected fro...

  13. APS insertion devices: Recent developments and results

    International Nuclear Information System (INIS)

    The Advanced Photon Source (APS) now has a total of 23 insertion devices (IDs). Over two-thirds of them are installed on the storage ring. The installed devices include 18, 27 and 55 mm-period undulators; an 85 mm-period wiggler; a 16 cm-period elliptical multipole wiggler; and many 33 mm-period undulators. Most of the IDs occupy storage-ring straight sections equipped with 8 mm vertical-aperture vacuum chambers. All of the IDs were measured magnetically at the APS and, in most cases, underwent a final magnetic tuning in order to minimize variation in the various integrals of the field through the ID over the full gap range. Special shimming techniques to correct magnetic field parameters in appropriate gap-dependent ways were developed and applied. Measurements of the closed-orbit distortion as a function of the ID gap variation have been completed, and results are in a good agreement with magnetic measurements. Spectral diagnostics of the ID radiation, including measurements of the absolute spectral flux, brilliance and polarization, show excellent agreement between calculated and measured results. Studies of the sensitivity of IDs to radiation exposure and measurements of the dose rate received by the IDs are in progress

  14. Dicty_cDB: FC-AP24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP24 (Link to dictyBase) - - - Contig-U16528-1 FC-AP24F (Li...nk to Original site) FC-AP24F 525 - - - - - - Show FC-AP24 Library FC (Link to library) Clone ID FC-AP24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP24Q.Seq.d/ Representative seq. ID FC-AP...24F (Link to Original site) Representative DNA sequence >FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq....C-BE24Q.Seq.d/ 1041 0.0 FC-AP24 (FC-AP24Q) /CSM/FC/FC-AP/FC-AP24Q.Seq.d/ 1041 0.0

  15. Dicty_cDB: FC-AP21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP21 (Link to dictyBase) - - - Contig-U15099-1 FC-AP21Z (Li...nk to Original site) - - FC-AP21Z 511 - - - - Show FC-AP21 Library FC (Link to library) Clone ID FC-AP21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP21Q.Seq.d/ Representative seq. ID FC-AP...21Z (Link to Original site) Representative DNA sequence >FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP21Q.Seq....14Q.Seq.d/ 1013 0.0 SLE553 (SLE553Q) /CSM/SL/SLE5-C/SLE553Q.Seq.d/ 1013 0.0 FC-AP21 (FC-AP21Q) /CSM/FC/FC-AP/FC-AP

  16. Dicty_cDB: FC-AP22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP22 (Link to dictyBase) - G24045 DDB0232387 Contig-U15141-1 FC-AP...22F (Link to Original site) FC-AP22F 317 - - - - - - Show FC-AP22 Library FC (Link to library) Clone ID FC-AP...1-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP22Q.Se...q.d/ Representative seq. ID FC-AP22F (Link to Original site) Representative DNA sequence >FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP...KKKKKKK Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP22 (FC-AP22Q) /CSM/FC/FC-AP/FC-AP

  17. Enigma of Runaway Stars Solved

    Science.gov (United States)

    1997-01-01

    . In fact, this is one of the most `perfect' bow shocks of parabolic form ever observed around an OB-runaway. Moreover, the orientation of the bow shock indicates that the system is moving towards the north; its origin must therefore lie somewhere south of its present position in the sky. It also turns out that the accordingly deduced path of HD77581 crosses a well-known OB-association with the designation Vel OB1 . At the measured distance of Vel OB1 of about 6000 lightyears, the observed proper motion and radial velocity of HD77581 indicate a space velocity of 90 km/sec. With this velocity, it would have taken HD77581 and its compact companion about 2.5 million years to travel the distance between Vel OB1 and its present position. This corresponds exactly to the expected time that has passed since the supernova explosion of the progenitor star of Vela~X-1, as deduced from the observed properties of the binary system. The puzzle comes together Now everything fits! The observation of a bow shock around the OB star HD77581 and its compact companion Vela X-1 supports the scenario originally proposed by Blaauw to create OB-runaway stars by the supernova explosion of the binary companion. Following back the path of the system resulted in the discovery of the place where it was born and from where it escaped after the violent supernova explosion which produced the neutron star that now manifests itself as the strong X-ray source known as Vela X-1. More information about this research project This research project is described in ESO Preprint no.~1199 and will appear shortly as a Letter to the Editor in `Astrophysical Journal' (ApJ 475, L37-L40). Notes: [1] Professor Adriaan Blaauw is a well-known Dutch astronomer (Leiden and Groningen). He participated very actively in the build-up of ESO in the 1950's and 60's and he was ESO Director General from 1970 - 1974. He is the author of ` ESO's Early History - The European Southern Observatory from concept to reality ' (1991). [2

  18. Catalytic activity of nuclear PLC-beta(1) is required for its signalling function during C2C12 differentiation.

    Science.gov (United States)

    Ramazzotti, Giulia; Faenza, Irene; Gaboardi, Gian Carlo; Piazzi, Manuela; Bavelloni, Alberto; Fiume, Roberta; Manzoli, Lucia; Martelli, Alberto M; Cocco, Lucio

    2008-11-01

    Here we report that PLC-beta(1) catalytic activity plays a role in the increase of cyclin D3 levels and induces the differentiation of C2C12 skeletal muscle cells. PLC-beta(1) mutational analysis revealed the importance of His(331) and His(378) for the catalysis. The expression of PLC-beta(1) and cyclin D3 proteins is highly induced during the process of skeletal myoblast differentiation. We have previously shown that PLC-beta(1) activates cyclin D3 promoter during the differentiation of myoblasts to myotubes, indicating that PLC-beta(1) is a crucial regulator of the mouse cyclin D3 gene. We show that after insulin treatment cyclin D3 mRNA levels are lower in cells overexpressing the PLC-beta(1) catalytically inactive form in comparison to wild type cells. We describe a novel signalling pathway elicited by PLC-beta(1) that modulates AP-1 activity. Gel mobility shift assay and supershift performed with specific antibodies indicate that the c-jun binding site is located in a cyclin D3 promoter region specifically regulated by PLC-beta(1) and that c-Jun binding activity is significantly increased by insulin and PLC-beta(1) overexpression. Mutation of AP-1 site decreased the basal cyclin D3 promoter activity and eliminated its induction by insulin and PLC-beta(1). These results hint at the fact that PLC-beta(1) catalytic activity signals a c-jun/AP-1 target gene, i.e. cyclin D3, during myogenic differentiation.

  19. Fênomeno de Raynaud grave associado a terapia com interferon-beta para esclerose múltipla: relato de caso Severe Raynaud's phenomenon associated with interferon-beta therapy for multiple sclerosis: case report

    Directory of Open Access Journals (Sweden)

    BORIS AFONSO CRUZ

    2000-06-01

    Full Text Available Interferon-B (IFN-beta é usado no tratamento de esclerose múltipla (EM. Descrevemos o caso de uma mulher com EM que apresentou fenômeno de Raynaud grave, livedo reticular e necrose digital duas semanas após tratamento com IFN-beta. Os sintomas melhoraram após suspensão do IFN-beta e início de anticoagulação associada a ciclofosfamida e corticóide. Fenômeno de Raynaud é um efeito colateral provável da terapia com IFN-beta para EM.Interferon-beta (IFN-beta is administered for treatment of multiple sclerosis (MS. We report on a woman with MS who presented with severe Raynaud's phenomenon, livedo-reticularis and digital necrosis two weeks after beginning therapy with IFN-beta. Symptoms improved after the IFN-beta was discontinued and anticoagulation associated with cyclophosphamide and corticoid were introduced. Raynaud's phenomenon is probably a side effect of IFN-beta therapy for multiple sclerosis.

  20. A Four-Star Lightweight

    Science.gov (United States)

    Kohler, Susanna

    2015-10-01

    least 1,800 AU which means that, if the system is only a few million years old, the binary pairs have orbited each other no more than ~20 times.The authors measurements show that the first binary pair (labeled Aab, where Aa and Ab are the two stars) consists of a 200 MJup low-mass star and a 35 MJup brown dwarf. The second binary pair (Bab) consists of a 19 MJup brown dwarf and a ~10 MJup companion. This gives 2M0441+2301 AabBab a total mass of only ~0.26 solar masses, making it the lowest-mass quadruple system yet discovered.The hierarchical structure of this system strongly suggests that it formed from the collapse and fragmentation of a molecular cloud core. What makes this system especially interesting is the span of masses involved. The low mass of the companion in Bab indicates that its possible to form planetary-mass companions from a cloud-fragmentation pathway which suggests that this may also be legitimate channel to consider for the formation of massive exoplanets.Note: article edited to more accurately reflect the specific contributions of this study.CitationBrendan P. Bowler and Lynne A. Hillenbrand 2015 ApJ 811 L30. doi:10.1088/2041-8205/811/2/L30

  1. Star Formation History and Chemical Evolution of the Sextans Dwarf Spheroidal Galaxy

    OpenAIRE

    Lee, Myung Gyoon; Yuk, In-Soo; Park, Hong Soo; Harris, Jason; Zaritsky, Dennis

    2009-01-01

    We present the star formation history and chemical evolution of the Sextans dSph dwarf galaxy as a function of galactocentric distance. We derive these from the $VI$ photometry of stars in the $42' \\times 28'$ field using the SMART model developed by Yuk & Lee (2007, ApJ, 668, 876) and adopting a closed-box model for chemical evolution. For the adopted age of Sextans 15 Gyr, we find that $>$84% of the stars formed prior to 11 Gyr ago, significant star formation extends from 15 to 11 Gyr ago (...

  2. No detection of large-scale magnetic fields at the surfaces of Am and HgMn stars

    OpenAIRE

    Auriere, M.; Wade, G. A.; Lignieres, F.; Hui-Bon-Hoa, A.; Landstreet, J. D.; Iliev, I; Donati, J.-F.; Petit, P.; Roudier, T.; Theado, S.

    2010-01-01

    We investigate the magnetic dichotomy between Ap/Bp and other A-type stars by carrying out a deep spectropolarimetric study of Am and HgMn stars. Using the NARVAL spectropolarimeter at the Telescope Bernard Lyot (Observatoire du Pic du Midi, France), we obtained high-resolution circular polarisation spectroscopy of 12 Am stars and 3 HgMn stars. Using Least Squares Deconvolution (LSD), no magnetic field is detected in any of the 15 observed stars. Uncertaintiies as low as 0.3 G (respectively 1...

  3. Neutrinoless double beta decay

    Indian Academy of Sciences (India)

    Kai Zuber

    2012-10-01

    The physics potential of neutrinoless double beta decay is discussed. Furthermore, experimental considerations as well as the current status of experiments are presented. Finally, an outlook towards the future, work on nuclear matrix elements and alternative processes is given.

  4. Beta-carotene

    Science.gov (United States)

    ... chemotherapy for a blood cancer called lymphoblastic leukemia. Mental performance. Some evidence suggests that taking beta-carotene ... One is water-based, and the other is oil-based. Studies show that the water-based version ...

  5. Dicty_cDB: FC-AP13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP13 (Link to dictyBase) - - - Contig-U15374-1 FC-AP13P (Li...nk to Original site) FC-AP13F 550 FC-AP13Z 184 FC-AP13P 734 - - Show FC-AP13 Library FC (Link to library) Clone ID FC-AP...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP13Q.Seq.d/ Representative seq. ID FC-AP...13P (Link to Original site) Representative DNA sequence >FC-AP13 (FC-AP13Q) /CSM/FC/FC-AP/FC-AP...KKRKLNILIIII*fnnhqvmekkikkkiknkkn f*k Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AP

  6. [High beta tokamak research

    International Nuclear Information System (INIS)

    Our activities on High Beta Tokamak Research during the past 20 months of the present grant period can be divided into six areas: reconstruction and modeling of high beta equilibria in HBT; measurement and analysis of MHD instabilities observed in HBT; measurements of impurity transport; diagnostic development on HBT; numerical parameterization of the second stability regime; and conceptual design and assembly of HBT-EP. Each of these is described in some detail in the sections of this progress report

  7. Triggered Star Formation by Massive Stars

    OpenAIRE

    Lee, Hsu-Tai; Chen, W. P.

    2005-01-01

    We present our diagnosis of the role that massive stars play in the formation of low- and intermediate-mass stars in OB associations (the Lambda Ori region, Ori OB1, and Lac OB1 associations). We find that the classical T Tauri stars and Herbig Ae/Be stars tend to line up between luminous O stars and bright-rimmed or comet-shaped clouds; the closer to a cloud the progressively younger they are. Our positional and chronological study lends support to the validity of the radiation-driven implos...

  8. B-type stars in eclipsing binaries

    Science.gov (United States)

    Ratajczak, Milena; Pigulski, Andrzej

    2016-07-01

    B-type stars in eclipsing binary systems are unique astrophysical tools to test several aspects of stellar evolution. Such objects can be used e.g. to determine the masses of Beta Cephei variable stars, as well as help to place tighter constraints on the value of the convective core overshooting parameter α. Both precise photometry and high-resolution spectroscopy with high SNR are required to achieve these goals, but since many of the targets are bright enough, the challenge is fair. Following this assumption, we shall explain how we plan to examine both the aforementioned aspects of stellar evolution using observations of B-type stars obtained with a wide range of spectrographs, as well as BRITE-Constellation satellites.

  9. Market analysis of APS/SCM applications and technologies

    OpenAIRE

    Prášil, Zdeněk

    2009-01-01

    The bachelor thesis aims to describe a current worldwide market of APS/SCM technologies and applications , i.e. advanced planned scheduling /supply chain management. In the first part, the APS/SCM is described in theory. The APS/SCM is defined and its benefits and impacts on company are discussed. The next part of the work is focused on the market with APS/SCM and the distribution of forces in the market. The demand and supply of this market segment is analyzed. In the last part, solutions of...

  10. {beta} - amyloid imaging probes

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Jae Min [Seoul National University College of Medicine, Seoul (Korea, Republic of)

    2007-04-15

    Imaging distribution of {beta} - amyloid plaques in Alzheimer's disease is very important for early and accurate diagnosis. Early trial of the {beta} -amyloid plaques includes using radiolabeled peptides which can be only applied for peripheral {beta} - amyloid plaques due to limited penetration through the blood brain barrier (BBB). Congo red or Chrysamine G derivatives were labeled with Tc-99m for imaging {beta} - amyloid plaques of Alzheimer patient's brain without success due to problem with BBB penetration. Thioflavin T derivatives gave breakthrough for {beta} - amyloid imaging in vivo, and a benzothiazole derivative [C-11]6-OH-BTA-1 brought a great success. Many other benzothiazole, benzoxazole, benzofuran, imidazopyridine, and styrylbenzene derivatives have been labeled with F-18 and I-123 to improve the imaging quality. However, [C-11]6-OH-BTA-1 still remains as the best. However, short half-life of C-11 is a limitation of wide distribution of this agent. So, it is still required to develop an Tc-99m, F-18 or I-123 labeled agent for {beta} - amyloid imaging agent.

  11. Project W-211, initial tank retrieval systems, description of operations for 241-AP-102 and 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-02-25

    The primary purpose of the Initial Tank Retrieval Systems (ITRS) is to provide systems for retrieval of radioactive wastes stored in underground double-shell tanks (DSTS) for transfer to alternate storage, evaporation, pretreatment or treatment, while concurrently reducing risks associated with safety watch list and other DSTs. This Description of Operations (DOO) defines the control philosophy for the waste retrieval system for tanks 241-AP-102 (AP-102) and 241-AP-104 (AP-104). This DOO will provide a basis for the detailed design of the Retrieval Control System (RCS) for AP-102 and AP-104 and establishes test criteria for the RCS. The test criteria will be used during qualification testing and acceptance testing to verify operability.

  12. AP1000主系统先进性分析%The Progressiveness Analysis of the AP1000 Main System

    Institute of Scientific and Technical Information of China (English)

    李家杰

    2012-01-01

      本文总结了第三代先进非能动压水堆核电厂AP1000主系统的主要特点,对AP1000主系统的先进性进行了分析,核电厂主系统设计人员能够从该文中了解到 AP1000主系统与第二代核电厂主系统之间的差别。%  This paper summarizes the main features of the AP1000 main system of the third generation of advanced passive pressurized water reactor nuclear power plant , and analyzes the progressiveness of the AP1000 main system .From this paper, the main system designers of nuclear power factory can learn the difference between the second-generation nuclear power factory main system and AP1000 main system

  13. STIS Coronagraphic Observations of Beta Pictoris

    CERN Document Server

    Heap, S R; Lanz, T M; Cornett, R H; Hubeny, I; Maran, S P; Woodgate, B E; Heap, Sara R.; Lindler, Don J.; Lanz, Thierry M.; Cornett, Robert H.; Hubeny, Ivan; Maran, Stephen P.; Woodgate, Bruce

    1999-01-01

    We present new coronagraphic images of Beta Pictoris obtained with the Space Telescope Imaging Spectrograph (STIS) in September 1997. The high-resolution images (0.1") clearly detect the circumstellar disk as close as 0.75" to the star, corresponding to a projected radius of 15 AU. The images define the warp in the disk with greater precision and at closer radii to Beta Pic than do previous observations. They show that the warp can be modelled by the projection of two components: the main disk, and a fainter component, which is inclined to the main component by 4-5 degrees, and which extends only as far as ~4" from the star. We interpret the main component as arising primarily in the outer disk and the tilted component as defining the inner region of the disk. The observed properties of the warped inner disk are inconsistent with a driving force from stellar radiation. However, warping induced by the gravitational potential of one or more planets is consistent with the data. Using models of planet-warped disk...

  14. Circumnuclear Regions of Star Formation in Early Type Galaxies

    CERN Document Server

    Diaz, Angeles I; Hagele, Guillermo F; Castellanos, Marcelo

    2008-01-01

    Circumnuclear star forming regions, also called hotspots, are often found in the inner regions of some spiral galaxies where intense processes of star formation are taking place. In the UV, massive stars dominate the observed circumnuclear emission even in the presence of an active nucleus, contributing between 30 and 50% to the H$\\beta$ total emission of the nuclear zone. Spectrophotometric data of moderate resolution (3000 < R < 11000) are presented from which the physical properties of the ionized gas: electron density, oxygen abundances, ionization structure etc. have been derived.

  15. Genome-Wide Identification of the Target Genes of AP2-O, a Plasmodium AP2-Family Transcription Factor.

    Directory of Open Access Journals (Sweden)

    Izumi Kaneko

    2015-05-01

    Full Text Available Stage-specific transcription is a fundamental biological process in the life cycle of the Plasmodium parasite. Proteins containing the AP2 DNA-binding domain are responsible for stage-specific transcriptional regulation and belong to the only known family of transcription factors in Plasmodium parasites. Comprehensive identification of their target genes will advance our understanding of the molecular basis of stage-specific transcriptional regulation and stage-specific parasite development. AP2-O is an AP2 family transcription factor that is expressed in the mosquito midgut-invading stage, called the ookinete, and is essential for normal morphogenesis of this stage. In this study, we identified the genome-wide target genes of AP2-O by chromatin immunoprecipitation-sequencing and elucidate how this AP2 family transcription factor contributes to the formation of this motile stage. The analysis revealed that AP2-O binds specifically to the upstream genomic regions of more than 500 genes, suggesting that approximately 10% of the parasite genome is directly regulated by AP2-O. These genes are involved in distinct biological processes such as morphogenesis, locomotion, midgut penetration, protection against mosquito immunity and preparation for subsequent oocyst development. This direct and global regulation by AP2-O provides a model for gene regulation in Plasmodium parasites and may explain how these parasites manage to control their complex life cycle using a small number of sequence-specific AP2 transcription factors.

  16. The Birth of Massive Stars and Star Clusters

    OpenAIRE

    Tan, Jonathan C.

    2005-01-01

    In the present-day universe, it appears that most, and perhaps all, massive stars are born in star clusters. It also appears that all star clusters contain stars drawn from an approximately universal initial mass function, so that almost all rich young star clusters contain massive stars. In this review I discuss the physical processes associated with both massive star formation and with star cluster formation. First I summarize the observed properties of star-forming gas clumps, then address...

  17. Residual radiation studies at AP0

    Energy Technology Data Exchange (ETDEWEB)

    Alexander J Elwyn et al.

    2002-06-19

    The radiation environment at the NuMI experiment has received a lot of attention in the last few years in preparation for project construction. One important issue is the induced radioactivation of the components in the beam line and the shielding materials. This arises from irradiation by hadrons that are generated in the target. Since the level of the residual activity has to be considered when determining access procedures for maintenance during NuMI operation, an understanding of the properties of the remnant radiation is important. To this end, experimental studies were performed in the target vault at AP0 which is similar in design to the NuMI target area. Here 120 GeV protons bombard a target, generating the hadrons that produce the induced radioactivity. Two sets of samples each consisting of three small cylindrical or rectangular solids of iron and steel, one sample of aluminum, and one of concrete were irradiated. One set was hung just below the bottom of a module near the lithium lens (in-vault), and the other was placed on top of the modules downstream of this location (above-vault), just beneath the movable concrete roof of the vault at AP0. Further, four thin activation foils of Au, Au+Cd, In, and Al (along with small disks of the same iron, aluminum, and concrete samples discussed above) were mounted on four 10.2 cm diameter Al disks, one placed on the in-vault module and three at above-vault downstream locations as well. The radioactivity of all these materials on the 10.2 cm Al disks was determined at the Radioisotope Analysis Facility in an attempt to characterize the radionuclides produced during irradiation. The activities of the thin foils were employed in an effort to unfold a spectrum of the neutrons produced during the hadronic cascades in the target. The MARS Monte Carlo code (MO95, MO00) was used to predict and analyze the residual radiation produced during the beam irradiation. New subroutines have been developed for the MARS14 version

  18. The Cambridge Double Star Atlas

    Science.gov (United States)

    MacEvoy, Bruce; Tirion, Wil

    2015-12-01

    Preface; What are double stars?; The binary orbit; Double star dynamics; Stellar mass and the binary life cycle; The double star population; Detecting double stars; Double star catalogs; Telescope optics; Preparing to observe; Helpful accessories; Viewing challenges; Next steps; Appendices: target list; Useful formulas; Double star orbits; Double star catalogs; The Greek alphabet.

  19. APS extends open access to all its journals

    CERN Multimedia

    Thomas, Kim

    2006-01-01

    "Physics research promoter and publisher the American Physical Society (APS) is to extend open access to all its journals. Th APS previously made its five print journals available through subscriptions, and its two e-journals (Physical Review Special Topics and Physics Educatoin Research) on an open access basis." (1/2 page)

  20. AP-42 ADDITIONS AND REVISIONS - LANDFILLS (COMBUSTION CONTROLS)

    Science.gov (United States)

    This project develops emission factors, etc., for landfills, in particular for combustion devices fed by landfill gas, for incorporation into AP-42. AP-42 is a massive collection of information concerning processes which generate air emissions and presents emission factors and co...

  1. Data-Based Decision Making: The Road to AP Equity

    Science.gov (United States)

    Edwards, Kelcey; Duggan, Odette

    2012-01-01

    Presented at the Advanced Placement Annual Conference (APAC) in Lake Buena Vista, FL in July 2012. This presentation reviews concepts central to achieving equitable AP access and success for all willing and academically prepared students. We analyze trends in participation and performance by race/ethnicity from the AP Report to the Nation and…

  2. A Closer Examination of the Academic Benefits of AP

    Science.gov (United States)

    McKillip, Mary E. M.; Rawls, Anita

    2013-01-01

    The authors sought to better understand the relationship between students participating in the Advanced Placement (AP) program and subsequent performance on the Scholastic Aptitude Test (SAT). Focusing on students graduating from U.S. public high schools in 2010, the authors used propensity scores to match junior year AP examinees in 3 subjects to…

  3. Braking the Gas in the beta Pictoris Disk

    CERN Document Server

    Fern'andez, R; Wu, Y; Brandeker, Alexis; Fern\\'andez, Rodrigo

    2006-01-01

    (Abridged) The main sequence star beta Pictoris hosts the best studied circumstellar disk to date. Nonetheless, a long-standing puzzle has been around since the detection of metallic gas in the disk: radiation pressure from the star should blow the gas away, yet the observed motion is consistent with Keplerian rotation. In this work we search for braking mechanisms that can resolve this discrepancy. We find that all species affected by radiation force are heavily ionized and dynamically coupled into a single fluid by Coulomb collisions, reducing the radiation force on species feeling the strongest acceleration. For a gas of solar composition, the resulting total radiation force still exceeds gravity, while a gas of enhanced carbon abundance could be self-braking. We also explore two other braking agents: collisions with dust grains and neutral gas. Grains surrounding beta Pic are photoelectrically charged to a positive electrostatic potential. If a significant fraction of the grains are carbonaceous (10% in t...

  4. V and K-band Mass-Luminosity Relations for M Dwarf Stars

    Science.gov (United States)

    Benedict, George Frederick; Henry, Todd J.; McArthur, Barbara E.; Franz, Otto; Wasserman, Larry H.; Dieterich, Sergio

    2015-08-01

    Applying Hubble Space Telescope Fine Guidance Sensor astrometric techniques developed to establish relative orbits for binary stars (Franz et al. 1998, AJ, 116, 1432), determine masses of binary components (Benedict et al. 2001, AJ, 121, 1607), and measure companion masses of exoplanet host stars (McArthur et al. 2010, ApJ, 715, 1203), we derive masses with an average 2% error for 28 components of 14 M dwarf binary star systems. With these and other published masses we update the lower Main Sequence V-band Mass-Luminosity Relation first shown in Henry et al. 1999, ApJ, 512, 864. We demonstrate that a Mass-Luminosity Relation in the K-band has far less scatter. These relations can be used to estimate the masses of the ubiquitous red dwarfs (75% of all stars) to an accuracy of better than 5%.

  5. Divergence of satellite DNA and interspersion of dispersed repeats in the genome of the wild beet Beta procumbens.

    Science.gov (United States)

    Dechyeva, Daryna; Gindullis, Frank; Schmidt, Thomas

    2003-01-01

    Several repetitive sequences of the genome of Beta procumbens Chr. Sm., a wild beet species of the section Procumbentes of the genus Beta have been isolated. According to their genomic organization, the repeats were assigned to satellite DNA and families of dispersed DNA sequences. The tandem repeats are 229-246 bp long and belong to an AluI restriction satellite designated pAp11. Monomers of this satellite DNA form subfamilies which can be distinguished by the divergence or methylation of an internal restriction site. The satellite is amplified in the section Procumbentes, but is also found in species of the section Beta including cultivated beet (Beta vulgaris). The existence of the pAp11 satellite in distantly related species suggests that the AluI sequence family is an ancient component of Beta genomes and the ancestor of the diverged satellite subfamily pEV4 in B. vulgaris. Comparative fluorescent in-situ hybridization revealed remarkable differences in the chromosomal position between B. procumbens and B. vulgaris, indicating that the pAp11 and pEV4 satellites were most likely involved in the expansion or rearrangement of the intercalary B. vulgaris heterochromatin. Furthermore, we describe the molecular structure, and genomic and chromosomal organization of two repetitive DNA families which were designated pAp4 and pAp22 and are 1354 and 582 bp long, respectively. The families consist of sequence elements which are widely dispersed along B. procumbens chromosomes with local clustering and exclusion from distal euchromatic regions. FISH on meiotic chromosomes showed that both dispersed repeats are colocalized in some chromosomal regions. The interspersion of repeats of the pAp4 and pAp22 family was studied by PCR and enabled the determination of repeat flanking sequences. Sequence analysis revealed that pAp22 is either derived from or part of a long terminal repeat (LTR) of an Athila-like retrotransposon. Southern analysis and FISH with pAp4 and pAp22 showed

  6. Surveying the Bright Stars by Optical Interferometry I: A Search for Multiplicity Among Stars of Spectral Types F - K

    CERN Document Server

    Hutter, Donald; Tycner, Christopher; Benson, James; Hummel, Christian; Sanborn, Jason; Franz, Otto G; Johnston, Kenneth

    2016-01-01

    We present the first results from an ongoing survey for multiplicity among the bright stars using the Navy Precision Optical Interferometer (NPOI). We first present a summary of NPOI observations of known multiple systems, including the first detection of the companion of $\\beta$ Scuti with precise relative astrometry, to illustrate the instrument's detection sensitivity for binaries at magnitude differences $\\Delta$$m$ $\\lessapprox$ 3 over the range of angular separation 3 - 860 milliarcseconds (mas). A limiting $\\Delta$$m_{700}$ $\\sim$ 3.5 is likely for binaries where the component spectral types differ by less than two. Model fits to these data show good agreement with published orbits, and we additionally present a new orbit solution for one of these stars, $\\sigma$ Her. We then discuss early results of the survey of bright stars at $\\delta$ $\\geq$ -20$\\deg$. This survey, which complements previous surveys of the bright stars by speckle interferometry, initially emphasizes bright stars of spectral types F...

  7. Differential Radial Velocities and Stellar Parameters of Nearby Young Stars

    CERN Document Server

    Yelda, D P S

    2006-01-01

    Radial velocity searches for substellar mass companions have focused primarily on stars older than 1 Gyr. Increased levels of stellar activity in young stars hinders the detection of solar system analogs and therefore there has been a prejudice against inclusion of young stars in radial velocity surveys until recently. Adaptive optics surveys of young stars have given us insight into the multiplicity of young stars but only for massive, distant companions. Understanding the limit of the radial velocity technique, restricted to high-mass, close-orbiting planets and brown dwarfs, we began a survey of young stars of various ages. While the number of stars needed to carry out full analysis of the problems of planetary and brown dwarf population and evolution is large, the beginning of such a sample is included here. We report on 61 young stars ranging in age from beta Pic association (~12 Myr) to the Ursa Majoris association (~300 Myr). This initial search resulted in no stars showing evidence for companions grea...

  8. Pulsars and quark stars

    CERN Document Server

    Xu, R

    2005-01-01

    Members of the family of pulsar-like stars are distinguished by their different manifestations observed, i.e., radio pulsars, accretion-driven X-ray pulsars, X-ray bursts, anomalous X-ray pulsars/soft gamma-ray repeaters, compact center objects, and dim thermal neutron stars. Though one may conventionally think that these stars are normal neutron stars, it is still an open issue whether they are actually neutron stars or quark stars, as no convincing work, either theoretical from first principles or observational, has confirmed Baade-Zwicky's original idea that supernovae produce neutron stars. After introducing briefly the history of pulsars and quark stars, the author summarizes the recent achievements in his pulsar group, including quark matter phenomenology at low temperature, starquakes of solid pulsars, low-mass quark stars, and the pulsar magnetospheric activities.

  9. Brightness Independent 4-Star Matching Algorithm for Lost-in-Space 3-Axis Attitude Acquisition

    Institute of Scientific and Technical Information of China (English)

    DONG Ying; XING Fei; YOU Zheng

    2006-01-01

    A star identification algorithm was developed for a charge-coupled device (CCD) or complementary metal-oxide-semiconductor (CMOS) autonomous star tracker to acquire 3-axis attitude information for a lost-in-space spacecraft. The algorithm took advantage of an efficient on-board database and an original "4-star matching" pattern recognition strategy to achieve fast and reliable star identification. The on-board database was composed of a brightness independent guide star catalog (mission catalog) and a K-vector star pair catalog. The star pattern recognition method involved direct location of star pair candidates and a simple array matching procedure. Tests of the algorithm with a CMOS active pixel sensor (APS) star tracker result in a 99.9% success rate for star identification for lost-in-space 3-axis attitude acquisition when the angular measurement accuracy of the star tracker is at least 0.01°. The brightness independent algorithm requires relatively higher measurement accuracy of the star apparent positions that can be easily achieved by CCD or CMOS sensors along with subpixel centroiding techniques.

  10. Beta and Gamma Gradients

    DEFF Research Database (Denmark)

    Løvborg, Leif; Gaffney, C. F.; Clark, P. A.;

    1985-01-01

    Experimental and/or theoretical estimates are presented concerning, (i) attenuation within the sample of beta and gamma radiation from the soil, (ii) the gamma dose within the sample due to its own radioactivity, and (iii) the soil gamma dose in the proximity of boundaries between regions...... of differing radioactivity. It is confirmed that removal of the outer 2 mm of sample is adequate to remove influence from soil beta dose and estimates are made of the error introduced by non-removal. Other evaluations include variation of the soil gamma dose near the ground surface and it appears...

  11. Double beta decay experiments

    International Nuclear Information System (INIS)

    The great sensitivity of double beta decay to neutrino mass and right handed currents has motivated many new and exciting attempts to observe this elusive nuclear phenomenon directly. Experiments in operation and other coming on line in the next one or two years are expected to result in order-of-magnitude improvements in detectable half lives for both the two-neutrino and no-neutrino modes. A brief history of double beta decay experiments is presented together with a discussion of current experimental efforts, including a gas filled time projection chamber being used to study selenium-82. (author)

  12. A probable giant planet imaged in the Beta Pictoris disk

    CERN Document Server

    Lagrange, A -M; Chauvin, G; Fusco, T; Ehrenreich, D; Mouillet, D; Rousset, G; Rouan, D; Allard, F; Gendron, E; Charton, J; Mugnier, L; Rabou, P; Montri, J; Lacombe, F

    2008-01-01

    Since the discovery of its dusty disk in 1984, Beta Pictoris has become the prototype of young early-type planetary systems, and there are now various indications that a massive Jovian planet is orbiting the star at ~ 10 AU. However, no planets have been detected around this star so far. Our goal was to investigate the close environment of Beta Pic, searching for planetary companion(s). Deep adaptive-optics L'-band images of Beta Pic were recorded using the NaCo instrument at the Very Large Telescope. A faint point-like signal is detected at a projected distance of ~ 8 AU from the star, within the North-East side of the dust disk. Various tests were made to rule out with a good confidence level possible instrumental or atmospheric artifacts. The probability of a foreground or background contaminant is extremely low, based in addition on the analysis of previous deep Hubble Space Telescope images. The object L'=11.2 apparent magnitude would indicate a typical temperature of ~1500 K and a mass of ~ 8 Jovian mas...

  13. Spectroscopic variability of two Oe stars

    CERN Document Server

    Rauw, G; Naze, Y; Eversberg, T; Alves, F; Arnold, W; Bergmann, T; Viegas, N G Correia; Fahed, R; Fernando, A; Gonzalez-Perez, J N; Carreira, L F Gouveia; Hempelmann, A; Hunger, T; Knapen, J H; Leadbeater, R; Dias, F Marques; Mittag, M; Moffat, A F J; Reinecke, N; Ribeiro, J; Romeo, N; Gallego, J Sanchez; Santos, E M Dos; Schanne, L; Schmitt, J H M M; Schroeder, K -P; Stahl, O; Stober, Ba; Stober, Be; Vollmann, K

    2015-01-01

    The Oe stars HD45314 and HD60848 have recently been found to exhibit very different X-ray properties: whilst HD60848 has an X-ray spectrum and emission level typical of most OB stars, HD45314 features a much harder and brighter X-ray emission, making it a so-called gamma Cas analogue. Monitoring the optical spectra could provide hints towards the origin of these very different behaviours. We analyse a large set of spectroscopic observations of HD45314 and HD60848, extending over 20 years. We further attempt to fit the H-alpha line profiles of both stars with a simple model of emission line formation in a Keplerian disk. Strong variations in the strengths of the H-alpha, H-beta, and He I 5876 emission lines are observed for both stars. In the case of HD60848, we find a time lag between the variations in the equivalent widths of these lines. The emission lines are double peaked with nearly identical strengths of the violet and red peaks. The H-alpha profile of this star can be successfully reproduced by our mod...

  14. Dicty_cDB: FC-AP05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP05 (Link to dictyBase) - - - Contig-U16521-1 FC-AP05Z (Li...nk to Original site) - - FC-AP05Z 532 - - - - Show FC-AP05 Library FC (Link to library) Clone ID FC-AP05 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP05Q.Seq.d/ Representative seq. ID FC-AP...05Z (Link to Original site) Representative DNA sequence >FC-AP05 (FC-AP05Q) /CSM/FC/FC-AP/FC-AP05Q.Seq....GAGA TCCGTCAAAGTTTCAAGCAAAAAAGTTGTTGCCAAGTAAATAAATAATACTTTTTTCCCT AT sequence update 1997. 3.25 Translated Amino Acid sequence ---AP

  15. Dicty_cDB: FC-AP23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP23 (Link to dictyBase) - G03230 DDB0190153 Contig-U16094-1 FC-AP...23P (Link to Original site) FC-AP23F 515 FC-AP23Z 472 FC-AP23P 987 - - Show FC-AP23 Library FC (Link ...ontig Contig-U16094-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...23Q.Seq.d/ Representative seq. ID FC-AP23P (Link to Original site) Representative DNA sequence >FC-AP23 (FC-AP...23Q) /CSM/FC/FC-AP/FC-AP23Q.Seq.d/ CAAATACATAATCTCTTTTTTGAAAATGTCCGAAAATAACGAAATTGAAATGGAACTCC

  16. Dicty_cDB: FC-AP12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP12 (Link to dictyBase) - G01739 DDB0232214 Contig-U15924-1 FC-AP...12P (Link to Original site) FC-AP12F 323 FC-AP12Z 613 FC-AP12P 936 - - Show FC-AP12 Library FC (Link ...ontig Contig-U15924-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP...12Q.Seq.d/ Representative seq. ID FC-AP12P (Link to Original site) Representative DNA sequence >FC-AP12 (FC-AP...12Q) /CSM/FC/FC-AP/FC-AP12Q.Seq.d/ CATATTATTTTAAATTTCAGATGTTCCCAAAATAACACATTAATTTGCTTTTTTTGTTG

  17. AP1000R licensing and deployment in the United States

    International Nuclear Information System (INIS)

    In recent years, both domestic and foreign utilities have turned to the standardized Westinghouse AP1000 plant design in satisfying their near - and long-term - sustainable energy needs. As direct support to these actions, licensing the AP1000 design has played a significant role by providing one of the fundamental bases in clearing regulatory hurdles leading to the start of new plant construction. Within the U.S. alone, Westinghouse AP1000 licensing activities have reached unprecedented milestones with the approvals of both AP1000 Design Certification and Southern Company's combined construction permit and operating license (COL) application directly supporting the construction of two new nuclear plants in Georgia. Further COL application approvals are immediately pending for an additional two AP1000 plants in South Carolina. And, across the U.S. nuclear industry spectrum, there are 10 other COL applications under regulatory review representing some 16 new plants at 10 sites. In total, these actions represent the first wave of new plant licensing under the regulatory approval process since 1978. Fundamental to the Nuclear Regulatory Commission's AP1000 Design Certification is the formal recognition of the AP1000 passive safety design through regulatory acceptance rulemaking. Through recognition and deployment of the AP1000 Design Certification, the utility licensee / operator of this reactor design are now offered an opportunity to use a simplified 'one-step' combined license process, thereby managing substantial back-end construction schedule risk from regulatory and intervention delays. Application of this regulatory philosophy represents both acceptance and encouragement of standardized reactor designs like the AP1000. With the recent AP1000 Design Certification and utility COL acceptances, the fundamental licensing processes of this philosophy have successfully proven the attainment of significant milestones with the next stage licensing actions directed

  18. Evaluation of neutrino masses from $m_{\\beta\\beta}$ values

    CERN Document Server

    Khrushchov, V V

    2008-01-01

    A neutrino mass matrix is considered under conditions of the CP invariance and the negligible reactor mixing $\\theta_{13}$ angle. Absolute mass values for three neutrinos are evaluated in normal and inverted hierarchy spectra on the ground of data for oscillation mixing neutrino parameters and effective neutrino mass entering into a probability of neutrinoless two beta decay $m_{\\beta\\beta}$ values.

  19. EK Eridani: the tip of the iceberg of giants which have evolved from magnetic Ap stars

    OpenAIRE

    Aurière, M.; Konstantinova-Antova, R.; Petit, P.; Charbonnel, C.; Dintrans, B.; Lignières, F.; Roudier, T.; Alecian, E.; Donati, J. F.; Landstreet, J. D.; Wade, G. A.

    2008-01-01

    We observe the slowly-rotating, active, single giant, EK Eri, to study and infer the nature of its magnetic field directly. We used the spectropolarimeter NARVAL at the Telescope Bernard Lyot, Pic du Midi Observatory, and the Least Square Deconvolution method to create high signal-to-noise ratio Stokes V profiles. We fitted the Stokes V profiles with a model of the large-scale magnetic field. We studied the classical activity indicators, the CaII H and K lines, the CaII infrared triplet, and ...

  20. Trichoderma .beta.-glucosidase

    Science.gov (United States)

    Dunn-Coleman, Nigel; Goedegebuur, Frits; Ward, Michael; Yao, Jian

    2006-01-03

    The present invention provides a novel .beta.-glucosidase nucleic acid sequence, designated bgl3, and the corresponding BGL3 amino acid sequence. The invention also provides expression vectors and host cells comprising a nucleic acid sequence encoding BGL3, recombinant BGL3 proteins and methods for producing the same.

  1. Applied Beta Dosimetry

    Energy Technology Data Exchange (ETDEWEB)

    Rich, B.L.

    1986-01-01

    Measurements of beta and/or nonpenetrating exposure results is complicated and past techniques and capabilities have resulted in significant inaccuracies in recorded results. Current developments have resulted in increased capabilities which make the results more accurate and should result in less total exposure to the work force. Continued development of works in progress should provide equivalent future improvements.

  2. Neutrinoless Double Beta Decay

    CERN Document Server

    Päs, Heinrich

    2015-01-01

    We review the potential to probe new physics with neutrinoless double beta decay $(A,Z) \\to (A,Z+2) + 2 e^-$. Both the standard long-range light neutrino mechanism as well as short-range mechanisms mediated by heavy particles are discussed. We also stress aspects of the connection to lepton number violation at colliders and the implications for baryogenesis.

  3. Production of Proteasome Inhibitor Syringolin A by the Endophyte Rhizobium sp. Strain AP16

    Science.gov (United States)

    Bigler, Laurent; Dudler, Robert

    2014-01-01

    Syringolin A, the product of a mixed nonribosomal peptide synthetase/polyketide synthase encoded by the syl gene cluster, is a virulence factor secreted by certain Pseudomonas syringae strains. Together with the glidobactins produced by a number of beta- and gammaproteobacterial human and animal pathogens, it belongs to the syrbactins, a structurally novel class of proteasome inhibitors. In plants, proteasome inhibition by syringolin A-producing P. syringae strains leads to the suppression of host defense pathways requiring proteasome activity, such as the ones mediated by salicylic acid and jasmonic acid. Here we report the discovery of a syl-like gene cluster with some unusual features in the alphaproteobacterial endophyte Rhizobium sp. strain AP16 that encodes a putative syringolin A-like synthetase whose components share 55% to 65% sequence identity (72% to 79% similarity) at the amino acid level. As revealed by average nucleotide identity (ANI) calculations, this strain likely belongs to the same species as biocontrol strain R. rhizogenes K84 (formely known as Agrobacterium radiobacter K84), which, however, carries a nonfunctional deletion remnant of the syl-like gene cluster. Here we present a functional analysis of the syl-like gene cluster of Rhizobium sp. strain AP16 and demonstrate that this endophyte synthesizes syringolin A and some related minor variants, suggesting that proteasome inhibition by syrbactin production can be important not only for pathogens but also for endophytic bacteria in the interaction with their hosts. PMID:24727275

  4. Standard Stars for the BYU H-alpha Photometric System (Abstract)

    Science.gov (United States)

    Joner, M.; Hintz, E.

    2015-12-01

    (Abstract only) We present primary standard stars for the BYU H-alpha photometric system. This system is similar to the H-beta photometric system that is often used with the intermediate band uvby system. Both systems use the difference between magnitudes measured in a wide (15-20-nm) and narrow (3-nm) bandpass centered on one of the strong Balmer lines of hydrogen to establish a color index. Line indices formed in this manner are independent of atmospheric extinction and interstellar reddening. These indices provide intrinsic measures of effective temperature for stars with spectral types between B and G. The present primary standard stars for the BYU system as established using spectroscopic observations that cover the region between the H-alpha and H-beta lines. The indices were formed using synthetic photometry reductions to convolve ideal filter profiles with the observed spectra. The number of observations per star is generally in excess of 25. Some stars have been observed more than 100 times over a period of 7 years. The typical error per observation for these stars is on the order of 1-3 mmag. In addition to the standard field stars, we present H-alpha and H-beta observations of individual stars that are members of selected open clusters. These include the Hyades, Pleiades, Coma, and NGC 752 clusters. Additional stars that exhibit varying degrees of hydrogen emission are easily distinguished in a plot of the alpha-beta plane. We have found that candidates for emission line objects, high mass x-ray binaries, and young stellar objects are readily identified in our alpha-beta plots. We acknowledge continued support from the BYU College of Physical and Mathematical Sciences as well as support from NSF Grant AST #0618209. We also thank the Dominion Astrophysical Observatory for continued allocation of robotic observing time for spectroscopy on the 1.2-m telescope.

  5. Further stable neutron star models from f(R) gravity

    Energy Technology Data Exchange (ETDEWEB)

    Astashenok, Artyom V. [I. Kant Baltic Federal University, Institute of Physics and Technology, Nevskogo st. 14, Kaliningrad, 236041 (Russian Federation); Capozziello, Salvatore [Dipartimento di Fisica, Università di Napoli ' ' Federico II' ' , Via Cinthia, 9, Napoli, I–80126 (Italy); Odintsov, Sergei D., E-mail: artyom.art@gmail.com, E-mail: capozziello@na.infn.it, E-mail: odintsov@ieec.uab.es [Instituciò Catalana de Recerca i Estudis Avançats (ICREA), Barcelona (Spain)

    2013-12-01

    Neutron star models in perturbative f(R) gravity are considered with realistic equations of state. In particular, we consider the FPS, SLy and other equations of state and a case of piecewise equation of state for stars with quark cores. The mass-radius relations for f(R) = R+R(e{sup −R/R{sub 0}}−1) model and for R{sup 2} models with logarithmic and cubic corrections are obtained. In the case of R{sup 2} gravity with cubic corrections, we obtain that at high central densities (ρ > 10ρ{sub ns}, where ρ{sub ns} = 2.7 × 10{sup 14} g/cm{sup 3} is the nuclear saturation density), stable star configurations exist. The minimal radius of such stars is close to 9 km with maximal mass ∼ 1.9M{sub ⊙} (SLy equation). A similar situation takes place for AP4 and BSK20 EoS. Such an effect can give rise to more compact stars than in General Relativity. If observationally identified, such objects could constitute a formidable signature for modified gravity at astrophysical level. Another interesting result can be achieved in modified gravity with only a cubic correction. For some EoS, the upper limit of neutron star mass increases and therefore these EoS can describe realistic star configurations (although, in General Relativity, these EoS are excluded by observational constraints)

  6. Interferon Beta-1b Injection

    Science.gov (United States)

    Interferon beta-1b injection is used to reduce episodes of symptoms in patients with relapsing-remitting (course ... and problems with vision, speech, and bladder control). Interferon beta-1b is in a class of medications ...

  7. Genetics Home Reference: beta thalassemia

    Science.gov (United States)

    ... for Disease Control and Prevention Centre for Genetics Education (Australia) Cold Spring Harbor Laboratory: Your Genes Your Health Disease InfoSearch: Beta Thalassemia Genomics Education Programme (UK) MalaCards: dominant beta-thalassemia Merck Manual ...

  8. Star Formation in Galaxies

    Science.gov (United States)

    1987-01-01

    Topics addressed include: star formation; galactic infrared emission; molecular clouds; OB star luminosity; dust grains; IRAS observations; galactic disks; stellar formation in Magellanic clouds; irregular galaxies; spiral galaxies; starbursts; morphology of galactic centers; and far-infrared observations.

  9. ENERGY STAR Certified Boilers

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 3.0 ENERGY STAR Program Requirements for Boilers that are effective as of October 1,...

  10. ENERGY STAR Certified Furnaces

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 4.0 ENERGY STAR Program Requirements for Furnaces that are effective as of February 1,...

  11. ENERGY STAR Certified Computers

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 6.1 ENERGY STAR Program Requirements for Computers that are effective as of June 2,...

  12. 'Polaris, Mark Kummerfeldt's Star, and My Star.'

    Science.gov (United States)

    McLure, John W.

    1984-01-01

    In most astronomy courses, descriptions of stars and constellations reveal the western European origins of the astronomers who named them. However, it is suggested that a study of non-western views be incorporated into astronomy curricula. Descriptions of various stars and constellations from different cultures and instructional strategies are…

  13. AP600 design certification thermal hydraulics testing and analysis

    International Nuclear Information System (INIS)

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power

  14. AP600 design certification thermal hydraulics testing and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Hochreiter, L.E.; Piplica, E.J.

    1995-09-01

    Westinghouse Electric Corporation, in conjunction with the Department of Energy and the Electric Power Research Institute, have been developing an advanced light water reactor design; the AP600. The AP600 is a 1940 Mwt, 600Mwe unit which is similar to a Westinghouse two-loop Pressurized Water Reactor. The accumulated knowledge on reactor design to reduce the capital costs, construction time, and the operational and maintenance cost of the unit once it begins to generate electrical power. The AP600 design goal is to maintain an overall cost advantage over fossil generated electrical power.

  15. A new gap separation mechanism for APS insertion devices.

    Energy Technology Data Exchange (ETDEWEB)

    Trakhtenberg, E. M.; Tcheskidov, V.; Den Hartog, P. K.; Deriy, B.; Erdmann, M.; Makarov, O.; Moog, E. R.

    1999-10-25

    A new gap separation mechanism for use with the standard Advanced Photon Source (APS) 3.3-cm-period undulator magnetic structures has been designed and built and the first system has been installed in the APS storage ring. The system allows a minimum magnetic gap of 10 mm for use with the APS 8-mm insertion device vacuum chambers. The mechanism is a bolted steel frame structure with a simple 4-motor mechanical drive train. The control system uses servomotors with incremental rotary encoders and virtual absolute linear encoders.

  16. Beta emitters and radiation protection

    DEFF Research Database (Denmark)

    Jødal, Lars

    2009-01-01

    BACKGROUND. Beta emitters, such as 90Y, are increasingly being used for cancer treatment. However, beta emitters demand other precautions than gamma emitters during preparation and administration, especially concerning shielding. AIM. To discuss practical precautions for handling beta emitters...... on the outside of the primary shielding material. If suitable shielding is used and larger numbers of handlings are divided among several persons, then handling of beta emitters can be a safe procedure....

  17. Cool Stars in Hot Places

    OpenAIRE

    Megeath, S. T.; Gaidos, E.; Hester, J. J.; Adams, F. C.; Bally, J.; Lee, J. -E.; Wolk, S.

    2007-01-01

    During the last three decades, evidence has mounted that star and planet formation is not an isolated process, but is influenced by current and previous generations of stars. Although cool stars form in a range of environments, from isolated globules to rich embedded clusters, the influences of other stars on cool star and planet formation may be most significant in embedded clusters, where hundreds to thousands of cool stars form in close proximity to OB stars. At the cool stars 14 meeting, ...

  18. Metal-Poor Stars

    OpenAIRE

    Frebel, Anna

    2008-01-01

    The abundance patterns of metal-poor stars provide us a wealth of chemical information about various stages of the chemical evolution of the Galaxy. In particular, these stars allow us to study the formation and evolution of the elements and the involved nucleosynthesis processes. This knowledge is invaluable for our understanding of the cosmic chemical evolution and the onset of star- and galaxy formation. Metal-poor stars are the local equivalent of the high-redshift Universe, and offer cru...

  19. Autonomous Star Tracker Algorithms

    DEFF Research Database (Denmark)

    Betto, Maurizio; Jørgensen, John Leif; Kilsgaard, Søren;

    1998-01-01

    Proposal, in response to an ESA R.f.P., to design algorithms for autonomous star tracker operations.The proposal also included the development of a star tracker breadboard to test the algorithms performances.......Proposal, in response to an ESA R.f.P., to design algorithms for autonomous star tracker operations.The proposal also included the development of a star tracker breadboard to test the algorithms performances....

  20. Medida de actividades Alfa y Beta en muestras ambientales con un detector proporcional y detección de 99Tc

    OpenAIRE

    García de León, Manuel

    1983-01-01

    Se utiliza un detector proporcional de flujo de gas para la medida de actividades Alfa y Beta ambientales y la detección de 99Tc. Se estudia la respuesta del detector a la radiación beta relacionando de una manera sistemática la energía máxima del espectro del emisor beta con la forma del platean producido. De la misma manera se estudia la medida de partículas alfa. Haciendo las correcciones por efecto de Crosstalk se propone un método de recuento simultaneo de radiación Alfa y Beta. Y se ap...

  1. Misleading Betas: An Educational Example

    Science.gov (United States)

    Chong, James; Halcoussis, Dennis; Phillips, G. Michael

    2012-01-01

    The dual-beta model is a generalization of the CAPM model. In the dual-beta model, separate beta estimates are provided for up-market and down-market days. This paper uses the historical "Anscombe quartet" results which illustrated how very different datasets can produce the same regression coefficients to motivate a discussion of the…

  2. TGF-beta and osteoarthritis.

    NARCIS (Netherlands)

    Blaney Davidson, E.N.; Kraan, P.M. van der; Berg, W.B. van den

    2007-01-01

    OBJECTIVE: Cartilage damage is a major problem in osteoarthritis (OA). Growth factors like transforming growth factor-beta (TGF-beta) have great potential in cartilage repair. In this review, we will focus on the potential therapeutic intervention in OA with TGF-beta, application of the growth facto

  3. The MONS Star Trackers

    CERN Document Server

    Bedding, T R; Bedding, Timothy R.; Kjeldsen, Hans

    2000-01-01

    The MONS satellite will have two Star Trackers to sense the spacecraft attitude, and we plan to use them as scientific instruments to perform high-precision photometry of thousands of stars. We briefly describe the current plans for the Star Trackers and their expected capabilities.

  4. Superfluid neutron stars

    OpenAIRE

    Langlois, David

    2001-01-01

    Neutron stars are believed to contain (neutron and proton) superfluids. I will give a summary of a macroscopic description of the interior of neutron stars, in a formulation which is general relativistic. I will also present recent results on the oscillations of neutron stars, with superfluidity explicitly taken into account, which leads in particular to the existence of a new class of modes.

  5. America's Star Libraries

    Science.gov (United States)

    Lyons, Ray; Lance, Keith Curry

    2009-01-01

    "Library Journal"'s new national rating of public libraries, the "LJ" Index of Public Library Service, identifies 256 "star" libraries. It rates 7,115 public libraries. The top libraries in each group get five, four, or three Michelin guide-like stars. All included libraries, stars or not, can use their scores to learn from their peers and improve…

  6. Dicty_cDB: FC-AP17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4.1 SJMBIB09 SJM Schistosoma japonicum cDNA, mRNA sequence. 80 8e-20 2 BE859184 |BE859184.1 SsS0499 Suaeda salsa ZAP...FC (Link to library) FC-AP17 (Link to dictyBase) - - - Contig-U16254-1 FC-AP17Z (Li...nk to Original site) - - FC-AP17Z 546 - - - - Show FC-AP17 Library FC (Link to library) Clone ID FC-AP17 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP17Q.Seq.d/ Representative seq. ID FC-AP...17Z (Link to Original site) Representative DNA sequence >FC-AP17 (FC-AP17Q) /CSM/FC/FC-AP/FC-AP17Q.Seq.

  7. Dicty_cDB: FC-AP11 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone IMAGE:4920557 5', mRNA sequence. 56 1e-04 2 BF345929 |BF345929.1 602017931F1 NCI_CGAP_Brn67 Homo sap...FC (Link to library) FC-AP11 (Link to dictyBase) - - - Contig-U16101-1 FC-AP11F (Li...nk to Original site) FC-AP11F 394 - - - - - - Show FC-AP11 Library FC (Link to library) Clone ID FC-AP11 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP11Q.Seq.d/ Representative seq. ID FC-AP...11F (Link to Original site) Representative DNA sequence >FC-AP11 (FC-AP11Q) /CSM/FC/FC-AP/FC-AP11Q.Seq.

  8. Dicty_cDB: FC-AP18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP18 (Link to dictyBase) - - - Contig-U16455-1 FC-AP18Z (Li...nk to Original site) - - FC-AP18Z 367 - - - - Show FC-AP18 Library FC (Link to library) Clone ID FC-AP18 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP18Q.Seq.d/ Representative seq. ID FC-AP...18Z (Link to Original site) Representative DNA sequence >FC-AP18 (FC-AP18Q) /CSM/FC/FC-AP/FC-AP18Q.Seq....XELTPSRPMCVESFNEYPP LGRFAVRDMGQTVAVGVIKSTVKKAPGKAGDKKGAXAPSKKK*innis**iafynnfkkk kkkkk Translated Amino Acid

  9. Dicty_cDB: FC-AP16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AP16 (Link to dictyBase) - - - Contig-U16269-1 FC-AP16Z (Li...nk to Original site) - - FC-AP16Z 552 - - - - Show FC-AP16 Library FC (Link to library) Clone ID FC-AP16 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AP/FC-AP16Q.Seq.d/ Representative seq. ID FC-AP...16Z (Link to Original site) Representative DNA sequence >FC-AP16 (FC-AP16Q) /CSM/FC/FC-AP/FC-AP16Q.Seq....7. 3.28 Translated Amino Acid sequence ---RNRRYKVRKGPLVVVSGKTTVSQALRNIPGVEVANVSRLNLLKLAPGGHLGRFIIWT KSAFEQLD

  10. A Resolved Census of Millimeter Emission from Taurus Multiple Star Systems

    CERN Document Server

    Harris, Robert J; Wilner, David J; Kraus, Adam L

    2012-01-01

    We present a high angular resolution millimeter-wave dust continuum imaging survey of circumstellar material associated with individual components of 23 multiple star systems in the Taurus-Auriga young cluster. Combined with previous measurements, these new data permit a comprehensive look at how millimeter luminosity (a tracer of disk mass) relates to the separation and mass of a stellar companion. Approximately one third (28-37%) of individual stars in multiples have detectable millimeter emission, a rate half that for single stars (~62%). There is a strong correlation between the luminosity and projected separation (a_p) of a stellar pair. Wide pairs (a_p > 300 AU) have a similar luminosity distribution as single stars, medium pairs (a_p ~ 30-300 AU) are a factor of 5 fainter, and close pairs (a_p < 30 AU) are ~ 5 times fainter yet (aside from a small population of bright circumbinary disks). In most cases, the emission is dominated by a disk around the primary (or a wide tertiary in triples), but there...

  11. Tank characterization report for double shell tank 241-AP-104

    Energy Technology Data Exchange (ETDEWEB)

    Winkelman, W.D., Westinghouse Hanford

    1996-08-07

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AP-104. This report supports the requirements of Tri-Party Agreement Milestone M-44-09.

  12. Lumbar pedicle screw placement: Using only AP plane imaging

    Directory of Open Access Journals (Sweden)

    Anil Sethi

    2012-01-01

    Conclusion: Placement of pedicle screws under fluoroscopic guidance using AP plane imaging alone with tactile guidance is safe, fast, and reliable. However, a good understanding of the radiographic landmarks is a prerequisite.

  13. Utilizing Synthetic UV Spectra to Explore the Physical Basis for the Classification of Lambda Boötis Stars

    Science.gov (United States)

    Cheng, Kwang-Ping; Neff, James E.; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A.; Prabhaker, Arvind; Steele, Patricia A.; Gray, Richard O.; Corbally, Christopher J.

    2016-04-01

    Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show mild to extreme deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This intriguing stellar class has recently regained the spotlight because of the directly imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star, Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. The possible link between Lambda Boo stars and planet-bearing stars motivates us to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Boötis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. In order to determine the origin of Lambda Boo stars’ unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. In this paper, using observed and synthetic spectra, we explore the physical basis for the classification of Lambda Boo stars, and develop quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. Based on these stricter Lambda Boo classification criteria, we conclude that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars.

  14. UTILIZING SYNTHETIC UV SPECTRA TO EXPLORE THE PHYSICAL BASIS FOR THE CLASSIFICATION OF LAMBDA BOÖTIS STARS

    Energy Technology Data Exchange (ETDEWEB)

    Cheng, Kwang-Ping; Johnson, Dustin M.; Tarbell, Erik S.; Romo, Christopher A.; Prabhaker, Arvind [Cal. State Univ., Fullerton, Fullerton, CA (United States); Neff, James E.; Steele, Patricia A. [College of Charleston, Charleston, SC (United States); Gray, Richard O. [Appalachian State Univ., Boone, NC (United States); Corbally, Christopher J. [Vatican Observatory, Tucson, AZ (United States)

    2016-04-15

    Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show mild to extreme deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This intriguing stellar class has recently regained the spotlight because of the directly imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star, Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. The possible link between Lambda Boo stars and planet-bearing stars motivates us to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Boötis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. In order to determine the origin of Lambda Boo stars’ unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. In this paper, using observed and synthetic spectra, we explore the physical basis for the classification of Lambda Boo stars, and develop quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. Based on these stricter Lambda Boo classification criteria, we conclude that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars.

  15. Roles of AP-2 in clathrin-mediated endocytosis.

    Directory of Open Access Journals (Sweden)

    Emmanuel Boucrot

    Full Text Available BACKGROUND: The notion that AP-2 clathrin adaptor is an essential component of an endocytic clathrin coat appears to conflict with recent observations that substantial AP-2 depletion, using RNA interference with synthesis of AP-2 subunits, fails to block uptake of certain ligands known to internalize through a clathrin-based pathway. METHODOLOGY/PRINCIPAL FINDINGS: We report here the use of in vivo imaging data obtained by spinning-disk confocal microscopy to study the formation of clathrin-coated structures at the plasma membranes of BSC1 and HeLa cells depleted by RNAi of the clathrin adaptor, AP-2. Very few clathrin coats continue to assemble after AP-2 knockdown. Moreover, there is a total absence of clathrin-containing structures completely lacking AP-2 while all the remaining coats still contain a small amount of AP-2. These observations suggest that AP-2 is essential for endocytic coated-pit and coated-vesicle formation. We also find that AP-2 knockdown strongly inhibits light-density lipoprotein (LDL receptor-mediated endocytosis, as long as cells are maintained in complete serum and at 37 degrees C. If cells are first incubated with LDL at 4 degrees C, followed by warming, there is little or no decrease in LDL uptake with respect to control cells. LDL uptake at 37 degrees C is also not affected in AP-2 depleted cells first deprived of LDL by incubation with either serum-starved or LDL-starved cells for 24 hr. The LDL-deprived cells display a significant increase in endocytic structures enriched on deeply invaginated tubes that contain LDL and we suggest that under this condition of stress, LDL might enter through this alternative pathway. CONCLUSIONS/SIGNIFICANCE: These results suggest that AP-2 is essential for endocytic clathrin coated-pit and coated-vesicle formation. They also indicate that under normal conditions, functional endocytic clathrin coated pits are required for LDL internalization. We also show that under certain

  16. AP-102/104 Retrieval control system qualification test procedure

    Energy Technology Data Exchange (ETDEWEB)

    RIECK, C.A.

    1999-05-18

    This Qualification Test Procedure documents the results of the qualification testing that was performed on the Project W-211, ''Initial Tank Retrieval Systems,'' retrieval control system (RCS) for tanks 241-AP-102 and 241-AP-104. The results confirm that the RCS has been programmed correctly and that the two related hardware enclosures have been assembled in accordance with the design documents.

  17. AP1000 design adaptation to European Markets and EUR compliance

    International Nuclear Information System (INIS)

    The AP1000 plant is an 1100-MWe pressurized water reactor (PWR) with passive safety features and extensive plant simplifications that enhance construction, operation, maintenance and safety. One of the key approaches in the AP1000 design is to use passive features to mitigate design basis accidents. In addition to redundancy, these features incorporate diversity based on PRA insights. The AP1000 design has incorporated a standardization approach, which together with the level of safety achieved by the passive safety features, results in a plant design that can be applied to different geographical regions with varying regulatory standards and utility expectations without major changes. Westinghouse has cooperated for almost 2 decades with European utilities to ensure adaptation of the AP1000 design to European market. The AP1000 50 Hz standard design (also referred to as European Passive Standard) is the resulting adaptation of the AP1000 design to European market needs and requirements, addressing both customer input from the EPP program and regulatory needs identified in the UK GDA process. This standard 50 Hz design retains the overall AP1000 design (safe, simple, standard), the use of proven components and its cost, safety and operability advantages, while it incorporates some changes to adapt to the European environment. In this paper, the key changes incorporated into the AP1000 50 Hz design are discussed, including: -) Adaptation of the electrical systems and Turbine adaptation from 60 Hz to 50 Hz, including approach to IEC vs IEEE compliance; -) Modifications to defense in depth (US class D, European Class 2) and other systems to simplify European licensing and address customer requirements; -) Option for adoption of KSB RUV type Main Reactor Coolant Pumps; -) Limited design adaptations in the areas of instrumentation-control and ventilation and filtration to adapt to European requirements and simplify the licensing process

  18. Analysis and characterization of double shell tank 241-AP-108

    International Nuclear Information System (INIS)

    This document is the first part of a three-part report describing the analysis and characterization of double shell tank 241-AP-108 which is located at the Hanford Reservation.This document is the analytical laboratory data package entitled 'Analysis and Characterization of Double Shell Tank 241-AP-108' which contains a case sampling history, the sampling protocols, the analytical procedures, sampling and analysis quality assurance and quality control measures, and chemical analysis results for samples obtained from the tank

  19. Rotating Stars in Relativity

    Directory of Open Access Journals (Sweden)

    Stergioulas Nikolaos

    2003-01-01

    Full Text Available Rotating relativistic stars have been studied extensively in recent years, both theoretically and observationally, because of the information they might yield about the equation of state of matter at extremely high densities and because they are considered to be promising sources of gravitational waves. The latest theoretical understanding of rotating stars in relativity is reviewed in this updated article. The sections on the equilibrium properties and on the nonaxisymmetric instabilities in f-modes and r-modes have been updated and several new sections have been added on analytic solutions for the exterior spacetime, rotating stars in LMXBs, rotating strange stars, and on rotating stars in numerical relativity.

  20. Nuclear physics of stars

    CERN Document Server

    Iliadis, Christian

    2015-01-01

    Most elements are synthesized, or ""cooked"", by thermonuclear reactions in stars. The newly formed elements are released into the interstellar medium during a star's lifetime, and are subsequently incorporated into a new generation of stars, into the planets that form around the stars, and into the life forms that originate on the planets. Moreover, the energy we depend on for life originates from nuclear reactions that occur at the center of the Sun. Synthesis of the elements and nuclear energy production in stars are the topics of nuclear astrophysics, which is the subject of this book

  1. Homology modeling of dissimilatory APS reductases (AprBA of sulfur-oxidizing and sulfate-reducing prokaryotes.

    Directory of Open Access Journals (Sweden)

    Birte Meyer

    Full Text Available BACKGROUND: The dissimilatory adenosine-5'-phosphosulfate (APS reductase (cofactors flavin adenine dinucleotide, FAD, and two [4Fe-4S] centers catalyzes the transformation of APS to sulfite and AMP in sulfate-reducing prokaryotes (SRP; in sulfur-oxidizing bacteria (SOB it has been suggested to operate in the reverse direction. Recently, the three-dimensional structure of the Archaeoglobus fulgidus enzyme has been determined in different catalytically relevant states providing insights into its reaction cycle. METHODOLOGY/PRINCIPAL FINDINGS: Full-length AprBA sequences from 20 phylogenetically distinct SRP and SOB species were used for homology modeling. In general, the average accuracy of the calculated models was sufficiently good to allow a structural and functional comparison between the beta- and alpha-subunit structures (78.8-99.3% and 89.5-96.8% of the AprB and AprA main chain atoms, respectively, had root mean square deviations below 1 A with respect to the template structures. Besides their overall conformity, the SRP- and SOB-derived models revealed the existence of individual adaptations at the electron-transferring AprB protein surface presumably resulting from docking to different electron donor/acceptor proteins. These structural alterations correlated with the protein phylogeny (three major phylogenetic lineages: (1 SRP including LGT-affected Archaeoglobi and SOB of Apr lineage II, (2 crenarchaeal SRP Caldivirga and Pyrobaculum, and (3 SOB of the distinct Apr lineage I and the presence of potential APS reductase-interacting redox complexes. The almost identical protein matrices surrounding both [4Fe-4S] clusters, the FAD cofactor, the active site channel and center within the AprB/A models of SRP and SOB point to a highly similar catalytic process of APS reduction/sulfite oxidation independent of the metabolism type the APS reductase is involved in and the species it has been originated from. CONCLUSIONS: Based on the comparative

  2. Erratum: ``A Low-Latitude Halo Stream around the Milky Way'' (ApJ, 588, 824 [2003])

    Science.gov (United States)

    Yanny, Brian; Newberg, Heidi Jo; Grebel, Eva K.; Kent, Steve; Odenkirchen, Michael; Rockosi, Connie M.; Schlegel, David; Subbarao, Mark; Brinkmann, Jon; Fukugita, Masataka; Ivezic, Željko; Lamb, Don Q.; Schneider, Donald P.; York, Donald G.

    2004-04-01

    The zero points of the stellar templates used to measure radial velocity in the main body of this paper have been found to be systematically in error. Correction of the radial velocities significantly increases the derived circular velocity of the stars in the planar stream, to 215+/-25 km s-1. The velocity dispersion of the stream is somewhat lower than earlier results with the modified analysis. Two types of stars were studied in this paper. The original template for stars of type F, used to study the ``Monoceros arc'' Galactic structure, was incorrectly zero-pointed by 20 km s-1. The original template for stars of type A, used to measure the Sagittarius dwarf tidal stream, produced radial velocities systematically shifted by 49 km s-1. In both cases, the sign of the error is such that for nearly all stars, the correct values of the heliocentric radial velocities are lower than those originally quoted. A cross-correlation of Sloan Digital Sky Survey (SDSS) spectra with templates from the ELODIE survey (C. Soubiran, D. Katz, & R. Cayrel, ApJ, 588, 824 [2003]) was performed to find new radial velocities for each star (D. Schlegel 2003, private communication). This showed that our radial velocities were systematically shifted by an amount that depends on the type of the star observed and the original template against which it was cross-correlated. To determine the measurement error with the new templates, we identified 445 F-type stars and 1109 A-type stars that had been observed twice by the SDSS. These stars were chosen with the color and magnitude criteria used to select stars in Figures 6 and 9. The errors in the F stars were a good match to a Gaussian with a σ of 28 km s-1. The errors in the A star comparison were significantly non-Gaussian, with large tails. A χ2 fit to a Gaussian (similar to the technique we use in this paper to measure the width of the streams) yielded a σ of 35 km s-1. Dividing by sqrt(2) to reflect two independent measurements, we

  3. MASSIVE INFANT STARS ROCK THEIR CRADLE

    Science.gov (United States)

    2002-01-01

    Extremely intense radiation from newly born, ultra-bright stars has blown a glowing spherical bubble in the nebula N83B, also known as NGC 1748. A new NASA Hubble Space Telescope image has helped to decipher the complex interplay of gas and radiation of a star-forming region in a nearby galaxy. The image graphically illustrates just how these massive stars sculpt their environment by generating powerful winds that alter the shape of the parent gaseous nebula. These processes are also seen in our Milky Way in regions like the Orion Nebula. The Hubble telescope is famous for its contribution to our knowledge about star formation in very distant galaxies. Although most of the stars in the Universe were born several billions of years ago, when the Universe was young, star formation still continues today. This new Hubble image shows a very compact star-forming region in a small part of one of our neighboring galaxies - the Large Magellanic Cloud. This galaxy lies only 165,000 light-years from our Milky Way and can easily be seen with the naked eye from the Southern Hemisphere. Young, massive, ultra-bright stars are seen here just as they are born and emerge from the shelter of their pre-natal molecular cloud. Catching these hefty stars at their birthplace is not as easy as it may seem. Their high mass means that the young stars evolve very rapidly and are hard to find at this critical stage. Furthermore, they spend a good fraction of their youth hidden from view, shrouded by large quantities of dust in a molecular cloud. The only chance is to observe them just as they start to emerge from their cocoon - and then only with very high-resolution telescopes. Astronomers from France, the U.S., and Germany have used Hubble to study the fascinating interplay between gas, dust, and radiation from the newly born stars in this nebula. Its peculiar and turbulent structure has been revealed for the first time. This high-resolution study has also uncovered several individual stars

  4. Beta-thalassemia.

    Science.gov (United States)

    Galanello, Renzo; Origa, Raffaella

    2010-05-21

    Beta-thalassemias are a group of hereditary blood disorders characterized by anomalies in the synthesis of the beta chains of hemoglobin resulting in variable phenotypes ranging from severe anemia to clinically asymptomatic individuals. The total annual incidence of symptomatic individuals is estimated at 1 in 100,000 throughout the world and 1 in 10,000 people in the European Union. Three main forms have been described: thalassemia major, thalassemia intermedia and thalassemia minor. Individuals with thalassemia major usually present within the first two years of life with severe anemia, requiring regular red blood cell (RBC) transfusions. Findings in untreated or poorly transfused individuals with thalassemia major, as seen in some developing countries, are growth retardation, pallor, jaundice, poor musculature, hepatosplenomegaly, leg ulcers, development of masses from extramedullary hematopoiesis, and skeletal changes that result from expansion of the bone marrow. Regular transfusion therapy leads to iron overload-related complications including endocrine complication (growth retardation, failure of sexual maturation, diabetes mellitus, and insufficiency of the parathyroid, thyroid, pituitary, and less commonly, adrenal glands), dilated myocardiopathy, liver fibrosis and cirrhosis). Patients with thalassemia intermedia present later in life with moderate anemia and do not require regular transfusions. Main clinical features in these patients are hypertrophy of erythroid marrow with medullary and extramedullary hematopoiesis and its complications (osteoporosis, masses of erythropoietic tissue that primarily affect the spleen, liver, lymph nodes, chest and spine, and bone deformities and typical facial changes), gallstones, painful leg ulcers and increased predisposition to thrombosis. Thalassemia minor is clinically asymptomatic but some subjects may have moderate anemia. Beta-thalassemias are caused by point mutations or, more rarely, deletions in the beta

  5. Beta-thalassemia

    Directory of Open Access Journals (Sweden)

    Origa Raffaella

    2010-05-01

    Full Text Available Abstract Beta-thalassemias are a group of hereditary blood disorders characterized by anomalies in the synthesis of the beta chains of hemoglobin resulting in variable phenotypes ranging from severe anemia to clinically asymptomatic individuals. The total annual incidence of symptomatic individuals is estimated at 1 in 100,000 throughout the world and 1 in 10,000 people in the European Union. Three main forms have been described: thalassemia major, thalassemia intermedia and thalassemia minor. Individuals with thalassemia major usually present within the first two years of life with severe anemia, requiring regular red blood cell (RBC transfusions. Findings in untreated or poorly transfused individuals with thalassemia major, as seen in some developing countries, are growth retardation, pallor, jaundice, poor musculature, hepatosplenomegaly, leg ulcers, development of masses from extramedullary hematopoiesis, and skeletal changes that result from expansion of the bone marrow. Regular transfusion therapy leads to iron overload-related complications including endocrine complication (growth retardation, failure of sexual maturation, diabetes mellitus, and insufficiency of the parathyroid, thyroid, pituitary, and less commonly, adrenal glands, dilated myocardiopathy, liver fibrosis and cirrhosis. Patients with thalassemia intermedia present later in life with moderate anemia and do not require regular transfusions. Main clinical features in these patients are hypertrophy of erythroid marrow with medullary and extramedullary hematopoiesis and its complications (osteoporosis, masses of erythropoietic tissue that primarily affect the spleen, liver, lymph nodes, chest and spine, and bone deformities and typical facial changes, gallstones, painful leg ulcers and increased predisposition to thrombosis. Thalassemia minor is clinically asymptomatic but some subjects may have moderate anemia. Beta-thalassemias are caused by point mutations or, more rarely

  6. Beta decay for pedestrians

    CERN Document Server

    Lipkin, Harry Jeannot

    1962-01-01

    The ""pedestrian approach"" was developed to describe some essentially simple experimental results and their theoretical implications in plain language. In this graduate-level text, Harry J. Lipkin presents simply, but without oversimplification, the aspects of beta decay that can be understood without reference to the formal theory; that is, the reactions that follow directly from conservation laws and elementary quantum mechanics.The pedestrian treatment is neither a substitute for a complete treatment nor a watered-down version.

  7. THE FIRST STARS

    Directory of Open Access Journals (Sweden)

    Daniel J. Whalen

    2013-12-01

    Full Text Available Pop III stars are the key to the character of primeval galaxies, the first heavy elements, the onset of cosmological reionization, and the seeds of supermassive black holes. Unfortunately, in spite of their increasing sophistication, numerical models of Pop III star formation cannot yet predict the masses of the first stars. Because they also lie at the edge of the observable universe, individual Pop III stars will remain beyond the reach of observatories for decades to come, and so their properties are unknown. However, it will soon be possible to constrain their masses by direct detection of their supernovae, and by reconciling their nucleosynthetic yields to the chemical abundances measured in ancient metal-poor stars in the Galactic halo, some of which may bear the ashes of the first stars. Here, I review the state of the art in numerical simulations of primordial stars and attempts to directly and indirectly constrain their properties.

  8. The First Stars

    CERN Document Server

    Whalen, Daniel J

    2012-01-01

    Pop III stars are the key to the character of primeval galaxies, the first heavy elements, the onset of cosmological reionization, and the seeds of supermassive black holes. Unfortunately, in spite of their increasing sophistication, numerical models of Pop III star formation cannot yet predict the masses of the first stars. Because they lie at the edge of the observable universe, individual Pop III stars will also remain beyond the reach of telescopes for the foreseeable future, and so their properties remain unknown. However, it will soon be possible to constrain their masses by the direct detection of their supernovae and by reconciling their nucleosynthetic yields to the chemical abundances measured in ancient metal-poor stars in the Galactic halo, some of which may be bear the ashes of the first stars. Here, I review current problems on the simulation frontier in Pop III star formation and discuss the best prospects for constraining their properties observationally in the near term.

  9. Integration of BETA with Eclipse

    DEFF Research Database (Denmark)

    Andersen, Peter; Madsen, Ole Lehrmann; Enevoldsen, Mads Brøgger

    2004-01-01

    This paper presents language interoperability issues appearing in order to implement support for the BETA language in the Java-based Eclipse integrated development environment. One of the challenges is to implement plug-ins in BETA and be able to load them in Eclipse. In order to do this, some form...... of language interoperability between Java and BETA is required. The first approach is to use the Java Native Interface and use C to bridge between Java and BETA. This results in a workable, but complicated solution. The second approach is to let the BETA compiler generate Java class files. With this approach...... it is possible to implement plug-ins in BETA and even inherit from Java classes. In the paper the two approaches are described together with part of the mapping from BETA to Java class files. http://www.sciencedirect.com/science/journal/15710661...

  10. Regulation of beta cell replication

    DEFF Research Database (Denmark)

    Lee, Ying C; Nielsen, Jens Høiriis

    2008-01-01

    Beta cell mass, at any given time, is governed by cell differentiation, neogenesis, increased or decreased cell size (cell hypertrophy or atrophy), cell death (apoptosis), and beta cell proliferation. Nutrients, hormones and growth factors coupled with their signalling intermediates have been...... suggested to play a role in beta cell mass regulation. In addition, genetic mouse model studies have indicated that cyclins and cyclin-dependent kinases that determine cell cycle progression are involved in beta cell replication, and more recently, menin in association with cyclin-dependent kinase...... inhibitors has been demonstrated to be important in beta cell growth. In this review, we consider and highlight some aspects of cell cycle regulation in relation to beta cell replication. The role of cell cycle regulation in beta cell replication is mostly from studies in rodent models, but whether...

  11. Beta cell adaptation in pregnancy

    DEFF Research Database (Denmark)

    Nielsen, Jens Høiriis

    2016-01-01

    Pregnancy is associated with a compensatory increase in beta cell mass. It is well established that somatolactogenic hormones contribute to the expansion both indirectly by their insulin antagonistic effects and directly by their mitogenic effects on the beta cells via receptors for prolactin...... and growth hormone expressed in rodent beta cells. However, the beta cell expansion in human pregnancy seems to occur by neogenesis of beta cells from putative progenitor cells rather than by proliferation of existing beta cells. Claes Hellerström has pioneered the research on beta cell growth for decades......, but the mechanisms involved are still not clarified. In this review the information obtained in previous studies is recapitulated together with some of the current attempts to resolve the controversy in the field: identification of the putative progenitor cells, identification of the factors involved...

  12. Neutron Star Kicks and their Relationship to Supernovae Ejecta Mass

    CERN Document Server

    Bray, J C

    2016-01-01

    We propose a simple model to explain the velocity of young neutron stars. We attempt to confirm a relationship between the amount of mass ejected in the formation of the neutron star and the `kick' velocity imparted to the compact remnant resulting from the process. We assume the velocity is given by $v_{\\rm kick}=\\alpha\\,(M_{\\rm ejecta} / M_{\\rm remnant}) + \\beta\\,$. To test this simple relationship we use the BPASS (Binary Population and Spectral Synthesis) code to create stellar population models from both single and binary star evolutionary pathways. We then use our Remnant Ejecta and Progenitor Explosion Relationship (REAPER) code to apply different $\\alpha$ and $\\beta$ values and three different `kick' orientations then record the resulting velocity probability distributions. We find that while a single star population provides a poor fit to the observational data, the binary population provides an excellent fit. Values of $\\alpha=70\\, {\\rm km\\,s^{-1}}$ and $\\beta=110\\,{\\rm km\\,s^{-1}}$ reproduce the \\c...

  13. The Lorentz force in atmospheres of CP stars: $\\theta$ Aurigae

    CERN Document Server

    Shulyak, D; Kochukhov, O; Lee, B C; Galazutdinov, G; Kim, K M; Han, I; Burlakova, T; Tsymbal, V; Lyashko, D; Han, Inwoo

    2006-01-01

    Several dynamical processes may induce considerable electric currents in the atmospheres of magnetic chemically peculiar (CP) stars. The Lorentz force, which results from the interaction between the magnetic field and the induced currents, modifies the atmospheric structure and induces characteristic rotational variability of the hydrogen Balmer lines. To study this phenomena we have initiated a systematic spectroscopic survey of the Balmer lines variation in magnetic CP stars. In this paper we continue presentation of results of the program focusing on the high-resolution spectral observations of A0p star \\aur (HD 40312). We have detected a significant variability of the H$\\alpha$, H$\\beta$, and H$\\gamma$ spectral lines during full rotation cycle of the star. This variability is interpreted in the framework of the model atmosphere analysis, which accounts for the Lorentz force effects. Both the inward and outward directed Lorentz forces are considered under the assumption of the axisymmetric dipole or dipole...

  14. LHCb: $2\\beta_s$ measurement at LHCb

    CERN Multimedia

    Conti, G

    2009-01-01

    A measurement of $2\\beta_s$, the phase of the $B_s-\\bar{B_s}$ oscillation amplitude with respect to that of the ${\\rm b} \\rightarrow {\\rm c^{+}}{\\rm W^{-}}$ tree decay amplitude, is one of the key goals of the LHCb experiment with first data. In the Standard Model (SM), $2\\beta_s$ is predicted to be $0.0360^{+0.0020}_{-0.0016} \\rm rad$. The current constraints from the Tevatron are: $2\\beta_{s}\\in[0.32 ; 2.82]$ at 68$\\%$CL from the CDF experiment and $2\\beta_{s}=0.57^{+0.24}_{-0.30}$ from the D$\\oslash$ experiment. Although the statistical uncertainties are large, these results hint at the possible contribution of New Physics in the $B_s-\\bar{B_s}$ box diagram. After one year of data taking at LHCb at an average luminosity of $\\mathcal{L}\\sim2\\cdot10^{32}\\rm cm^{-2} \\rm s^{-1}$ (integrated luminosity $\\mathcal{L}_{\\rm int}\\sim 2 \\rm fb^{-1}$), the expected statistical uncertainty on the measurement is $\\sigma(2\\beta_s)\\simeq 0.03$. This uncertainty is similar to the $2\\beta_s$ value predicted by the SM.

  15. Induced Pairing Interaction in Neutron Star Matter

    Science.gov (United States)

    Lombardo, U.; Schulze, H.-J.; Zuo, W.

    2013-01-01

    The three superfluid phases supposed to occur in neutron stars are reviewed in the framework of the generalized BCS theory with the induced interaction. The structure of neutron stars characterized by beta-stable asymmetric nuclear matter in equilibrium with the gravitational force discloses new aspects of the pairing mechanism. Some of them are discussed in this report, in particular the formation in dense matter of Cooper pairs in the presence of three-body forces and the interplay between repulsive and attractive polarization effects on isospin T = 1 Cooper pairs embedded into the neutron and proton environment. Quantitative estimates of the energy gaps are reported and their sensitivity to the medium effects, i.e., interaction and polarization, is explored.

  16. Chemical spots and oscillatory diffusion modes in magnetic stars

    Science.gov (United States)

    Urpin, V.

    2016-07-01

    The stars of the middle main sequence often have spot-like chemical structures at their surfaces. We consider diffusion caused by electric currents and argue that such current-driven diffusion can form chemical inhomogeneities in a plasma. The considered mechanism can contribute to a formation of element spots in Hg-Mn and Ap-stars. Due to the Hall effect, diffusion in the presence of electric currents can be accompanied by the propagation of a particular type of magnetohydrodynamic modes in which only the impurity number density oscillates. Such modes exist if the magnetic pressure is much greater than the gas pressure and can be the reason for variations of the abundance peculiarities in stars.

  17. An AP4B1 frameshift mutation in siblings with intellectual disability and spastic tetraplegia further delineates the AP-4 deficiency syndrome.

    Science.gov (United States)

    Abdollahpour, Hengameh; Alawi, Malik; Kortüm, Fanny; Beckstette, Michael; Seemanova, Eva; Komárek, Vladimír; Rosenberger, Georg; Kutsche, Kerstin

    2015-02-01

    The recently proposed adaptor protein 4 (AP-4) deficiency syndrome comprises a group of congenital neurological disorders characterized by severe intellectual disability (ID), delayed or absent speech, hereditary spastic paraplegia, and growth retardation. AP-4 is a heterotetrameric protein complex with important functions in vesicle trafficking. Mutations in genes affecting different subunits of AP-4, including AP4B1, AP4E1, AP4S1, and AP4M1, have been reported in patients with the AP-4 deficiency phenotype. We describe two siblings from a non-consanguineous couple who presented with severe ID, absent speech, microcephaly, growth retardation, and progressive spastic tetraplegia. Whole-exome sequencing in the two patients identified the novel homozygous 2-bp deletion c.1160_1161delCA (p.(Thr387Argfs*30)) in AP4B1. Sanger sequencing confirmed the mutation in the siblings and revealed it in the heterozygous state in both parents. The AP4B1-associated phenotype has previously been assigned to spastic paraplegia-47. Identification of a novel AP4B1 alteration in two patients with clinical manifestations highly similar to other individuals with mutations affecting one of the four AP-4 subunits further supports the observation that loss of AP-4 assembly or functionality underlies the common clinical features in these patients and underscores the existence of the clinically recognizable AP-4 deficiency syndrome.

  18. DNA cleavage at the AP site via β-elimination mediated by the AP site-binding ligands.

    Science.gov (United States)

    Abe, Yukiko S; Sasaki, Shigeki

    2016-02-15

    DNA is continuously damaged by endogenous and exogenous factors such as oxidation and alkylation. In the base excision repair pathway, the damaged nucleobases are removed by DNA N-glycosylase to form the abasic sites (AP sites). The alkylating antitumor agent exhibits cytotoxicity through the formation of the AP site. Therefore blockage or modulation of the AP site repair pathway may enhance the antitumor efficacy of DNA alkylating agents. In this study, we have examined the effects of the nucleobase-polyamine conjugated ligands (G-, A-, C- and T-ligands) on the cleavage of the AP site. The G- and A-ligands cleaved DNA at the AP site by promoting β-elimination in a non-selective manner by the G-ligand, and in a selective manner for the opposing dT by the A-ligand. These results suggest that the nucleobase-polyamine conjugate ligands may have the potential for enhancement of the cytotoxicities of the AP site.

  19. Neutron stars and their magnetic fields

    CERN Document Server

    Reisenegger, Andreas

    2008-01-01

    Neutron stars have the strongest magnetic fields known anywhere in the Universe. In this review, I intend to give a pedagogical discussion of some of the related physics. Neutron stars exist because of Pauli's exclusion principle, in two senses: 1) It makes it difficult to squeeze particles too close together, in this way allowing a mechanical equilibrium state in the presence of extremely strong gravity. 2) The occupation of low-energy proton and electron states makes it impossible for low-energy neutrons to beta decay. A corollary of the second statement is that charged particles are necessarily present inside a neutron star, allowing currents to flow. Since these particles are degenerate, they collide very little, and therefore make it possible for the star to support strong, organized magnetic fields over long times. These show themselves in pulsars and are the most likely energy source for the high X-ray and gamma-ray luminosity ``magnetars''. I briefly discuss the possible origin of this field and some ...

  20. Small quark stars in the chromodielectric model

    CERN Document Server

    Malheiro, M; Nuss, L G; Fiolhais, M; Taurines, A R

    2001-01-01

    The Chromodielectric Model with a quartic potential is used to describe homogeneous strange quark matter, in beta equilibrium, at high densities. Two equations of state (EOS) are obtained for the same set of model parameters: one corresponds to a chiral restored phase with almost massless quarks and no electrons, and the other to a chiral broken phase. Depending on the model parameters, a phase transition between the two phases may occur. With those EOS the structure of compact stars is investigated and two types of stars are obtained: larger ones with radius $R\\sim 10 - 12$ km, a hadron mantle and a mass $M\\sim 1- 2 M_\\odot$, and smaller pure quark stars, in a chiral restored phase, with $R\\sim 5 - 8$ km, $M\\sim M_\\odot$ and a large baryon density at the edge. The phenomenology of the compact object RX J185635-3754, whose best fit for the radius and mass is $R\\sim 6$ km and $M\\sim 0.9 M_\\odot$, lies in the class of small quark stars predicted by the chromodielectric model.

  1. Metastable strange matter and compact quark stars

    CERN Document Server

    Malheiro, M; Taurines, A R

    2003-01-01

    Strange quark matter in beta equilibrium at high densities is studied in a quark confinement model. Two equations of state are dynamically generated for the {\\it same} set of model parameters used to describe the nucleon: one corresponds to a chiral restored phase with almost massless quarks and the other to a chiral broken phase. The chiral symmetric phase saturates at around five times the nuclear matter density. Using the equation of state for this phase, compact bare quark stars are obtained with radii and masses in the ranges $R\\sim 5 - 8$ km and $M\\sim M_\\odot$. The energy per baryon number decreases very slowly from the center of the star to the periphery, remaining above the corresponding values for the iron or the nuclear matter, even at the edge. Our results point out that strange quark matter at very high densities may not be absolutely stable and the existence of an energy barrier between the two phases may prevent the compact quarks stars to decay to hybrid stars.

  2. Metal-Poor Stars

    CERN Document Server

    Frebel, Anna

    2008-01-01

    The abundance patterns of metal-poor stars provide us a wealth of chemical information about various stages of the chemical evolution of the Galaxy. In particular, these stars allow us to study the formation and evolution of the elements and the involved nucleosynthesis processes. This knowledge is invaluable for our understanding of the cosmic chemical evolution and the onset of star- and galaxy formation. Metal-poor stars are the local equivalent of the high-redshift Universe, and offer crucial observational constraints on the nature of the first stars. This review presents the history of the first discoveries of metal-poor stars that laid the foundation to this field. Observed abundance trends at the lowest metallicities are described, as well as particular classes of metal-poor stars such as r-process and C-rich stars. Scenarios on the origins of the abundances of metal-poor stars and the application of large samples of metal-poor stars to cosmological questions are discussed.

  3. The Second Stars

    CERN Document Server

    Herwig, Falk

    2005-01-01

    The ejecta of the first probably very massive stars polluted the Big Bang primordial element mix with the first heavier elements. The resulting ultra metal-poor abundance distribution provided the initial conditions for the second stars of a wide range of initial masses reaching down to intermediate and low masses. The importance of these second stars for understanding the origin of the elements in the early universe are manifold. While the massive first stars have long vanished the second stars are still around and currently observed. They are the carriers of the information about the first stars, but they are also capable of nuclear production themselves. For example, in order to use ultra or extremely metal-poor stars as a probe for the r-process in the early universe a reliable model of the s-process in the second stars is needed. Eventually, the second stars may provide us with important clues on questions ranging from structure formation to how the stars actually make the elements, not only in the early...

  4. Dark stars: a review.

    Science.gov (United States)

    Freese, Katherine; Rindler-Daller, Tanja; Spolyar, Douglas; Valluri, Monica

    2016-06-01

    Dark stars are stellar objects made (almost entirely) of hydrogen and helium, but powered by the heat from dark matter annihilation, rather than by fusion. They are in hydrostatic and thermal equilibrium, but with an unusual power source. Weakly interacting massive particles (WIMPs), among the best candidates for dark matter, can be their own antimatter and can annihilate inside the star, thereby providing a heat source. Although dark matter constitutes only [Formula: see text]0.1% of the stellar mass, this amount is sufficient to power the star for millions to billions of years. Thus, the first phase of stellar evolution in the history of the Universe may have been dark stars. We review how dark stars come into existence, how they grow as long as dark matter fuel persists, and their stellar structure and evolution. The studies were done in two different ways, first assuming polytropic interiors and more recently using the MESA stellar evolution code; the basic results are the same. Dark stars are giant, puffy (∼10 AU) and cool (surface temperatures  ∼10 000 K) objects. We follow the evolution of dark stars from their inception at  ∼[Formula: see text] as they accrete mass from their surroundings to become supermassive stars, some even reaching masses  >[Formula: see text] and luminosities  >[Formula: see text], making them detectable with the upcoming James Webb Space Telescope. Once the dark matter runs out and the dark star dies, it may collapse to a black hole; thus dark stars may provide seeds for the supermassive black holes observed throughout the Universe and at early times. Other sites for dark star formation may exist in the Universe today in regions of high dark matter density such as the centers of galaxies. The current review briefly discusses dark stars existing today, but focuses on the early generation of dark stars. PMID:27214049

  5. Dark stars: a review.

    Science.gov (United States)

    Freese, Katherine; Rindler-Daller, Tanja; Spolyar, Douglas; Valluri, Monica

    2016-06-01

    Dark stars are stellar objects made (almost entirely) of hydrogen and helium, but powered by the heat from dark matter annihilation, rather than by fusion. They are in hydrostatic and thermal equilibrium, but with an unusual power source. Weakly interacting massive particles (WIMPs), among the best candidates for dark matter, can be their own antimatter and can annihilate inside the star, thereby providing a heat source. Although dark matter constitutes only [Formula: see text]0.1% of the stellar mass, this amount is sufficient to power the star for millions to billions of years. Thus, the first phase of stellar evolution in the history of the Universe may have been dark stars. We review how dark stars come into existence, how they grow as long as dark matter fuel persists, and their stellar structure and evolution. The studies were done in two different ways, first assuming polytropic interiors and more recently using the MESA stellar evolution code; the basic results are the same. Dark stars are giant, puffy (∼10 AU) and cool (surface temperatures  ∼10 000 K) objects. We follow the evolution of dark stars from their inception at  ∼[Formula: see text] as they accrete mass from their surroundings to become supermassive stars, some even reaching masses  >[Formula: see text] and luminosities  >[Formula: see text], making them detectable with the upcoming James Webb Space Telescope. Once the dark matter runs out and the dark star dies, it may collapse to a black hole; thus dark stars may provide seeds for the supermassive black holes observed throughout the Universe and at early times. Other sites for dark star formation may exist in the Universe today in regions of high dark matter density such as the centers of galaxies. The current review briefly discusses dark stars existing today, but focuses on the early generation of dark stars.

  6. Dark stars: a review

    Science.gov (United States)

    Freese, Katherine; Rindler-Daller, Tanja; Spolyar, Douglas; Valluri, Monica

    2016-06-01

    Dark stars are stellar objects made (almost entirely) of hydrogen and helium, but powered by the heat from dark matter annihilation, rather than by fusion. They are in hydrostatic and thermal equilibrium, but with an unusual power source. Weakly interacting massive particles (WIMPs), among the best candidates for dark matter, can be their own antimatter and can annihilate inside the star, thereby providing a heat source. Although dark matter constitutes only ≲ 0.1% of the stellar mass, this amount is sufficient to power the star for millions to billions of years. Thus, the first phase of stellar evolution in the history of the Universe may have been dark stars. We review how dark stars come into existence, how they grow as long as dark matter fuel persists, and their stellar structure and evolution. The studies were done in two different ways, first assuming polytropic interiors and more recently using the MESA stellar evolution code; the basic results are the same. Dark stars are giant, puffy (˜10 AU) and cool (surface temperatures  ˜10 000 K) objects. We follow the evolution of dark stars from their inception at  ˜1{{M}⊙} as they accrete mass from their surroundings to become supermassive stars, some even reaching masses  >{{10}6}{{M}⊙} and luminosities  >{{10}10}{{L}⊙} , making them detectable with the upcoming James Webb Space Telescope. Once the dark matter runs out and the dark star dies, it may collapse to a black hole; thus dark stars may provide seeds for the supermassive black holes observed throughout the Universe and at early times. Other sites for dark star formation may exist in the Universe today in regions of high dark matter density such as the centers of galaxies. The current review briefly discusses dark stars existing today, but focuses on the early generation of dark stars.

  7. AP@home: The Artificial Pancreas Is Now at Home.

    Science.gov (United States)

    Heinemann, Lutz; Benesch, Carsten; DeVries, J Hans

    2016-07-01

    In the past years the development of an artificial pancreas (AP) has made great progress and many activities are ongoing in this area of research. The major step forward made in the last years was moving the evaluation of AP systems from highly controlled experimental conditions to daily life conditions at the home of patients with diabetes; this was also the aim of the European Union-funded AP@home project. Over a time period of 5 years a series of clinical studies were performed that culminated in 2 "final studies" during which an AP system was used by patients in their home environment for 2 or 3 months without supervision by a physician, living their normal lives. Two different versions of the AP system developed within this project were evaluated. A significant improvement in glycated hemoglobin was observed during closed-loop conditions despite the fact that during the control period the patients used the best currently available therapeutic option. In addition, a "single-port AP system" was developed within the project that combines continuous glucose monitoring and insulin infusion at a single tissue site. By using such a combined device the patients not only have to carry one less device around, the number of access points through the skin is also reduced from 2 to 1. In summary, close cooperation of 12 European partners, both academic centers and industry, enabled the development and evaluation of AP systems under daily life conditions. The next step is to develop these into products in cooperation with commercial partners. PMID:26888971

  8. An alternatively spliced mRNA from the AP-2 gene encodes a negative regulator of transcriptional activation by AP-2.

    OpenAIRE

    Buettner, R; Kannan, P; Imhof, A.; Bauer, R.; Yim, S O; Glockshuber, R; Van Dyke, M W; Tainsky, M A

    1993-01-01

    AP-2 is a retinoic acid-inducible and developmentally regulated activator of transcription. We have cloned an alternative AP-2 transcript (AP-2B) from the human teratocarcinoma cell line PA-1, which encodes a protein differing in the C terminus from the previously isolated AP-2 protein (AP-2A). This protein contains the activation domain of AP-2 and part of the DNA binding domain but lacks the dimerization domain which is necessary for DNA binding. Analysis of overlapping genomic clones spann...

  9. Project Runaway: Calibrating the Spectroscopic Distance Scale Using Runaway O and Wolf-Rayet Stars

    Science.gov (United States)

    Hartkopf, William I.; Mason, B. D.

    2009-05-01

    Well-determined O star masses are notoriously difficult to obtain, due to such factors as broad spectral lines, larger and less-reliable average distances, high multiplicity rates, crowded fields, and surrounding nebulosity. Some of these difficulties are reduced for the subset of O stars known as runaways, however. They have escaped some of the nebulosity and crowding, and the event leading to their ejection virtually guarantees that these objects are either single stars or extremely hard spectroscopic binaries. The goal of this project is to increase the sample of known runaway stars, using updated proper motions from the soon-to-be-released UCAC3 catalog, as well as published radial velocities and data from recent duplicity surveys of massive stars using AO and speckle interferometry. Input files include the Galactic O Star Catalog of Maiz-Apellaniz et al. (2004 ApJSS 151, 103) as well as the Seventh Catalogue of Galactic Wolf-Rayet Stars and its more recent Annex (van der Hucht 2001 NewAR 45, 135; 2006 A&A 458, 453). The new runaway star sample will form the basis for a list of SIM targets aimed at improving the distances of Galactic O and WR stars, calibrating the spectroscopic distance scale and leading to more accurate mass estimates for these massive stars.

  10. RELATIVISTIC SUPERNOVAE HAVE SHORTER-LIVED CENTRAL ENGINES OR MORE EXTENDED PROGENITORS: THE CASE OF SN 2012ap

    International Nuclear Information System (INIS)

    Deep, late-time X-ray observations of the relativistic, engine-driven, type Ic SN 2012ap allow us to probe the nearby environment of the explosion and reveal the unique properties of relativistic supernova explosions (SNe). We find that on a local scale of ∼0.01 pc the environment was shaped directly by the evolution of the progenitor star with a pre-explosion mass-loss rate of M-dot <5×10−6 M⊙ yr−1, in line with gamma-ray bursts (GRBs) and the other relativistic SN 2009bb. Like sub-energetic GRBs, SN 2012ap is characterized by a bright radio emission and evidence for mildly relativistic ejecta. However, its late-time (δt ≈ 20 days) X-ray emission is ∼100 times fainter than the faintest sub-energetic GRB at the same epoch, with no evidence for late-time central engine activity. These results support theoretical proposals that link relativistic SNe like 2009bb and 2012ap with the weakest observed engine-driven explosions, where the jet barely fails to break out. Furthermore, our observations demonstrate that the difference between relativistic SNe and sub-energetic GRBs is intrinsic and not due to line-of-sight effects. This phenomenology can either be due to an intrinsically shorter-lived engine or to a more extended progenitor in relativistic SNe

  11. 3D-HST Emission Line Galaxies at z ~ 2: Discrepancies in the Optical/UV Star Formation Rates

    OpenAIRE

    Zeimann, Gregory R.; Ciardullo, Robin; Gebhardt, Henry; Gronwall, Caryl; Schneider, Donald P.; Hagen, Alex; Bridge, Joanna S.; Feldmeier, John; Trump, Jonathan R.

    2014-01-01

    We use Hubble Space Telescope near-IR grism spectroscopy to examine the H-beta line strengths of 260 star-forming galaxies in the redshift range 1.90 < z < 2.35. We show that at these epochs, the H-beta star formation rate (SFR) is a factor of ~1.8 higher than what would be expected from the systems' rest-frame UV flux density, suggesting a shift in the standard conversion between these quantities and star formation rate. We demonstrate that at least part of this shift can be attributed to me...

  12. STAR in CTO PCI: When is STAR not a star?

    Science.gov (United States)

    Hira, Ravi S; Dean, Larry S

    2016-04-01

    Subintimal tracking and reentry (STAR) has been used as a bailout strategy and involves an uncontrolled dissection and recanalization into the distal lumen to reestablish vessel patency. In the current study, thrombolysis in myocardial infarction (TIMI) flow < 3 was the only variable which they found to be significantly associated with restenosis and reocclusion after stent placement. It may be reasonable to consider second generation drug eluting stent placement in patients receiving STAR that have TIMI 3 flow, however, this should only be done if there is no compromise of major side branches. If unsure, we recommend to perform balloon angioplasty without stenting.

  13. AP1000 - the new standard for nuclear power

    International Nuclear Information System (INIS)

    Full text of publication follows: The AP1000 is the only Generation III+ reactor to receive Final Design Approval (FDA) from the Nuclear Regulatory Commission, and is expected to receive its Design Certification by the end of the year. Building on the proven features of current generation nuclear plants, the AP1000 combines experience with innovation into a design that surpasses current standards of safety and reliability. Use of passive safety features results in a simpler and more compact design that enhances safety, simplifies O and M requirements, and reduces capital and operating costs. At 1117 Mwe, the AP1000 is well suited for almost any grid system and will be fully competitive with combined-cycle gas and comparable fossil fuel plants. The AP1000 is ready to help launch a renaissance in new nuclear plant construction throughout the world. Maturity of Design: In excess of 1300 man-years and $400 million in development funding have been expended on the AP1000. It has undergone extensive, part scale testing at the system, sub-system and component level, in addition to a series of part scale integrated tests. The AP1000 is the most analyzed of the next generation reactors. Simplicity of Design/Economics: The AP1000 uses simplified and innovative passive safety systems to an unprecedented extent. Simplified passive safety systems provide reliable operation, reduced capital costs, and enhanced plant safety with large plant operating margins. The AP1000 features improved reliability through simplicity rather than addition of redundant safety trains. This simpler design is easier and less costly to operate and maintain than larger, more complex plants, while less equipment and smaller buildings translate into lower capital costs and shorter construction durations. After construction, economic benefit will be found in reduced operating and maintenance costs, largely due to reduced operating and maintenance staffing requirements. Construction aspects

  14. Making Stars … With a Little Help

    Science.gov (United States)

    Kohler, Susanna

    2015-11-01

    in all cases, the presence of external pressure causes the star formation rates to be significantly higher than in the cases with no feedback. For galaxies that contain a high gas fraction, this difference is especially pronounced at early times; the external pressure causes gas to fragment into clumps that are dense enough to form stars much sooner than in the absence of pressure.Bieri and collaborators also track the mass entering and leaving the galactic disk during the simulation. When external pressure is present, it drives a large net mass inflow at the beginning of the simulation, carrying in material from the halo and outer disk. This early source of mass helps to feed cloud and clump growth in the inner parts of the galaxy contributing to the increased star formation rate in the pressurized cases.Thus, this simple model has demonstrated that enhanced pressure due to AGN feedback is an effective means of explaining the large star formation rates we observe in high-redshift galaxies.CitationRebekka Bieri et al 2015 ApJ 812 L36. doi:10.1088/2041-8205/812/2/L36

  15. The First Stars

    Science.gov (United States)

    Yoshida, Naoki

    2010-10-01

    The standard cosmological model predicts that the first cosmological objects are formed when the age of the universe is a few hundred million years. Recent theoretical studies and numerical simulations consistently suggest that the first objects are very massive primordial stars. We introduce the key physics and explain why the first stars are thought to be massive, rather than to be low-mass stars. The state-of-the-art simulations include all the relevant atomic and molecular physics to follow the thermal evolution of a prestellar gas cloud to very high ``stellar'' densities. Evolutionary calculations of the primordial stars suggest the formation of massive blackholes in the early universe. Finally, we show the results from high-resolution simulations of star formation in a low-metallicity gas. Vigorous fragmentation is triggered in a star-forming gas cloud at a metallicity of as low as Z = 10-5Zsolar.

  16. Learning through delivery, Westinghouse AP1000 plant construction

    International Nuclear Information System (INIS)

    The AP1000 plant, which is a 1100 MWe class pressurized water reactor with passive safety features, is designed around a conventional 2 loop, 2 steam generator primary system configuration with 2 hot legs, 4 reactor coolant pumps directly mounted in the steam generator lower head and 4 cold legs. A particular feature of AP1000 is its modular construction to minimize the time and cost of construction. Modular construction allows activities to be run in parallel, it allows more activities to be performed in a controlled factory instead of in the field, and it provides a better level of quality. The AP1000 plant design includes 106 structural modules and 52 mechanical modules. Structural modules include all penetrations for piping, cable trays, HVAC duct runs, and all reinforcement for pipe, equipment hangers, and supports. Structural modules are shipped in sub-modules to support transportation by rail or truck or barge. Mechanical modules contain equipment such as pumps, tanks, heat exchangers, air-handling units, and filters along with interconnecting pipes, valves, instruments, wiring and support services. Modular construction requires strong coordination between engineering, supply chain and construction. A total of 8 AP1000 units are currently under construction in China and in the United States. The lessons learned and best practices of each new AP1000 construction are systematically incorporated into the standard design. (A.C.)

  17. Xeroradiography in. beta. -thalassaemia

    Energy Technology Data Exchange (ETDEWEB)

    Scutellari, P.N.; Orzincolo, C.; Tamarozzi, R.

    1985-01-01

    Xeroradiographic investigations of the skull, hand, and elbow were performed on 27 patients with homozygous ..beta..-thalassaemia. The results were compared with plain radiographic examinations. Xeroradiography, because of its technical properties (i.e. edge contrast enhancement and wide latitude), was shown to demonstrate cortical thinning of long bones, swelling of the diploic space in the skull, and reticulated patterns in the elbow better than standard radiography. Moreover, the use of 'positive' mode imaging was shown to have advantages in the study of the skull and extremities.

  18. Role of nucleonic Fermi surface depletion in neutron star cooling

    CERN Document Server

    Dong, J M; Zhang, H F; Zuo, W

    2015-01-01

    The Fermi surface depletion of beta-stable nuclear matter is calculated to study its effects on several physical properties which determine the neutron star thermal evolution. The neutron and proton Z factors measuring the corresponding Fermi surface depletions, are calculated within the Brueckner-Hartree-Fock approach employing the AV18 two-body force supplemented by a microscopic three body force. Neutrino emissivity, heat capacity and, in particular, neutron 3PF2 superfluidity turn out to be reduced, especially at high baryonic density, to such an extent that the cooling rates of young neutron stars are significantly slowed

  19. Physical and orbital properties of Beta Pictoris b

    CERN Document Server

    Bonnefoy, M; Galicher, R; Beust, H; Lagrange, A -M; Baudino, J -L; Chauvin, G; Borgniet, S; Meunier, N; Rameau, J; Boccaletti, A; Cumming, A; Helling, C; Homeier, D; Allard, F; Delorme, P

    2014-01-01

    The intermediate-mass star Beta Pictoris is known to be surrounded by a structured edge-on debris disk within which a gas giant planet was discovered orbiting at 8-10 AU. The physical properties of Beta Pic b were previously inferred from broad and narrow-band 0.9-4.8 microns photometry. We used commissioning data of the Gemini Planet Imager (GPI) to obtain new astrometry and a low-resolution (R=35-39) J-band (1.12-1.35 microns) spectrum of the planet. We find that the planet has passed the quadrature. We constrain its semi-major axis to $\\leq$ 10 AU (90 % prob.) with a peak at 8.9+0.4-0.6 AU. The joint fit of the planet astrometry and the most recent radial velocity measurements of the star yields a planet's dynamical mass $\\leq$ 20 MJup (greater than 96 % prob.). The extracted spectrum of Beta Pic b is similar to those of young L1-1.5+1 dwarfs. We use the spectral type estimate to revise the planet luminosity to log(L/Lsun)=-3.90+-0.07. The 0.9-4.8 microns photometry and spectrum are reproduced for Teff=165...

  20. Intelligent Star Tracker

    OpenAIRE

    Clark, Natalie; Furth, Paul; Horan, Steven

    2000-01-01

    We describe our Intelligent Star Tracker System. Our Intelligent Star Tracker System incorporates an adaptive optic catadioptric telescope in a silicon carbide housing. Leveraging off of our active optic technologies, the novel active pixel position sensors (APPS) enable wide dynamic range and allows simultaneous imagery of faint and bright stars in a single image. Moreover, the APPS, in conjunction with the adaptive optics technologies, offer unprecedented accuracy in altitude and navigation...

  1. Evolution of massive stars

    International Nuclear Information System (INIS)

    The evolution of stars with masses larger than 15 sun masses is reviewed. These stars have large convective cores and lose a substantial fraction of their matter by stellar wind. The treatment of convection and the parameterisation of the stellar wind mass loss are analysed within the context of existing disagreements between theory and observation. The evolution of massive close binaries and the origin of Wolf-Rayet Stars and X-ray binaries is also sketched. (author)

  2. 3D-HST Emission Line Galaxies at z ~ 2: Discrepancies in the Optical/UV Star Formation Rates

    CERN Document Server

    Zeimann, Gregory R; Gebhardt, Henry; Gronwall, Caryl; Schneider, Donald P; Hagen, Alex; Bridge, Joanna S; Feldmeier, John; Trump, Jonathan R

    2014-01-01

    We use Hubble Space Telescope near-IR grism spectroscopy to examine the H-beta line strengths of 260 star-forming galaxies in the redshift range 1.90 < z < 2.35. We show that at these epochs, the H-beta star formation rate (SFR) is a factor of ~1.8 higher than what would be expected from the systems' rest-frame UV flux density, suggesting a shift in the standard conversion between these quantities and star formation rate. We demonstrate that at least part of this shift can be attributed to metallicity, as H-beta is more greatly enhanced in systems with lower oxygen abundance. This offset must be considered when measuring the star formation rate history of the universe. We also show that the relation between stellar and nebular extinction in our z ~ 2 sample is consistent with that observed in the local universe.

  3. Interacting binary stars

    CERN Document Server

    Sahade, Jorge; Ter Haar, D

    1978-01-01

    Interacting Binary Stars deals with the development, ideas, and problems in the study of interacting binary stars. The book consolidates the information that is scattered over many publications and papers and gives an account of important discoveries with relevant historical background. Chapters are devoted to the presentation and discussion of the different facets of the field, such as historical account of the development in the field of study of binary stars; the Roche equipotential surfaces; methods and techniques in space astronomy; and enumeration of binary star systems that are studied

  4. Covering tree with stars

    DEFF Research Database (Denmark)

    Baumbach, Jan; Guo, Jiong; Ibragimov, Rashid

    2015-01-01

    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting...... tree is isomorphic to T? We prove that in the general setting, CST is NP-complete, which implies that the tree edit distance considered here is also NP-hard, even when both input trees having diameters bounded by 10. We also show that, when the number of distinct stars is bounded by a constant k, CTS...

  5. Covering tree with stars

    DEFF Research Database (Denmark)

    Baumbach, Jan; Guo, Jian-Ying; Ibragimov, Rashid

    2013-01-01

    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting...... tree is isomorphic to T? We prove that in the general setting, CST is NP-complete, which implies that the tree edit distance considered here is also NP-hard, even when both input trees having diameters bounded by 10. We also show that, when the number of distinct stars is bounded by a constant k, CTS...

  6. ENERGY STAR Unit Reports

    Data.gov (United States)

    Department of Housing and Urban Development — These quarterly Federal Fiscal Year performance reports track the ENERGY STAR qualified HOME units that Participating Jurisdictions record in HUD's Integrated...

  7. Past, Present, and Future of AP Chemistry: A Brief History of Course and Exam Alignment Efforts

    Science.gov (United States)

    Magrogan, Serena

    2014-01-01

    As part of the Advanced Placement (AP) Program's commitment to continually enhance alignment with current best practices in college-level learning, the AP Program is currently evaluating and redesigning courses and exams, one of which launched during the 2013-2014 academic school year: AP chemistry. The history of the AP chemistry course and…

  8. AP Report to the Nation: A Closer Look at the Nation and Florida

    Science.gov (United States)

    Sawtell, Ellen A.; Gillie, Jacqueline M.; Smith, Patricia Z.

    2012-01-01

    In February 2012, the College Board published The 8th Annual AP Report to the Nation. This session provides a deeper dive into key information for the United States with an emphasis on Florida, and participants hear how one school in Florida utilizes AP Potential™ to help build their AP Program. Participants also learn about AP participation and…

  9. Combinations of 148 navigation stars and the star tracker

    Science.gov (United States)

    Duncan, R.

    1980-01-01

    The angular separation of all star combinations for 148 nav star on the onboard software for space transportation system-3 flight and following missions is presented as well as the separation of each pair that satisfies the viewing constraints of using both star trackers simultaneously. Tables show (1) shuttle star catalog 1980 star position in M 1950 coordinates; (2) two star combination of 148 nav stars; and (3) summary of two star-combinations of the star tracker 5 deg filter. These 148 stars present 10,875 combinations. For the star tracker filters of plus or minus 5 deg, there are 875 combinations. Formalhaut (nav star 26) has the best number of combinations, which is 33.

  10. Horizontal Branch stars as AmFm/HgMn stars

    CERN Document Server

    Michaud, G

    2008-01-01

    Recent observations and models for horizontal branch stars are briefly described and compared to models for AmFm stars. The limitations of those models are emphasized by a comparison to observations and models for HgMn stars.

  11. Double beta decay: present status

    OpenAIRE

    Barabash, A. S.

    2008-01-01

    The present status of double beta decay experiments (including the search for $2\\beta^{+}$, EC$\\beta^{+}$ and ECEC processes) are reviewed. The results of the most sensitive experiments are discussed. Average and recommended half-life values for two-neutrino double beta decay are presented. Conservative upper limits on effective Majorana neutrino mass and the coupling constant of the Majoron to the neutrino are established as $ < 0.75$ eV and $ < 1.9 \\cdot 10^{-4}$, respectively. Proposals fo...

  12. Simultaneous beta and gamma spectroscopy

    Science.gov (United States)

    Farsoni, Abdollah T.; Hamby, David M.

    2010-03-23

    A phoswich radiation detector for simultaneous spectroscopy of beta rays and gamma rays includes three scintillators with different decay time characteristics. Two of the three scintillators are used for beta detection and the third scintillator is used for gamma detection. A pulse induced by an interaction of radiation with the detector is digitally analyzed to classify the type of event as beta, gamma, or unknown. A pulse is classified as a beta event if the pulse originated from just the first scintillator alone or from just the first and the second scintillator. A pulse from just the third scintillator is recorded as gamma event. Other pulses are rejected as unknown events.

  13. New Photometrically Variable Magnetic Chemically Peculiar Stars in the ASAS-3 Archive

    Science.gov (United States)

    Hümmerich, Stefan; Paunzen, Ernst; Bernhard, Klaus

    2016-10-01

    The magnetic Ap or CP2 stars are natural atomic and magnetic laboratories. Strictly periodic changes are observed in the spectra and brightness of these stars, which allow the derivation of rotational periods. Related to this group of objects are the He-weak (CP4) and He-rich stars, some of which also undergo brightness changes due to rotational modulation. Increasing the sample size of known rotational periods among CP2/4 stars is important and will contribute to our understanding of these objects and their evolution in time. We have compiled an extensive target list of CP2/4 stars from the General Catalog of Ap, HgMn, and Am stars, including several early-type (spectral types B/A) variables of undetermined type from the International Variable Star Index. We investigated our sample stars using publicly available observations from the ASAS-3 archive. Our previous efforts in this respect led to the discovery of 323 variable stars. Using a refined analysis approach, we were able to identify another 360 stars exhibiting photometric variability in ASAS-3 data. Summary data, folded light curves and, if available, information from the literature are presented for our final sample, which is composed of 334 bona-fide {α }2 Canum Venaticorum (ACV) variables, 23 ACV candidates, and 3 eclipsing binary systems. Interesting and unusual objects are discussed in detail. In particular, we call attention to HD 66051 (V414 Pup), which is an eclipsing binary system showing obvious rotational modulation of the light curve due to the presence of an ACV variable in the system.

  14. Scintillator based beta batteries

    Science.gov (United States)

    Rensing, Noa M.; Tiernan, Timothy C.; Shirwadkar, Urmila; O'Dougherty, Patrick; Freed, Sara; Hawrami, Rastgo; Squillante, Michael R.

    2013-05-01

    Some long-term, remote applications do not have access to conventional harvestable energy in the form of solar radiation (or other ambient light), wind, environmental vibration, or wave motion. Radiation Monitoring Devices, Inc. (RMD) is carrying out research to address the most challenging applications that need power for many months or years and which have undependable or no access to environmental energy. Radioisotopes are an attractive candidate for this energy source, as they can offer a very high energy density combined with a long lifetime. Both large scale nuclear power plants and radiothermal generators are based on converting nuclear energy to heat, but do not scale well to small sizes. Furthermore, thermo-mechanical power plants depend on moving parts, and RTG's suffer from low efficiency. To address the need for compact nuclear power devices, RMD is developing a novel beta battery, in which the beta emissions from a radioisotope are converted to visible light in a scintillator and then the visible light is converted to electrical power in a photodiode. By incorporating 90Sr into the scintillator SrI2 and coupling the material to a wavelength-matched solar cell, we will create a scalable, compact power source capable of supplying milliwatts to several watts of power over a period of up to 30 years. We will present the latest results of radiation damage studies and materials processing development efforts, and discuss how these factors interact to set the operating life and energy density of the device.

  15. Vibration analysis of primary air pump JE01 AP003

    International Nuclear Information System (INIS)

    JE01 AP003 primary coolant pump is one of the main components in the safe operation of the reactor so that needs to be done early detection of damage types and levels of its constituent components. The main components of the pump that is often damaged bearing. The purpose of this paper is to know the symptoms of bearing damage and the level of damage based on vibration analysis. One indication of the bearing has been damaged, that is the vibration or temperature rise in the bearing. One way to detect early symptoms of damage to the pump is to use the vibration response peak Based on the analysis of the measurement results cited the obtained results that the primary coolant pump JE01 AP003 has been damage to a free end looseness bearing with moderate levels of damage. Need JE01 AP003 bearing replacement even though the damage is not severe. (author)

  16. Experience with the EPICS PV Gateway at the APS

    CERN Document Server

    Evans, Kenneth

    2005-01-01

    The EPICS PV Gateway has become a stable, high-performance application that provides access to process variables while minimizing the impact on critical IOCs and implementing additional access security. The additional access security typically prevents write access but is highly configurable. The Advanced Photon Source (APS) currently uses 40 Gateways running on 11 machines to provide access to the machine network from the offices and for the individual experimental teams. These include reverse Gateways that allow administration of all 40 APS Gateways from a single MEDM screen, even though the Gateways are running on separate networks. This administration includes starting, stopping, making and viewing reports, and viewing and editing access security files. There is one Gateway that provides process variable renaming. This paper provides an overview of the Gateways at the APS and describes the procedures that have been set up to use and administer them.

  17. Star Position Estimation Improvements for Accurate Star Tracker Attitude Estimation

    OpenAIRE

    Delabie, Tjorven

    2015-01-01

    This paper presents several methods to improve the estimation of the star positions in a star tracker, using a Kalman Filter. The accuracy with which the star positions can be estimated greatly influences the accuracy of the star tracker attitude estimate. In this paper, a Kalman Filter with low computational complexity, that can be used to estimate the star positions based on star tracker centroiding data and gyroscope data is discussed. The performance of this Kalman Filter can be increased...

  18. PKA-activated ApAF–ApC/EBP heterodimer is a key downstream effector of ApCREB and is necessary and sufficient for the consolidation of long-term facilitation

    OpenAIRE

    LEE, Jin-A; Lee, Sue-Hyun; Lee, Changhoon; Chang, Deok-Jin; Lee, Yong; Kim, Hyoung; Cheang, Ye-Hwang; Ko, Hyoung-Gon; Lee, Yong-Seok; Jun, Heejung; Bartsch, Dusan; Kandel, Eric R.; Kaang, Bong-Kiun

    2006-01-01

    Long-term memory requires transcriptional regulation by a combination of positive and negative transcription factors. Aplysia activating factor (ApAF) is known to be a positive transcription factor that forms heterodimers with ApC/EBP and ApCREB2. How these heterodimers are regulated and how they participate in the consolidation of long-term facilitation (LTF) has not, however, been characterized. We found that the functional activation of ApAF required phosphorylation of ApAF by PKA on Ser-2...

  19. Beta section Beta: biogeographical patterns of variation and taxonomy.

    NARCIS (Netherlands)

    Letschert, J.P.W.

    1993-01-01

    In Chapter 1 an account is given of the historical subdivision of the genus Beta and its sections, and the relations of the sections are discussed. Emphasis is given to the taxonomic treatment of wild section Beta by various authors. The Linnaean names B. vulgaris L. and B. maritima L. are lectotypi

  20. Transcriptional Regulation of the AP-2α Promoter by BTEB-1 and AP-2rep, a Novel wt-1/egr-Related Zinc Finger Repressor

    OpenAIRE

    Imhof, Axel; Schuierer, Marion; Werner, Oliver; Moser, Markus; Roth, Christina; Bauer, Reinhard; BUETTNER, REINHARD

    1999-01-01

    AP-2 transcription factors have been suggested to exert key regulatory functions in vertebrate embryonic development, in tumorigenicity of various cancer cell types, and in controlling cell cycle and apoptotic effector genes. In this study, we investigated transcriptional regulation of the AP-2α gene promoter mediated by an autoregulatory element (referred to as A32) with a core consensus AP-2 binding site at position −336 relative to the mRNA initiation site. AP-2 and multiple different nucl...

  1. Properties of the H-alpha-emitting Circumstellar Regions of Be Stars

    CERN Document Server

    Tycner, C; Hajian, A R; Armstrong, J T; Benson, J A; Gilbreath, G C; Hutter, D J; Pauls, T A; White, N M; Tycner, Christopher; Lester, John B.; Hajian, Arsen R.

    2005-01-01

    Long-baseline interferometric observations obtained with the Navy Prototype Optical Interferometer of the H-alpha-emitting envelopes of the Be stars eta Tauri and beta Canis Minoris are presented. For compatibility with the previously published interferometric results in the literature of other Be stars, circularly symmetric and elliptical Gaussian models were fitted to the calibrated H-alpha observations. The models are sufficient in characterizing the angular distribution of the H-alpha-emitting circumstellar material associated with these Be stars. To study the correlations between the various model parameters and the stellar properties, the model parameters for eta Tau and beta CMi were combined with data for other Be stars from the literature. After accounting for the different distances to the sources and stellar continuum flux levels, it was possible to study the relationship between the net H-alpha emission and the physical extent of the H-alpha-emitting circumstellar region. A clear dependence of the...

  2. SN 2002ap, the hypernova of class Ic

    OpenAIRE

    Pandey, S. B.; Sahu, D. K.; Anupama, G. C.; Bhattacharya, D; Sagar, Ram

    2003-01-01

    The supernova SN 2002ap was discovered in the outer regions of the nearby spiral M74 on January 29.4 UT. Early photometric and spectroscopic observations indicate the supernova belongs to the class of Ic hypernova. Late time (After JD 2452500) light curve decay slopes are similar to that of the hypernovae SN 1997ef and SN 1998bw. We present here the $BVRI$ photometric light curves and colour evolutions of SN 2002ap to investigate the late time nature of the light curve.

  3. Star Formation Law in the Milky Way

    CERN Document Server

    Sofue, Yoshiaki

    2016-01-01

    The Schmidt law (SF law) in the Milky Way was investigated using 3D distribution maps of HII regions, HI and molecular (\\Htwo) gases with spatial resolutions of $\\sim 1$ kpc in the Galactic plane and a few tens of pc in the vertical direction. HII regions were shown to be distributed in a star-forming (SF) disk with nearly constant vertical full thickness 92 pc in spatial coincidence with the molecular gas disk. The vertically averaged volume star formation rate (SFR) $\\rho_{\\rm SFR}$ in the SF disk is related to the surface SFR $\\Sigma_{\\rm SFR}$ by $\\rho_{\\rm SFR} /[{\\rm M_\\odot y^{-1} kpc^{-3}}] =9.26\\times \\Sigma_{\\rm SFR}/[{\\rm M_\\odot y^{-1} kpc^{-2}}]$. The SF law fitted by a single power law of gas density in the form of $\\Sigma_{\\rm SFR} \\propto \\rho_{\\rm SFR} \\propto \\rho_{\\rm gas}^\\alpha$ and $\\propto \\Sigma_{\\rm gas}^\\beta$ showed indices of $\\alpha=0.78 \\pm 0.05$ for $\\rho_{\\rm H_2}$ and $2.15 \\pm 0.08$ for $\\rho_{\\rm total}$, and $\\beta=1.14\\pm 0.23$ for $\\Sigma_{\\rm total}$, where $\\rho$ and $\\...

  4. Exploring the Birth of Binary Stars

    Science.gov (United States)

    Kohler, Susanna

    2016-08-01

    understand the alignment of protostellar outflows during binary formation, Offner and collaborators conduct a series of numerical simulations of the process of turbulent fragmentation.The teams radiation-magnetohydrodynamics simulations start with a spherical core with random turbulent velocities within it. The simulations then follow the formation of seeds within the core, which accrete mass and eventually launch protostellar outflows.In total, Offner and collaborators run twelve simulations, in which five produce single stars, five produce binaries, and two produce triplestar systems.Comparison to ObservationsCumulative density function of the angles between simulated binary pairs protostellar outflows. The black line is the MASSES data (observations of actual binaries). The alignments from the simulations are consistent with the real observational data. [Offner et al. 2016]As a final step, the authors generate synthetic observations from their simulations, to demonstrate what the protostellar outflows would look like. They then compare these to real observations of outflow orientations in young binaries from a survey known as MASSES.Statistical analysis shows that the protostellar jets in the authors simulations are consistent with being randomly aligned or misaligned. This confirms what we would expect since the systems formed at wide separations from separate gravitational collapse events and the alignment distribution is consistent with observations of binaries in MASSES.Offner and collaborators work in this study indicates that the presence of misaligned binaries in observations supports turbulent fragmentation as the mechanism for binary formation. The authors caution, however, that were dealing with small-number statistics: MASSES consists of only 19 binary pairs. The next step is to obtain a larger sample of observations for comparison.CitationStella S. R. Offner et al 2016 ApJ 827 L11. doi:10.3847/2041-8205/827/1/L11

  5. Rotating Stars Can Help Planets Become Habitable

    Science.gov (United States)

    Kohler, Susanna

    2015-12-01

    ), average (green), or fast (blue). [Johnstone et al. 2015]Case A(Initial atmospheric mass of 10-4 Earth masses)Entire atmosphere evaporates quickly, regardless of the rotation speed of the host star.Case B(Initial atmospheric mass of 10-3 Earth masses)Entire atmosphere evaporates, but the timescale is much shorter if the stellar host is fast-rotating as opposed to slow-rotating.Case C(Initial atmospheric mass of 10-2 Earth masses)If the stellar host is fast-rotating, entire atmosphere evaporates on a short timescale. If the host is slow-rotating, very little of the atmosphere evaporates.Case D(Initial atmospheric mass of 10-1 Earth masses)Very little of the atmosphere evaporates, regardless of the rotation speed of the host star.These results demonstrate that the initial rotation rate of a host star not only determines whether a planet will lose its protoatmosphere, but also how long this process will take. Thus, the evolution of host stars rotation rates is an important component in our understanding of how planets might evolve to become habitable.CitationC. P. Johnstone et al 2015 ApJ 815 L12. doi:10.1088/2041-8205/815/1/L12

  6. Stars and Flowers, Flowers and Stars

    Science.gov (United States)

    Minti, Hari

    2012-12-01

    The author, a graduated from the Bucharest University (1964), actually living and working in Israel, concerns his book to variable stars and flowers, two domains of his interest. The analogies includes double stars, eclipsing double stars, eclipses, Big Bang. The book contains 34 chapters, each of which concerns various relations between astronomy and other sciences and pseudosciences such as Psychology, Religion, Geology, Computers and Astrology (to which the author is not an adherent). A special part of the book is dedicated to archeoastronomy and ethnoastronomy, as well as to history of astronomy. Between the main points of interest of these parts: ancient sanctuaries in Sarmizegetusa (Dacia), Stone Henge(UK) and other. The last chapter of the book is dedicated to flowers. The book is richly illustrated. It is designed for a wide circle of readers.

  7. Violent Star Formation in NGC 2363: Erratum

    Science.gov (United States)

    Gonzalez-Delgado, Rosa M.; Perez, Enrique; Tenorio-Tagle, Guillermo; Vilchez, Jose M.; Terlevich, Elena; Terlevich, Roberto; Telles, Eduardo; Rodríguez Espinosa, Jose M.; Mas-Hesse, Miguel; Garcia-Vargas, Maria Luisa; Diaz, Angeles I.; Cepa, Jordi; Castaneda, Hector

    1996-12-01

    In the paper "Violent Star Formation in NGC 2363" by Rosa M. Gonzalez- Delgado, Enrique Perez, Guillermo Tenorio-Tagle, Jose M. Vilchez, Elena Terlevich, Roberto Terlevich, Eduardo Telles, Jose M. Rodriguez-Espinosa, Miguel Mas-Hesse, Maria Luisa Garcia-Vargas, Angeles I. Diaz, Jordi Cepa, and Hector Castaneda (ApJ, 437,239 [1994)), there are three errors in Section 5.4. The Paschen discontinuity in knot A is (0.82 +/- 0.19) x 10^-16^ ergs s^-1^ cm^-2^ A^-1^, the coefficient in the formula in page 258 is 2.445 x 10^11^, and the units in the ordinate axis of Figure 16 are 10^-15^ ergs cm^-2^ s^-1^ A^-1^. These are typographical errors, and they do not affect the determination of the electron temperature using the Paschen jump and the discussion and conclusions in this paper.

  8. Neutron Stars: Formation and Structure

    OpenAIRE

    Kutschera, Marek

    1998-01-01

    A short introduction is given to astrophysics of neutron stars and to physics of dense matter in neutron stars. Observed properties of astrophysical objects containing neutron stars are discussed. Current scenarios regarding formation and evolution of neutron stars in those objects are presented. Physical principles governing the internal structure of neutron stars are considered with special emphasis on the possible spin ordering in the neutron star matter.

  9. Quark Neutron Layer Stars

    CERN Document Server

    Carinhas, P A

    1993-01-01

    Typical nuclear equations of state and a quark bag model, surprisingly, allow compact stars with alternate layers of neutrons and quarks. One can determine on the basis of the Gibbs free energy which phase, nuclear or quark, is energetically favorable. Using the nuclear equation of state of Wiringa, and a quark equation of state given by Freedman and McLerran, the allowed quark parameter space for such layer stars is searched. This paper differs from past work in that configurations are found in which quark matter is located exterior and interior to shells of nuclear matter, i.e., dependent on quark parameters, a star may contain several alternating layers of quark and nuclear matter. Given the uncertainty in the quark parameter space, one can estimate the probability for finding pure neutron stars, pure quark stars (strange stars), stars with a quark core and a nucleon exterior, or layer stars. Several layer models are presented. The physical characteristics, stability, and results of a thorough search of th...

  10. Neutrostriction in Neutron stars

    OpenAIRE

    Ignatovich, V. K.

    2003-01-01

    It is demonstrated that not only gravity, but also neutrostriction forces due to optical potential created by coherent elastic neutron-neutron scattering can hold a neutron star together. The latter forces can be stronger than gravitational ones. The effect of these forces on mass, radius and structure of the neutron star is estimated.

  11. The violent neutron star

    OpenAIRE

    Watts, Anna L.

    2012-01-01

    Neutron stars enable us to study both the highest densities and the highest magnetic fields in the known Universe. In this article I review what can be learned about such fundamental physics using magnetar bursts. Both the instability mechanisms that trigger the bursts, and the subsequent dynamical and radiative response of the star, can be used to explore stellar and magnetospheric structure and composition.

  12. Observing Double Stars

    Science.gov (United States)

    Genet, Russell M.; Fulton, B. J.; Bianco, Federica B.; Martinez, John; Baxter, John; Brewer, Mark; Carro, Joseph; Collins, Sarah; Estrada, Chris; Johnson, Jolyon; Salam, Akash; Wallen, Vera; Warren, Naomi; Smith, Thomas C.; Armstrong, James D.; McGaughey, Steve; Pye, John; Mohanan, Kakkala; Church, Rebecca

    2012-05-01

    Double stars have been systematically observed since William Herschel initiated his program in 1779. In 1803 he reported that, to his surprise, many of the systems he had been observing for a quarter century were gravitationally bound binary stars. In 1830 the first binary orbital solution was obtained, leading eventually to the determination of stellar masses. Double star observations have been a prolific field, with observations and discoveries - often made by students and amateurs - routinely published in a number of specialized journals such as the Journal of Double Star Observations. All published double star observations from Herschel's to the present have been incorporated in the Washington Double Star Catalog. In addition to reviewing the history of visual double stars, we discuss four observational technologies and illustrate these with our own observational results from both California and Hawaii on telescopes ranging from small SCTs to the 2-meter Faulkes Telescope North on Haleakala. Two of these technologies are visual observations aimed primarily at published "hands-on" student science education, and CCD observations of both bright and very faint doubles. The other two are recent technologies that have launched a double star renaissance. These are lucky imaging and speckle interferometry, both of which can use electron-multiplying CCD cameras to allow short (30 ms or less) exposures that are read out at high speed with very low noise. Analysis of thousands of high speed exposures allows normal seeing limitations to be overcome so very close doubles can be accurately measured.

  13. Isospin-dependent clusterization of Neutron-Star Matter

    OpenAIRE

    Ducoin, C.; Chomaz, P.; Gulminelli, F.

    2006-01-01

    To appear in Nuclear Physics A International audience Because of the presence of a liquid-gas phase transition in nuclear matter, compact-star matter can present a region of instability against the formation of clusters. We investigate this phase separation in a matter composed of neutrons, protons and electrons, within a Skyrme-Lyon mean-field approach. Matter instability and phase properties are characterized through the study of the free-energy curvature. The effect of beta-equilibri...

  14. Berberine inhibits cyclin D1 expression via suppressed binding of AP-1 transcription factors to CCND1 AP-1 motif

    Institute of Scientific and Technical Information of China (English)

    Ye LUO; Yu HAO; Tai-ping SHI; Wei-wei DENG; Na LI

    2008-01-01

    Aim: To verify the suppressive effect of berberine on the proliferation of the human pulmonary giant cell carcinoma cell line PG and to demonstrate the mecha-nisms behind the antitumoral effects of berberine. Methods: The proliferative effects of PG cells were detected by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide colorimetry. The cell cycle was examined by flow cytometry. The expression level of cyclin D1 was detected by RT-PCR. The activities of the activating protein-1 (AP-1) and NF-κB signaling pathways related to cyclin D1 were examined by luciferase assay. The cytoplasmic level of c-Jun was detected by Western blot analysis. An electrophoretic mobility shift assay was used to examiae the binding of transcription factors to the cyclin D1 gene (CCNDl) AP-1 motif. Results: The results showed that the proliferation of PG cells treated with different concentrations (10, 20, and 40 μg/mL) of berberine for 24 and 48 h was suppressed significantly compared to the control group. After treatment with berberine, the proportion of PG cells at the G0/G1 phase increased, while cells at the S and G2/M phases decreased. Berberine could inhibit the expression of cyclin D1 in PG cells. Berberine inhibited the activity of the AP-1 signaling pathway, but had no significant effect on the NF-κB signaling pathway. Berberine suppressed the expression of c-Jun and decreased the binding of tran-scription factors to the CCND1 AP-1 motif. Conclusion: Berberine suppresses the activity of the AP-1 signaling pathway and decreases the binding of transcrip-tion factors to the CCND1 AP-1 motif. This is one of the important mechanisms behind the antitumoral effects of berberine as a regulator of cyclin D1.

  15. Beta Function and Anomalous Dimensions

    DEFF Research Database (Denmark)

    Pica, Claudio; Sannino, Francesco

    2011-01-01

    We demonstrate that it is possible to determine the coefficients of an all-order beta function linear in the anomalous dimensions using as data the two-loop coefficients together with the first one of the anomalous dimensions which are universal. The beta function allows to determine the anomalous...

  16. The best-beta CAPM

    NARCIS (Netherlands)

    L. Zou

    2006-01-01

    The issue of 'best-beta' arises as soon as potential errors in the Sharpe-Lintner-Black capital asset pricing model (CAPM) are acknowledged. By incorporating a target variable into the investor preferences, this study derives a best-beta CAPM (BCAPM) that maintains the CAPM's theoretical appeal and

  17. Star spot location estimation using Kalman filter for star tracker.

    Science.gov (United States)

    Liu, Hai-bo; Yang, Jian-kun; Wang, Jiong-qi; Tan, Ji-chun; Li, Xiu-jian

    2011-04-20

    Star pattern recognition and attitude determination accuracy is highly dependent on star spot location accuracy for the star tracker. A star spot location estimation approach with the Kalman filter for a star tracker has been proposed, which consists of three steps. In the proposed approach, the approximate locations of the star spots in successive frames are predicted first; then the measurement star spot locations are achieved by defining a series of small windows around each predictive star spot location. Finally, the star spot locations are updated by the designed Kalman filter. To confirm the proposed star spot location estimation approach, the simulations based on the orbit data of the CHAMP satellite and the real guide star catalog are performed. The simulation results indicate that the proposed approach can filter out noises from the measurements remarkably if the sampling frequency is sufficient. PMID:21509065

  18. Revised Anatomy of Stars

    CERN Document Server

    Dubin, M; Dubin, Maurice; Soberman, Robert K.

    1997-01-01

    Stars accrete near invisible hydrogen dominated agglomerates. This population, the `dark matter,' effects the nature of stars. Measurements show plasma streams impacting Earth, planets, Sun and stars. This mass-energy source contradicts nebula collapse model for stars. The visual derived model, to which later discoveries (e.g., fusion) were appended, is confounded and contradicted by new observations. Discovery of a quantity of beryllium 7 (53 day half-life) in the Earth's upper atmosphere, fusion produced, hence from the solar outer zone, proves core fusion wrong. Magnetically pinched plasmas from aggregates impact stars at hundreds of km/s, create impulsive conditions for nuclear explosions below the surface. Disks with planets aid cluster capture. Planets modulate the influx varying fusion, hence luminosity (e.g., solar cycle). This population, with no assumptions or ad hoc physics, explains mysterious phenomena, e.g., luminosity/wind variation, sunspots, high temperature corona, CMEs, etc. Standard explan...

  19. Neutron Stars and Pulsars

    CERN Document Server

    Becker, Werner

    2009-01-01

    Neutron stars are the most compact astronomical objects in the universe which are accessible by direct observation. Studying neutron stars means studying physics in regimes unattainable in any terrestrial laboratory. Understanding their observed complex phenomena requires a wide range of scientific disciplines, including the nuclear and condensed matter physics of very dense matter in neutron star interiors, plasma physics and quantum electrodynamics of magnetospheres, and the relativistic magneto-hydrodynamics of electron-positron pulsar winds interacting with some ambient medium. Not to mention the test bed neutron stars provide for general relativity theories, and their importance as potential sources of gravitational waves. It is this variety of disciplines which, among others, makes neutron star research so fascinating, not only for those who have been working in the field for many years but also for students and young scientists. The aim of this book is to serve as a reference work which not only review...

  20. Ages of young stars

    CERN Document Server

    Soderblom, David R; Jeffries, Rob D; Mamajek, Eric E; Naylor, Tim

    2013-01-01

    Determining the sequence of events in the formation of stars and planetary systems and their time-scales is essential for understanding those processes, yet establishing ages is fundamentally difficult because we lack direct indicators. In this review we discuss the age challenge for young stars, specifically those less than ~100 Myr old. Most age determination methods that we discuss are primarily applicable to groups of stars but can be used to estimate the age of individual objects. A reliable age scale is established above 20 Myr from measurement of the Lithium Depletion Boundary (LDB) in young clusters, and consistency is shown between these ages and those from the upper main sequence and the main sequence turn-off -- if modest core convection and rotation is included in the models of higher-mass stars. Other available methods for age estimation include the kinematics of young groups, placing stars in Hertzsprung-Russell diagrams, pulsations and seismology, surface gravity measurement, rotation and activ...

  1. RAVEN Beta Release

    Energy Technology Data Exchange (ETDEWEB)

    Rabiti, Cristian [Idaho National Lab. (INL), Idaho Falls, ID (United States); Alfonsi, Andrea [Idaho National Lab. (INL), Idaho Falls, ID (United States); Cogliati, Joshua Joseph [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mandelli, Diego [Idaho National Lab. (INL), Idaho Falls, ID (United States); Kinoshita, Robert Arthur [Idaho National Lab. (INL), Idaho Falls, ID (United States); Wang, Congjian [Idaho National Lab. (INL), Idaho Falls, ID (United States); Maljovec, Daniel Patrick [Idaho National Lab. (INL), Idaho Falls, ID (United States); Talbot, Paul William [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2016-02-01

    This documents the release of the Risk Analysis Virtual Environment (RAVEN) code. A description of the RAVEN code is provided, and discussion of the release process for the M2LW-16IN0704045 milestone. The RAVEN code is a generic software framework to perform parametric and probabilistic analysis based on the response of complex system codes. RAVEN is capable of investigating the system response as well as the input space using Monte Carlo, Grid, or Latin Hyper Cube sampling schemes, but its strength is focused toward system feature discovery, such as limit surfaces, separating regions of the input space leading to system failure, using dynamic supervised learning techniques. RAVEN has now increased in maturity enough for the Beta 1.0 release.

  2. Beta systems error analysis

    Science.gov (United States)

    1984-01-01

    The atmospheric backscatter coefficient, beta, measured with an airborne CO Laser Doppler Velocimeter (LDV) system operating in a continuous wave, focussed model is discussed. The Single Particle Mode (SPM) algorithm, was developed from concept through analysis of an extensive amount of data obtained with the system on board a NASA aircraft. The SPM algorithm is intended to be employed in situations where one particle at a time appears in the sensitive volume of the LDV. In addition to giving the backscatter coefficient, the SPM algorithm also produces as intermediate results the aerosol density and the aerosol backscatter cross section distribution. A second method, which measures only the atmospheric backscatter coefficient, is called the Volume Mode (VM) and was simultaneously employed. The results of these two methods differed by slightly less than an order of magnitude. The measurement uncertainties or other errors in the results of the two methods are examined.

  3. RAVEN Beta Release

    International Nuclear Information System (INIS)

    This documents the release of the Risk Analysis Virtual Environment (RAVEN) code. A description of the RAVEN code is provided, and discussion of the release process for the M2LW-16IN0704045 milestone. The RAVEN code is a generic software framework to perform parametric and probabilistic analysis based on the response of complex system codes. RAVEN is capable of investigating the system response as well as the input space using Monte Carlo, Grid, or Latin Hyper Cube sampling schemes, but its strength is focused toward system feature discovery, such as limit surfaces, separating regions of the input space leading to system failure, using dynamic supervised learning techniques. RAVEN has now increased in maturity enough for the Beta 1.0 release.

  4. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    Energy Technology Data Exchange (ETDEWEB)

    Theodorakis, P E [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Avgeropoulos, A [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Freire, J J [Departamento de Ciencias y Tecnicas FisicoquImicas, Universidad Nacional de Educacion a Distancia, Facultad de Ciencias, Senda del Rey 9, 28040 Madrid (Spain); Kosmas, M [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece); Vlahos, C [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece)

    2007-11-21

    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.

  5. Beta Beams Implementation at CERN

    CERN Document Server

    Hansen, Christian

    2011-01-01

    Beta Beam,the concept of generating a pure and intense (anti) neutrino beam by letting accelerated radioactive ions beta decay in a storage ring, called Decay Ring (DR), is the base of one of the proposed next generation neutrino oscillation facilities, necessary for a complete study of the neutrino oscillation parameter space. Sensitivities of the unknown neutrino oscillation parameters depend on the Decay Ring's ion intensity and of it's duty factor (the filled ratio of the ring). Therefore efficient ion production, stripping, bunching, acceleration and storing are crucial sub-projects under study and development within the Beta Beam collaboration. Specifically the feasibility of these tasks as parts of a Beta Beam implementation at CERN will be discussed in this report. The positive impact of the large {\\theta}13 indications from T2K on the Beta Beam performance will also be discussed.

  6. Incorporating the APS Catalog of the POSS I and Image Archive in ADS

    Science.gov (United States)

    Humphreys, Roberta M.

    1998-01-01

    The primary purpose of this contract was to develop the software to both create and access an on-line database of images from digital scans of the Palomar Sky Survey. This required modifying our DBMS (called Star Base) to create an image database from the actual raw pixel data from the scans. The digitized images are processed into a set of coordinate-reference index and pixel files that are stored in run-length files, thus achieving an efficient lossless compression. For efficiency and ease of referencing, each digitized POSS I plate is then divided into 900 subplates. Our custom DBMS maps each query into the corresponding POSS plate(s) and subplate(s). All images from the appropriate subplates are retrieved from disk with byte-offsets taken from the index files. These are assembled on-the-fly into a GIF image file for browser display, and a FITS format image file for retrieval. The FITS images have a pixel size of 0.33 arcseconds. The FITS header contains astrometric and photometric information. This method keeps the disk requirements manageable while allowing for future improvements. When complete, the APS Image Database will contain over 130 Gb of data. A set of web pages query forms are available on-line, as well as an on-line tutorial and documentation. The database is distributed to the Internet by a high-speed SGI server and a high-bandwidth disk system. URL is http://aps.umn.edu/IDB/. The image database software is written in perl and C and has been compiled on SGI computers with MIX5.3. A copy of the written documentation is included and the software is on the accompanying exabyte tape.

  7. Inorganic, radioisotopic and organic analysis of 241-AP-101 tank waste

    International Nuclear Information System (INIS)

    Battelle received five samples from Hanford waste tank 241-AP-101, taken at five different depths within the tank. No visible solids or organic layer were observed in the individual samples. Individual sample densities were measured, then the five samples were mixed together to provide a single composite. The composite was homogenized and representative sub-samples taken for inorganic, radioisotopic, and organic analysis. All analyses were performed on triplicate sub-samples of the composite material. The sample composite did not contain visible solids or an organic layer. A subsample held at 10 C for seven days formed no visible solids. The characterization of the 241-AP-101 composite samples included: (1) Inductively-coupled plasma spectrometry for Ag, Al, Ba, Bi, Ca, Cd, Cr, Cu, Fe, K, La, Mg, Mn, Na, Nd, Ni, P, Pb, Pd, Ru, Rh, Si, Sr, Ti, U, Zn, and Zr (Note: Although not specified in the test plan, As, B, Be, Co, Li, Mo, Sb, Se, Sn, Tl, V, W, and Y were also measured and reported for information only) (2) Radioisotopic analyses for total alpha and total beta activities, 3H, 14C, 60Co, 79Se, 90Sr, 99Tc as pertechnetate, 106Ru/Rh, 125Sb, 134Cs, 137Cs, 152Eu, 154Eu, 155Eu, 238Pu, 239+240Pu, 241Am, 242Cm, and 243+244Cm; (3) Inductively-coupled plasma mass spectrometry for 237Np, 239Pu, 240Pu, 99Tc, 126Sn, 129I, 231Pa, 233U, 234U, 235U, 236U, 238U, 241AMU, 242AMU, 243AMU, As, B, Be, Ce, Co, Cs, Eu, I, Li, Mo, Pr, Rb, Sb, Se, Ta, Te, Th, Tl, V, and W; (4) total U by kinetic phosphorescence analysis; (5) Ion chromatography for Cl, F, NO2, NO3, PO4, SO4, acetate, formate, oxalate, and citrate; (6) Density, inorganic carbon and organic carbon by two different methods, mercury, free hydroxide, ammonia, and cyanide. The 241-AP-101 composite met all contract limits (molar ratio of analyte to sodium or ratio of becquerels of analyte to moles of sodium) defined in Specification 7 for Envelope A. Except for a few cases, the characterization results met or surpassed the

  8. Inorganic, radioisotopic and organic analysis of 241-AP-101 tank waste

    Energy Technology Data Exchange (ETDEWEB)

    SK Fiskum; PR Bredt; JA Campbell; LR Greenwood; OT Farmer; GJ Lumetta; GM Mong; RT Ratner; CZ Soderquist; RG Swoboda; MW Urie; JJ Wagner

    2000-06-28

    Battelle received five samples from Hanford waste tank 241-AP-101, taken at five different depths within the tank. No visible solids or organic layer were observed in the individual samples. Individual sample densities were measured, then the five samples were mixed together to provide a single composite. The composite was homogenized and representative sub-samples taken for inorganic, radioisotopic, and organic analysis. All analyses were performed on triplicate sub-samples of the composite material. The sample composite did not contain visible solids or an organic layer. A subsample held at 10 C for seven days formed no visible solids. The characterization of the 241-AP-101 composite samples included: (1) Inductively-coupled plasma spectrometry for Ag, Al, Ba, Bi, Ca, Cd, Cr, Cu, Fe, K, La, Mg, Mn, Na, Nd, Ni, P, Pb, Pd, Ru, Rh, Si, Sr, Ti, U, Zn, and Zr (Note: Although not specified in the test plan, As, B, Be, Co, Li, Mo, Sb, Se, Sn, Tl, V, W, and Y were also measured and reported for information only) (2) Radioisotopic analyses for total alpha and total beta activities, {sup 3}H, {sup 14}C, {sup 60}Co, {sup 79}Se, {sup 90}Sr, {sup 99}Tc as pertechnetate, {sup 106}Ru/Rh, {sup 125}Sb, {sup 134}Cs, {sup 137}Cs, {sup 152}Eu, {sup 154}Eu, {sup 155}Eu, {sup 238}Pu, {sup 239+240}Pu, {sup 241}Am, {sup 242}Cm, and {sup 243+244}Cm; (3) Inductively-coupled plasma mass spectrometry for {sup 237}Np, {sup 239}Pu, {sup 240}Pu, {sup 99}Tc, {sup 126}Sn, {sup 129}I, {sup 231}Pa, {sup 233}U, {sup 234}U, {sup 235}U, {sup 236}U, {sup 238}U, {sup 241}AMU, {sup 242}AMU, {sup 243}AMU, As, B, Be, Ce, Co, Cs, Eu, I, Li, Mo, Pr, Rb, Sb, Se, Ta, Te, Th, Tl, V, and W; (4) total U by kinetic phosphorescence analysis; (5) Ion chromatography for Cl, F, NO{sub 2}, NO{sub 3}, PO{sub 4}, SO{sub 4}, acetate, formate, oxalate, and citrate; (6) Density, inorganic carbon and organic carbon by two different methods, mercury, free hydroxide, ammonia, and cyanide. The 241-AP-101 composite met all

  9. Penetration dynamics of AP8 in thin ceramic tiles

    NARCIS (Netherlands)

    Abadjieva, E.; Khoe, Y.S.

    2013-01-01

    The interaction of thin ceramic tiles with AP8 (WC core, 7,62 mm) at 1000 m/s velocity has been studied experimentally and numerically. “Thin” ceramic tiles refers here to ratio of the tile thickness (t) to the projectile diameter, (d), t/d@ 1, as they are both in the same order. The method applied

  10. Time Trials--An AP Physics Challenge Lab

    Science.gov (United States)

    Jones, David

    2009-01-01

    I have come to the conclusion that for high school physics classroom and laboratory experiences, simpler is better! In this paper I describe a very simple and effective lab experience that my AP students have thoroughly enjoyed year after year. I call this lab exercise "Time Trials." The experiment is simple in design and it is a lot of fun for…

  11. The AP Lever for Boosting Access, Success, and Equity

    Science.gov (United States)

    Roegman, Rachel; Hatch, Thomas

    2016-01-01

    Four New Jersey school districts worked together to increase student achievement by applying a number of strategies focused on getting traditionally underrepresented students to take more AP courses. The districts are members of the New Jersey Network of Superintendents (NJNS), comprising 15 superintendents who work together to develop systemwide…

  12. The New AP Chemistry Exam: Its Rationale, Content, and Scoring

    Science.gov (United States)

    Price, Paul D.; Kugel, Roger W.

    2014-01-01

    The 2013-2014 academic year marks the rollout of the redesigned advanced placement (AP) chemistry course and exam. There have been many questions as to why the course was redesigned and how the new examination will differ from its legacy version. In this article we give a brief overview of the legacy course and examine why a redesign occurred in…

  13. Integrating Particulate Representations into AP Chemistry and Introductory Chemistry Courses

    Science.gov (United States)

    Prilliman, Stephen G.

    2014-01-01

    The College Board's recently revised curriculum for advanced placement (AP) chemistry places a strong emphasis on conceptual understanding, including representations of particle phenomena. This change in emphasis is informed by years of research showing that students could perform algorithmic calculations but not explain those calculations…

  14. SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Wei; Johns-Krull, Christopher M., E-mail: wc2@rice.edu, E-mail: cmj@rice.edu [Department of Physics and Astronomy, Rice University, Houston, TX 77005 (United States)

    2013-10-20

    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star.

  15. [Serum beta 2 microglobulin (beta 2M) following renal transplantation].

    Science.gov (United States)

    Pacheco-Silva, A; Nishida, S K; Silva, M S; Ramos, O L; Azjen, H; Pereira, A B

    1994-01-01

    Although there was an important improvement in graft and patient survival the last 10 years, graft rejection continues to be a major barrier to the success of renal transplantation. Identification of a laboratory test that could help to diagnose graft rejection would facilitate the management of renal transplanted patients. PURPOSE--To evaluate the utility of monitoring serum beta 2M in recently transplanted patients. METHODS--We daily determined serum beta 2M levels in 20 receptors of renal grafts (10 from living related and 10 from cadaveric donors) and compared them to their clinical and laboratory evolution. RESULTS--Eight patients who presented immediate good renal function following grafting and did not have rejection had a mean serum beta 2M of 3.7 mg/L on the 4th day post transplant. The sensitivity of the test for the diagnosis of acute rejection was 87.5%, but the specificity was only 46%. Patients who presented acute tubular necrosis (ATN) without rejection had a progressive decrease in their serum levels of beta 2M, while their serum creatinine changed as they were dialyzed. In contrast, patients with ATN and concomitance of acute rejection or CSA nephrotoxicity presented elevated beta 2M and creatinine serum levels. CONCLUSION--Daily monitoring of serum beta 2M does not improve the ability to diagnose acute rejection in patients with good renal function. However, serum beta 2M levels seemed to be useful in diagnosing acute rejection or CSA nephrotoxicity in patients with ATN.

  16. Shear viscosity of $\\beta$-stable nuclear matter

    CERN Document Server

    Benhar, Omar

    2009-01-01

    Viscosity plays a critical role in determining the stability of rotating neutron stars. We report the results of a calculation of the shear viscosity of $\\beta$~-~stable matter, carried out using an effective interaction based on a state-of-the-art nucleon-nucleon potential and the formalism of correlated basis functions. Within our approach the equation of state, determining the proton fraction, and the nucleon-nucleon scattering probability are consistently obtained from the same dynamical model. The results show that, while the neutron contribution to the viscosity is always dominant, above nuclear saturation density the electron contribution becomes appreciable.

  17. Catch a Star!

    Science.gov (United States)

    2006-11-01

    ESO and the European Association for Astronomy Education are launching today the 2007 edition of 'Catch a Star!', their international astronomy competition for school students. Now in its fifth year, the competition offers students the chance to win a once-in-a-lifetime trip to ESO's flagship observatory in Chile, as well as many other prizes. Students are invited to 'become astronomers' and embark on a journey to explore the Universe. ESO PR Photo 42/06 The competition includes separate categories - 'Catch a Star Researchers' and 'Catch a Star Adventurers' - to ensure that every student, whatever their level, has the chance to enter and win exciting prizes. For the artistically minded, 'Catch a Star!' also includes an artwork competition, 'Catch a Star Artists'. "'Catch a Star!' offers a unique opportunity for students to learn more about astronomy and about the methods scientists use to discover new things about the Universe", said Douglas Pierce-Price, Education Officer at ESO. In teams, students choose an astronomical topic to study and produce an in-depth report. An important part of the project for 'Catch a Star Researchers' is to think about how ESO's telescopes or a telescope of the future can contribute to their investigations of the subject. As well as the top prize - a trip to one of ESO's observatory sites in Chile - visits to observatories in Germany, Austria and Spain, and many other prizes are also available to be won. 'Catch a Star Researchers' winners will be chosen by an international jury, and 'Catch a Star Adventurers' will be awarded further prizes by lottery. Entries for 'Catch a Star Artists' will be displayed on the web and winners chosen with the help of a public online vote. The first editions of 'Catch a Star!' have attracted several hundred entries from more than 25 countries worldwide. Previous winning entries have included "Star clusters and the structure of the Milky Way" (Budapest, Hungary), "Vega" (Acqui Terme, Italy) and "Venus

  18. Intuitionistic Fuzzy Generalized Beta Closed Mappings

    OpenAIRE

    D. Jayanthi

    2014-01-01

    In this paper we introduce intuitionistic fuzzy generalized beta closed mappings and intuitionistic fuzzy generalized beta open mappings. We investigate some of their properties. We also introduce intuitionistic fuzzy M-generalized beta closed mappings as well as intuitionistic fuzzy M-generalized beta open mappings. We provide the relation between intuitionistic fuzzy M-generalized beta closed mappings and intuitionistic fuzzy generalized beta closed mappings.

  19. AP1000 Features Prevent Potential Containment Recirculation Screen Plugging

    International Nuclear Information System (INIS)

    This paper presents the results of plant design development and evaluations that demonstrate that the AP1000 plant is not subject to potential containment recirculation screen plugging following a loss-of-coolant-accident (LOCA). Following a LOCA in a pressurized water reactor, it is necessary to recirculate water from the containment back into the reactor to maintain long term core cooling. The AP1000 utilizes passive safety systems to provide containment recirculation for long term core cooling following a LOCA. The AP1000 also has non-safety pumps which provide a backup means of providing recirculation. Screens are provided around the recirculation pipes to prevent debris from blocking recirculation flow and core cooling passages. Debris may be generated by the LOCA blowdown from insulation and coatings used inside containment. Even with effective cleanliness programs, there may be some resident debris such as dust and dirt. The potential for plugging the recirculation screens is a current PWR licensing issue. The AP1000 design provides inherent advantages with respect to the potential plugging of containment recirculation screens. These characteristics include prevention of fibrous debris generation, improved debris settling and improved recirculation screen design. Debris settling analysis demonstrates that failure of coatings does not result in debris being transported to the screens before it settles to the floor. Additional analysis also shows that the plant can tolerate conservative amounts of resident debris being transported to the screens. The AP1000 significantly reduces the probability of plugging the containment recirculation screens and significantly reduces inspection and maintenance of coatings used inside containment. (authors)

  20. The Nainital-Cape Survey. IV. A search for pulsational variability in 108 chemically peculiar stars

    Science.gov (United States)

    Joshi, S.; Martinez, P.; Chowdhury, S.; Chakradhari, N. K.; Joshi, Y. C.; van Heerden, P.; Medupe, T.; Kumar, Y. B.; Kuhn, R. B.

    2016-05-01

    Context. The Nainital-Cape Survey is a dedicated ongoing survey program to search for and study pulsational variability in chemically peculiar (CP) stars to understand their internal structure and evolution. Aims: The main aims of this survey are to find new pulsating Ap and Am stars in the northern and southern hemisphere and to perform asteroseismic studies of these new pulsators. Methods: The survey is conducted using high-speed photometry. The candidate stars were selected on the basis of having Strömgren photometric indices similar to those of known pulsating CP stars. Results: Over the last decade a total of 337 candidate pulsating CP stars were observed for the Nainital-Cape Survey, making it one of the longest ground-based surveys for pulsation in CP stars in terms of time span and sample size. The previous papers of this series presented seven new pulsating variables and 229 null results. In this paper we present the light curves, frequency spectra and various astrophysical parameters of the 108 additional CP stars observed since the last reported results. We also tabulated the basic physical parameters of the known roAp stars. As a part of establishing the detection limits in the Nainital-Cape Survey, we investigated the scintillation noise level at the two observing sites used in this survey, Sutherland and Nainital, by comparing the combined frequency spectra stars observed from each location. Our analysis shows that both the sites permit the detection of variations of the order of 0.6 milli-magnitude (mmag) in the frequency range 1-4 mHz, Sutherland is on average marginally better. The dataset is only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/590/A116

  1. Relativistic Stars in Beyond Horndeski Theories

    CERN Document Server

    Babichev, Eugeny; Langlois, David; Saito, Ryo; Sakstein, Jeremy

    2016-01-01

    This work studies relativistic stars in beyond Horndeski scalar-tensor theories that exhibit a breaking of the Vainshtein mechanism inside matter, focusing on a model based on the quartic beyond Horndeski Lagrangian. We self-consistently derive the scalar field profile for static spherically symmetric objects in asymptotically de Sitter space-time and show that the Vainshtein breaking branch of the solutions is the physical branch thereby resolving several ambiguities with non-relativistic frameworks. The geometry outside the star is shown to be exactly Schwarzschild-de Sitter and therefore the PPN parameter $\\beta_{\\rm PPN}=1$, confirming that the external screening works at the post-Newtonian level. The Tolman-Oppenheimer-Volkoff (TOV) equations are derived and a new lower bound on the Vainshtein breaking parameter $\\Upsilon_1>-4/9$ is found by requiring the existence of static spherically symmetric stars. Focusing on the unconstrained case where $\\Upsilon_1<0$, we numerically solve the TOV equations for...

  2. Functional analysis of the two Brassica AP3 genes involved in apetalous and stamen carpelloid phenotypes.

    Directory of Open Access Journals (Sweden)

    Yanfeng Zhang

    Full Text Available The Arabidopsis homeotic genes APETALA3 (AP3 and PISTILLATA (PI are B genes which encode MADS-box transcription factors and specify petal and stamen identities. In the current study, the stamen carpelloid (SC mutants, HGMS and AMS, of B. rapa and B. napus were investigated and two types of AP3 genes, B.AP3.a and B.AP3.b, were functional characterized. B.AP3.a and B.AP3.b share high similarity in amino acid sequences except for 8 residues difference located at the C-terminus. Loss of this 8 residues in B.AP3.b led to the change of PI-derived motifs. Meanwhile, B.AP3.a specified petal and stamen development, whereas B.AP3.b only specified stamen development. In B. rapa, the mutations of both genes generated the SC mutant HGMS. In B. napus that contained two B.AP3.a and two B.AP3.b, loss of the two B.AP3.a functions was the key reason for the apetalous mutation, however, the loss-of-function in all four AP3 was related to the SC mutant AMS. We inferred that the 8 residues or the PI-derived motif in AP3 gene probably relates to petal formation.

  3. Making star teams out of star players.

    Science.gov (United States)

    Mankins, Michael; Bird, Alan; Root, James

    2013-01-01

    Top talent is an invaluable asset: In highly specialized or creative work, for instance, "A" players are likely to be six times as productive as "B" players. So when your company has a crucial strategic project, why not multiply all that firepower and have a team of your best performers tackle it? Yet many companies hesitate to do this, believing that all-star teams don't work: Big egos will get in the way. The stars won't be able to work with one another. They'll drive the team Leader crazy. Mankins, Bird, and Root of Bain & Company believe it's time to set aside that thinking. They have seen all-star teams do extraordinary work. But there is a right way and a wrong way to organize them. Before you can even begin to assemble such a team, you need to have the right talent management practices, so you hire and develop the best people and know what they're capable of. You have to give the team appropriate incentives and leaders and support staffers who are stars in their own right. And projects that are ill-defined or small scale are not for all-star teams. Use them only for critical missions, and make sure their objectives are clear. Even with the right setup, things can still go wrong. The wise executive will take steps to manage egos, prune non-team-players, and prevent average coworkers from feeling completely undervalued. She will also invest a lot of time in choosing the right team Leader and will ask members for lots of feedback to monitor how that leader is doing. PMID:23390743

  4. Quark matter nucleation in neutron stars and astrophysical implications

    CERN Document Server

    Bombaci, Ignazio; Vidana, Isaac; Providencia, Constanca

    2016-01-01

    A phase of strong interacting matter with deconfined quarks is expected in the core of massive neutron stars. We investigate the quark deconfinement phase transition in cold (T = 0) and hot beta-stable hadronic matter. Assuming a first order phase transition, we calculate and compare the nucleation rate and the nucleation time due to quantum and thermal nucleation mechanisms. We show that above a threshold value of the central pressure a pure hadronic star (HS) (i.e. a compact star with no fraction of deconfined quark matter) is metastable to the conversion to a quark star (QS) (i.e. a hybrid star or a strange star). This process liberates an enormous amount of energy, of the order of 10^{53}~erg, which causes a powerful neutrino burst, likely accompanied by intense gravitational waves emission, and possibly by a second delayed (with respect to the supernova explosion forming the HS) explosion which could be the energy source of a powerful gamma-ray burst (GRB). This stellar conversion process populates the Q...

  5. The Christmas and New Year Orion star count

    Science.gov (United States)

    Miles, R.; Lloyd, D.

    2007-06-01

    In 2006 December, the BAA Campaign for Dark Skies (CfDS), in conjunction with the Campaign to Protect Rural England (CPRE), launched the first-ever Orion star count: a survey to evaluate light pollution in the United Kingdom. With the assistance of Callum Potter, website manager, and other officers of the CfDS, a webpage (www.britastro.org/starcount) dedicated to the project was established. People in the UK were asked to estimate the number of stars they could see with the naked eye within the constellation of Orion bordered by a rectangle of four bright stars (Orion's 'shoulders' and 'feet': stars, alpha, gamma, beta and kappa Orionis). The count included the three stars of Orion's Belt, but excluded the four 'corner' stars themselves (see Figure 1). Results were reported to the BAA either by post or by filling in an online form. Observations were made in the absence of moonlight when the sky was naturally dark during late December and January.

  6. Water Vapor Absorption in Early M-type Stars

    CERN Document Server

    Matsuura, M; Murakami, H; Freund, M M; Tanaka, M

    1999-01-01

    The spectrometers onboard the Infrared Telescope in Space (IRTS) reveal water vapor absorption in early M-type stars, as early as M2. Previous observations detected H_2O vapor absorption only in stars later than M6, with the exception of the recent detection of H_2O in beta Peg (M2.5 II-III). In our sample of 108 stars, 67 stars have spectral types earlier than M6. The spectral types are established by means of their near-infrared colors on a statistical basis. Among the 67 stars of spectral types earlier than M6, we find water vapor absorption in six stars. The observed absorption features are interpreted using a local thermodynamic equilibrium model. The features are reasonably fitted by model spectra with excitation temperatures of 1000-1500 K and water column densities of 5x10^19 to 1x10^20 cm^-2. These numbers imply that the H_2O molecules are present in a region of the atmosphere, located above the photosphere. Furthermore, our analysis shows a good correlation between the H_2O absorption band strength,...

  7. Dust Emissivity in the Star-Forming Filament OMC 2/3

    OpenAIRE

    Sadavoy, S. I.; Stutz, A. M.; Schnee, S.; Mason, B. S.; Di Francesco, J.; Friesen, R. K.

    2016-01-01

    We present new measurements of the dust emissivity index, beta, for the high-mass, star-forming OMC 2/3 filament. We combine 160-500 um data from Herschel with long-wavelength observations at 2 mm and fit the spectral energy distributions across a ~ 2 pc long, continuous section of OMC 2/3 at 15000 AU (0.08 pc) resolution. With these data, we measure beta and reconstruct simultaneously the filtered-out large-scale emission at 2 mm. We implement both variable and fixed values of beta, finding ...

  8. Dense Axion Stars

    Science.gov (United States)

    Mohapatra, Abhishek; Braaten, Eric; Zhang, Hong

    2016-03-01

    If the dark matter consists of axions, gravity can cause them to coalesce into axion stars, which are stable gravitationally bound Bose-Einstein condensates of axions. In the previously known axion stars, gravity and the attractive force between pairs of axions are balanced by the kinetic pressure. If the axion mass energy is mc2 =10-4 eV, these dilute axion stars have a maximum mass of about 10-14M⊙ . We point out that there are also dense axion stars in which gravity is balanced by the mean-field pressure of the axion condensate. We study axion stars using the leading term in a systematically improvable approximation to the effective potential of the nonrelativistic effective field theory for axions. Using the Thomas-Fermi approximation in which the kinetic pressure is neglected, we find a sequence of new branches of axion stars in which gravity is balanced by the mean-field interaction energy of the axion condensate. If mc2 =10-4 4 eV, the first branch of these dense axion stars has mass ranging from about 10-11M⊙ toabout M⊙.

  9. Dense Axion Stars

    CERN Document Server

    Braaten, Eric; Zhang, Hong

    2015-01-01

    If the dark matter consists of axions, gravity can cause them to coalesce into axion stars, which are stable gravitationally bound Bose-Einstein condensates of axions. In the previously known axion stars, gravity and the attractive force between pairs of axions are balanced by the kinetic pressure.If the axion mass energy is $mc^2= 10^{-4}$ eV, these dilute axion stars have a maximum mass of about $10^{-14} M_\\odot$. We point out that there are also dense axion stars in which gravity is balanced by the mean-field pressure of the axion condensate. We study axion stars using the leading term in a systematically improvable approximation to the effective potential of the nonrelativistic effective field theory for axions. Using the Thomas-Fermi approximation in which the kinetic pressure is neglected, we find a sequence of new branches of axion stars in which gravity is balanced by the mean-field interaction energy of the axion condensate. If $mc^2 = 10^{-4}$ eV, the first branch of these dense axion stars has mas...

  10. Symbiotic Stars in X-rays

    Science.gov (United States)

    Luna, G. J. M.; Sokoloski, J. L.; Mukai, K.; Nelson, T.

    2014-01-01

    Until recently, symbiotic binary systems in which a white dwarf accretes from a red giant were thought to be mainly a soft X-ray population. Here we describe the detection with the X-ray Telescope (XRT) on the Swift satellite of 9 white dwarf symbiotics that were not previously known to be X-ray sources and one that was previously detected as a supersoft X-ray source. The 9 new X-ray detections were the result of a survey of 41 symbiotic stars, and they increase the number of symbiotic stars known to be X-ray sources by approximately 30%. Swift/XRT detected all of the new X-ray sources at energies greater than 2 keV. Their X-ray spectra are consistent with thermal emission and fall naturally into three distinct groups. The first group contains those sources with a single, highly absorbed hard component, which we identify as probably coming from an accretion-disk boundary layer. The second group is composed of those sources with a single, soft X-ray spectral component, which likely arises in a region where low-velocity shocks produce X-ray emission, i.e. a colliding-wind region. The third group consists of those sources with both hard and soft X-ray spectral components. We also find that unlike in the optical, where rapid, stochastic brightness variations from the accretion disk typically are not seen, detectable UV flickering is a common property of symbiotic stars. Supporting our physical interpretation of the two X-ray spectral components, simultaneous Swift UV photometry shows that symbiotic stars with harder X-ray emission tend to have stronger UV flickering, which is usually associated with accretion through a disk. To place these new observations in the context of previous work on X-ray emission from symbiotic stars, we modified and extended the alpha/beta/gamma classification scheme for symbiotic-star X-ray spectra that was introduced by Muerset et al. based upon observations with the ROSAT satellite, to include a new sigma classification for sources with

  11. Exocomet signatures around the A-shell star $\\Phi$ Leo?

    CERN Document Server

    Eiroa, C; Montesinos, B; Villaver, E; Absil, O; Henning, Th; Bayo, A; Canovas, H; Carmona, A; Chen, Ch; Ertel, S; Iglesias, D P; Launhardt, R; Maldonado, J; Meeus, G; Moór, A; Mora, A; Mustill, A J; Olofsson, J; Rauw, G; Riviere-Marichalar, P; Roberge, A

    2016-01-01

    We present an intensive monitoring of high-resolution spectra of the Ca {\\sc ii} K line in the A7IV shell star $\\Phi$ Leo at very short (minutes, hours), short (night to night), and medium term (weeks, months) timescales. The spectra show remarkable variable absorptions on timescales of hours, days and months. The characteristics of these sporadic events are very similar to most of the ones observed towards the debris disk host star $\\beta$ Pic, which are usually interpreted as signs of the evaporation of solid, comet-like bodies grazing or falling onto the star. Therefore, our results suggest the presence of solid bodies around $\\Phi$ Leo. To our knowledge, with the exception of $\\beta$ Pic, our monitoring is the one with the best time resolution at the mentioned timescales done on a star with events attributed to exocomets. Assuming the cometary scenario, and considering the timescales of our monitoring, our results point to $\\Phi$ Leo presenting the richest environment with comet-like events yet known, sec...

  12. Utilizing Synthetic Spectra to Refine Lambda Boo Stars' UV Classification Criteria

    Science.gov (United States)

    Cheng, Kwang-Ping; Neff, James E.; Johnson, Dustin; Tarbell, Erik; Romo, Christopher; Steele, Patricia; Gray, Richard O.; Corbally, Christopher J.

    2016-01-01

    Lambda Boo-type stars are a group of late B to early F-type Population I dwarfs that show deficiencies of iron-peak elements (up to 2 dex), but their C, N, O, and S abundances are near solar. This stellar class has recently regained the spotlight because of the directly-imaged planets around a confirmed Lambda Boo star, HR 8799, and a suggested Lambda Boo star Beta Pictoris. The discovery of a giant asteroid belt around Vega, another possible Lambda Boo star, also suggests hidden planets. This possible link between Lambda Boo stars and planet-bearing stars motivates us to study Lambda Boo stars systematically. Since the peculiar nature of the prototype Lambda Bootis was first noticed in 1943, Lambda Boo candidates published in the literature have been selected using widely different criteria. The Lambda Boo label has been applied to almost any peculiar A-type stars that do not fit elsewhere. In order to determine the origin of Lambda Boo stars' unique abundance pattern and to better discriminate between theories explaining the Lambda Boo phenomenon, a consistent working definition of Lambda Boo stars is needed. We have re-evaluated all published Lambda Boo candidates and their available ultraviolet and visible spectra. Using observed and synthetic spectra, we explored the classification of Lambda Boo stars and developed quantitative criteria that discriminate metal-poor stars from bona fide Lambda Boo stars. With model spectra, we demonstrated that the (C I 1657 Angstrom)/ (Al II 1671 Angstrom) line ratio is the best single criterion to distinguish between Lambda Boo stars and metal weak stars, and that one cannot use a single C I/Al II cut-off value as a Lambda Boo classification criterion. The C I/Al II cut-off value is a function of a star's effective temperature and metallicity. Using these stricter Lambda Boo classification criteria, we concluded that neither Beta Pictoris nor Vega should be classified as Lambda Boo stars.

  13. A Novel Approach for Star Extraction from Star Image

    Institute of Scientific and Technical Information of China (English)

    ZHENGSheng; LIUJian; TIANJinwen; YANGRuijuan

    2005-01-01

    Star acquisition is one of the most timeconsuming routines in star tracker operation. One star Point spread function (PSF) forms a near Gaussian distribution in the star image, the star image can be regarded as 2-D intensity surface, and every pixel is the sampled point. The star cluster grouping is to find the highes tintensity pixel among the PSFs and collect the adjacent pixels and group them. The possible highest intensity pixels are the maximum extremum points of the 2-D intensity surface. To efficiently extract star from the star image, a novel star acquisition approach, which uses the simplified least squares support vector machines regression algorithm to find the optimal intensity surface function and predictthe maximum extremum points, is proposed. Comput erexperiments are carried out for the simulated star images.The experimental results demonstrate that the proposed method has a lot of advantages, including the high efficiency and good robustness over a wide range of sensor noise.

  14. Thermal evolution of neutron stars with decaying magnetic fields

    International Nuclear Information System (INIS)

    Rotochemical heating originates in the deviation from beta equilibrium due to spin-down compression, which is closely related to the dipole magnetic field. We numerically calculate the deviation from chemical equilibrium and thermal evolution of neutron stars with decaying magnetic fields. We find that the power-law long term decay of the magnetic field slightly affects the deviation from chemical equilibrium and surface temperature. However, the magnetic decay leads to older neutron stars that could have a different surface temperature with the same magnetic field strength. That is, older neutron stars with a low magnetic field (108 G) could have a lower temperature even with rotochemical heating in operation, which probably explains the lack of other observations on older millisecond pulsars with higher surface temperature, except millisecond pulsar J0437–4715. (paper)

  15. Physical parameters of three field RR Lyrae stars

    CERN Document Server

    Ferro, A Arellano; Jaimes, R Figuera

    2012-01-01

    Str\\"omgren $uvby-\\beta$ photometry of the stars classified as RR Lyrae stars RU Piscium, SS Piscium and TU Ursae Majoris has been used to estimate their iron abundance, temperature, gravity and absolute magnitude. The stability of the pulsating period is discussed. The nature of SS Psc as a RRc or a HADS is addressed. The reddening of each star is estimated from the Str\\"omgren colour indices and reddening sky maps. The results of three approaches to the determination of [Fe/H], $T_{\\rm eff}$ and $\\log(g)$ are discussed: Fourier light curve decomposition, the Preston $\\Delta S$ index and the theoretical grids on the $(b-y)_o - c_1{_o}$ plane.

  16. The relevance of ambipolar diffusion for neutron star evolution

    CERN Document Server

    Passamonti, Andrea; Pons, José A; Miralles, Juan A

    2016-01-01

    We study ambipolar diffusion in strongly magnetised neutron stars, with special focus on the effects of neutrino reaction rates and the impact of a superfluid/superconducting transition in the neutron star core. For axisymmetric magnetic field configurations, we determine the deviation from $\\beta-$equilibrium induced by the magnetic force and calculate the velocity of the slow, quasi-stationary, ambipolar drift. We study the temperature dependence of the velocity pattern and clearly identify the transition to a predominantly solenoidal flow. For stars without superconducting/superfluid constituents and with a mixed poloidal-toroidal magnetic field of typical magnetar strength, we find that ambipolar diffusion proceeds fast enough to have a significant impact on the magnetic field evolution only at low core temperatures, $T \\lesssim 1-2\\times10^8$ K. The ambipolar diffusion timescale becomes appreciably shorter when fast neutrino reactions are present, because the possibility to balance part of the magnetic f...

  17. The strong magnetic field of the large-amplitude beta Cephei pulsator V1449 Aql

    CERN Document Server

    Hubrig, S; Briquet, M; Schoeller, M; Gonzalez, J F; Nunez, N; De Cat, P; Morel, T

    2011-01-01

    Only for very few beta Cephei stars has the behaviour of the magnetic field been studied over the rotation cycle. During the past two years we have obtained multi-epoch polarimetric spectra of the beta Cephei star V1449 Aql with SOFIN at the Nordic Optical Telescope to search for a rotation period and to constrain the geometry of the magnetic field. The mean longitudinal magnetic field is measured at 13 different epochs. The new measurements, together with the previous FORS1 measurements, have been used for the frequency analysis and the characterization of the magnetic field. V1449 Aql so far possesses the strongest longitudinal magnetic field of up to 700G among the beta Cephei stars. The resulting periodogram displays three dominant peaks with the highest peak at f=0.0720d^-1 corresponding to a period P=13.893d. The magnetic field geometry can likely be described by a centred dipole with a polar magnetic field strength B_d around 3kG and an inclination angle beta of the magnetic axis to the rotation axis o...

  18. Vidicon star tracker.

    Science.gov (United States)

    Schuck, W H

    1966-04-01

    In many applications of star trackers, extremely short acquisition times, as well as accuracy and sensitivity, are required. Tracking systems employing the vidicon as a radiation sensor have been shown to provide the necessary speed of acquisition for such applications. This paper discusses the various theoretical and practical considerations involved in using the vidicon as a sensor in a star tracking system. A typical system configuration including telescope, sensor, and processing electronics is presented. The various optical and sensor parametric relationships required in the design of a vidicon star tracker are fully discussed and analyzed. PMID:20048884

  19. STARs in the CNS.

    Science.gov (United States)

    Ehrmann, Ingrid; Fort, Philippe; Elliott, David J

    2016-08-15

    STAR (signal transduction and activation of RNA) proteins regulate splicing of target genes that have roles in neural connectivity, survival and myelination in the vertebrate nervous system. These regulated splicing targets include mRNAs such as the Neurexins (Nrxn), SMN2 (survival of motor neuron) and MAG (myelin-associated glycoprotein). Recent work has made it possible to identify and validate STAR protein splicing targets in vivo by using genetically modified mouse models. In this review, we will discuss the importance of STAR protein splicing targets in the CNS (central nervous system). PMID:27528753

  20. Entropy Production of Stars

    Directory of Open Access Journals (Sweden)

    Leonid M. Martyushev

    2015-06-01

    Full Text Available The entropy production (inside the volume bounded by a photosphere of main-sequence stars, subgiants, giants, and supergiants is calculated based on B–V photometry data. A non-linear inverse relationship of thermodynamic fluxes and forces as well as an almost constant specific (per volume entropy production of main-sequence stars (for 95% of stars, this quantity lies within 0.5 to 2.2 of the corresponding solar magnitude is found. The obtained results are discussed from the perspective of known extreme principles related to entropy production.