
Sample records for antimony 117

  1. Antimony Toxicity

    Directory of Open Access Journals (Sweden)

    Shyam Sundar


    Full Text Available Antimony toxicity occurs either due to occupational exposure or during therapy. Occupational exposure may cause respiratory irritation, pneumoconiosis, antimony spots on the skin and gastrointestinal symptoms. In addition antimony trioxide is possibly carcinogenic to humans. Improvements in working conditions have remarkably decreased the incidence of antimony toxicity in the workplace. As a therapeutic, antimony has been mostly used for the treatment of leishmaniasis and schistosomiasis. The major toxic side-effects of antimonials as a result of therapy are cardiotoxicity (~9% of patients and pancreatitis, which is seen commonly in HIV and visceral leishmaniasis co-infections. Quality control of each batch of drugs produced and regular monitoring for toxicity is required when antimonials are used therapeutically.

  2. Pentavalent Antimonials: New Perspectives for Old Drugs


    Ribeiro, Raul R.; Cynthia Demicheli; Frédéric Frézard


    Pentavalent antimonials, including meglumine antimoniate and sodium stibogluconate, have been used for more than half a century in the therapy of the parasitic disease leishmaniasis. Even though antimonials are still the first-line drugs, they exhibit several limitations, including severe side effects, the need for daily parenteral administration and drug resistance. The molecular structure of antimonials, their metabolism and mechanism of action are still being investigated. Some recent stud...

  3. Pentavalent Antimonials: New Perspectives for Old Drugs

    Directory of Open Access Journals (Sweden)

    Raul R. Ribeiro


    Full Text Available Pentavalent antimonials, including meglumine antimoniate and sodium stibogluconate, have been used for more than half a century in the therapy of the parasitic disease leishmaniasis. Even though antimonials are still the first-line drugs, they exhibit several limitations, including severe side effects, the need for daily parenteral administration and drug resistance. The molecular structure of antimonials, their metabolism and mechanism of action are still being investigated. Some recent studies suggest that pentavalent antimony acts as a prodrug that is converted to active and more toxic trivalent antimony. Other works support the direct involvement of pentavalent antimony. Recent data suggest that the biomolecules, thiols and ribonucleosides, may mediate the actions of these drugs. This review will summarize the progress to date on the chemistry and biochemistry of pentavalent antimony. It will also present the most recent works being done to improve antimonial chemotherapy. These works include the development of simple synthetic methods for pentavalent antimonials, liposome-based formulations for targeting the Leishmania parasites responsible for visceral leishmaniasis and cyclodextrin-based formulations to promote the oral delivery of antimony.

  4. Nuclear data for the cyclotron production of 117Sb and 90Nb

    International Nuclear Information System (INIS)

    This presented study is to make comparison of cross sections to produce 117Sb and 90Nb via different reactions with particle incident energy up to 70 MeV as a part of systematic studies on particle-induced activations on enriched Sn, Y2O3 and ZrO2 targets, theoretical calculation of production yield, calculation of required thickness of target and suggestion of optimum reaction to produce Antimony-117 and Niobium-90. (authors)


    Directory of Open Access Journals (Sweden)

    Cláudia Maria Valete-Rosalino


    Full Text Available Introduction: Pentavalent antimonials are the first drug of choice in the treatment of tegumentary leishmaniasis. Data on ototoxicity related with such drugs is scarcely available in literature, leading us to develop a study on cochleovestibular functions. Case Report: A case of a tegumentary leishmaniasis patient, a 78-year-old man who presented a substantial increase in auditory threshold with tinnitus and severe rotatory dizziness during the treatment with meglumine antimoniate, is reported. These symptoms worsened in two weeks after treatment was interrupted. Conclusion: Dizziness and tinnitus had already been related to meglumine antimoniate. However, this is the first well documented case of cochlear-vestibular toxicity related to meglumine antimoniate.

  6. Preparation and properties of antimony thin film anode materials

    Institute of Scientific and Technical Information of China (English)

    SU Shufa; CAO Gaoshao; ZHAO Xinbing


    Metallic antimony thin films were deposited by magnetron sputtering and electrodeposition. Electrochemical properties of the thin film as anode materials for lithium-ion batteries were investigated and compared with those of antimony powder. It was found that both magnetron sputtering and electrodeposition are easily controllable processes to deposit antimony films with fiat charge/discharge potential plateaus. The electrochemical performances of antimony thin films, especially those prepared with magnetron sputtering, are better than those of antimony powder. The reversible capacities of the magnetron sputtered antimony thin film are above 400 mA h g-1 in the first 15 cycles.

  7. 21 CFR 862.3110 - Antimony test system. (United States)


    ... antimony, a heavy metal, in urine, blood, vomitus, and stomach contents. Measurements obtained by this device are used in the diagnosis and treatment of antimony poisoning. (b) Classification. Class I....

  8. Perspectives of antimony compounds in oncology

    Institute of Scientific and Technical Information of China (English)

    Pankaj SHARMA; Diego PEREZ; Armando CABRERA; Nee ROSAS; Jose Luis ARIAS


    Antimony, a natural element that has been used as a drug for over more than 100 years, has remarkable therapeutic efficacy in patients with acute promyelocytic leukemia. This review focuses on recent advances in developing antimony anti- cancer agents with an emphasis on antimony coordination complexes, Sb (Ⅲ) and Sb (V). These complexes, which include many organometallic complexes, may provide a broader spectrum of antitumoral activity. They were compared with classical platinum anticancer drugs. The review covers the literature data pub- lished up to 2007. A number of antimonials with different antitumoral activities are known and have diverse applications, even though little research has been done on their possibilities. It might be feasible to develop more specific and effective inhibitors for phosphatase-targeted, anticancer therapeutics through the screen- ing of sodium stibogluconate (SSG) and potassium antimonyltartrate-related compounds, which are comprised of antimony conjugated to different organic moieties. For example, SSG appears to be a better inhibitor than suramin which is a compound known for its antineoplastic activity against several types of cancers.

  9. Infrared surface polaritons on antimony. (United States)

    Cleary, Justin W; Medhi, Gautam; Shahzad, Monas; Rezadad, Imen; Maukonen, Doug; Peale, Robert E; Boreman, Glenn D; Wentzell, Sandy; Buchwald, Walter R


    The semimetal antimony, with a plasma frequency ~80 times less than that of gold, is potentially useful as a host for infrared surface polaritons (SPs). Relevant IR SP properties, including the frequency-dependent propagation length and penetration depths for fields into the media on either side of the interface, were determined from optical constants measured on optically-thick thermally-evaporated Sb films over the wavelength range 1 to 40 μm. Plasma and carrier relaxation frequencies were determined from Drude-model fits to these data. The real part of the permittivity is negative for wavelengths beyond 11 μm. Distinct resonant decreases in specular reflected intensity were observed for Sb lamellar gratings in the wavelength range of 6 to 11 μm, where the real part of the permittivity is positive. Both resonance angles and the angular reflectance spectral line shapes are in agreement with theory for excitation of bound surface electromagnetic waves (SPs). Finite element method (FEM) electrodynamic simulations indicate the existence of SP modes under conditions matching the experiments. FEM results also show that such waves depend on having a significant imaginary part of the permittivity, as has been noted earlier for the case of surface exciton polaritons.

  10. Synthesis and application of antimony pent(isooctyl thioglycollate)

    Institute of Scientific and Technical Information of China (English)

    LIU You-nian; LI Hong-bing; SHU Wan-gen; CHEN Qi-yuan


    A new type of thermal stabilizer, antimony pent(isooctyl thioglycollate)(Sb(SCH2COOC8H17)5), was synthesized by using antimony trioxide, isooctanol and thioglycolic acid in 2 steps. Firstly, antimony trioxide was oxidized into colloidal antimony peroxide. Then antimony peroxide and isooctyl thioglycollate reacted stoichiometrically for 2 h with the yield of 87%. This compound was used as thermal stabilizer for polyvinyl chloride(PVC). The results show that the thermal stability time is 52 min at 200 ℃ by heat-ageing oven test when adding 2.5% thermal stabilizer to PVC resin. Compared with antimony tris(isooctyl thiolycollate), the initial thermal stability of antimony pent(isooctyl thioglycollate) is better than that of antimony tris(isooctyl thioglycollate), while the long-term thermal stability time is shorter than that of antimony tris(isooctyl thioglycollate). Meanwhile, the synergism of antimony pent(isooctyl thioglycollate) with calcium stearate was studied, indicating that when the mass ratio of antimony pent(isooctyl thioglycollate) to calcium stearate is 2:1, the thermal stability time of PVC is 58 min.

  11. Vacuum Evaporation Technology for Treating Antimony-Rich Anode Slime (United States)

    Qiu, Keqiang; Lin, Deqiang; Yang, Xuelin


    A vacuum evaporation technology for treating antimony-rich anode slime was developed in this work. Experiments were carried out at temperatures from 873 K to 1073 K and residual gas pressures from 50 Pa to 600 Pa. During vacuum evaporation, silver from the antimony-rich anode slime was left behind in the distilland in a silver alloy containing antimony and lead, and antimony trioxide was evaporated. The experimental results showed that 92% by weight of antimony can be removed, and the silver content in the alloy was up to 12.84%. The antimony trioxide content in the distillate was more than 99.7%, and the distillate can be used directly as zero-grade antimony trioxide (China standard).

  12. Microbial antimony biogeochemistry: Enzymes, regulation, and related metabolic pathways (United States)

    Li, Jingxin; Qian Wang,; Oremland, Ronald S.; Kulp, Thomas R.; Rensing, Christopher; Wang, Gejiao


    Antimony (Sb) is a toxic metalloid that occurs widely at trace concentrations in soil, aquatic systems, and the atmosphere. Nowadays, with the development of its new industrial applications and the corresponding expansion of antimony mining activities, the phenomenon of antimony pollution has become an increasingly serious concern. In recent years, research interest in Sb has been growing and reflects a fundamental scientific concern regarding Sb in the environment. In this review, we summarize the recent research on bacterial antimony transformations, especially those regarding antimony uptake, efflux, antimonite oxidation, and antimonate reduction. We conclude that our current understanding of antimony biochemistry and biogeochemistry is roughly equivalent to where that of arsenic was some 20 years ago. This portends the possibility of future discoveries with regard to the ability of microorganisms to conserve energy for their growth from antimony redox reactions and the isolation of new species of “antimonotrophs.”

  13. Arsenic and antimony transporters in eukaryotes. (United States)

    Maciaszczyk-Dziubinska, Ewa; Wawrzycka, Donata; Wysocki, Robert


    Arsenic and antimony are toxic metalloids, naturally present in the environment and all organisms have developed pathways for their detoxification. The most effective metalloid tolerance systems in eukaryotes include downregulation of metalloid uptake, efflux out of the cell, and complexation with phytochelatin or glutathione followed by sequestration into the vacuole. Understanding of arsenic and antimony transport system is of high importance due to the increasing usage of arsenic-based drugs in the treatment of certain types of cancer and diseases caused by protozoan parasites as well as for the development of bio- and phytoremediation strategies for metalloid polluted areas. However, in contrast to prokaryotes, the knowledge about specific transporters of arsenic and antimony and the mechanisms of metalloid transport in eukaryotes has been very limited for a long time. Here, we review the recent advances in understanding of arsenic and antimony transport pathways in eukaryotes, including a dual role of aquaglyceroporins in uptake and efflux of metalloids, elucidation of arsenic transport mechanism by the yeast Acr3 transporter and its role in arsenic hyperaccumulation in ferns, identification of vacuolar transporters of arsenic-phytochelatin complexes in plants and forms of arsenic substrates recognized by mammalian ABC transporters.

  14. In vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta Etel Treiger; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Lab. de Biologia Molecular]. E-mail:; Osso Junior, Joao Alberto [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), SP (Brazil). Centro de Radiofarmacia]. E-mail:; Andrade Junior, Heitor Franco de [Instituto de Medicina Tropical de Sao Paulo (IMT-SP), SP (Brazil). Lab. de Protozoologia].


    Pentavalent antimony, as meglumine antimoniate (Glucantime) or sodium stibogluconate (Pentostam), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes {sup 122} Sb and {sup 124} Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology. (author)

  15. In Vitro antileishmanial properties of neutron-irradiated meglumine antimoniate


    Samanta Etel Treiger Borborema; Heitor Franco de Andrade Junior; João Alberto Osso Junior; Nanci do Nascimento


    Pentavalent antimony, as meglumine antimoniate (Glucantime® ) or sodium stibogluconate (Pentostam® ), is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer...

  16. Pharmacokinetic of antimony in mice with cutaneous Leishmaniasis

    Energy Technology Data Exchange (ETDEWEB)

    Borborema, Samanta E.T.; Nascimento, Nanci do [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular]. E-mails:;; Andrade Junior, Heitor F. de [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Lab. de Biologia Molecular; Instituto de Medicina Tropical de Sao Paulo, Sao Paulo, SP (Brazil); E-mail:; Osso Junior, Joao A. [Instituto de Pesquisas Energeticas e Nucleares IPEN/CNEN-SP, Sao Paulo, SP (Brazil). Centro de Radiofarmacia]. E-mail:


    Cutaneous Leishmaniasis (CL) remains a major world health problem, with about 1.5 million new cases each year. Caused by protozoa Leishmania, in South America, this infection can vary from a chronic skin ulcer, to an erosive mucosal disease and severe facial disfigurement. Pentavalent antimony (Sb{sup +5}) as sodium stibogluconate (Pentostam) or meglumine antimoniate (Glucantime) are main drugs for treating most forms of human leishmaniasis. For six decades, despite the recent developments, the effective therapy to cutaneous leishmaniasis has been based on long parenteral courses of such drugs, even though these are fairly costly, toxic and inconvenient to use, without adequate knowledge on their pharmacokinetics or mechanism of action. Pharmacokinetics studies could be based on bioactive traceable drugs, usually with radioactive isotopes, but antimony radioisotopes are unavailable commercially. Neutron irradiation is a powerful tool in the analysis of mineral content of samples, for antimony, there are at least two main isotopes that could be formed after neutron irradiation in nuclear reactor. The aim of the present study was to construct antimony salts with those radioisotopes to obtain tracers to compare the pharmacokinetic and the tissue distribution of neutron irradiated meglumine antimoniate in healthy and cutaneous leishmaniasis experimentally infected mice. Meglumine antimoniate, (Glucantime, Aventis, S.P, Brazil), was neutron irradiated inside the IEA-R1 nuclear reactor (IPEN/CNEN-SP), producing two radioisotopes {sup 122}Sb and {sup 124}Sb. Its biodistribution was verified in BALB/c mice experimentally infected with Leishmania (Leishmania) Amazonensis, which received a single intraperitoneal dose of the drug. At different times after injection, the tissues and blood were excised and activity measured in a NaI (Tl) scintillation counter. Compared with the healthy mice, experimentally infected mice had significantly lower maximum concentration of antimony

  17. Separation of traffic related antimony compounds

    International Nuclear Information System (INIS)

    Complete text of publication follows. It is known that most of the brake pads contain Sb2S3 as lubricant to achieve better friction stability. Due to braking the brake lining crumbles away and its Sb content gets into the air. As a result of the temperature increase accompanying the braking a part of the antimony may oxidize to oxides, as Sb2O3 or even to the more stable form, Sb2O4. Since Sb2O3 more readily soluble than the others, its absorption from the lung so its environmental impact effect is more harmful. After a systematic investigation involving solubilization of the solid compounds, citric and tartaric acid as well as 6 mol/dm3 HCl were tested for leaching of trace antimony compounds from natural matrix. To prepare reference material related to these species, soil and activated charcoal was spiked in 10 μg/g concentration with all the three material (Sb2S3, Sb2O3,Sb2O4). separately. Recovery of the different forms was checked by graphite furnace atomic absorption spectrometric (GFAAS) analysis of the leachates. The soil was confirmed to oxidize the sulfide content while the activated charcoal was established to enrich antimony from HCl solution as ion association complex. It was concluded, that Sb2S3 is leached only in slight amount in 4 hours by 0.1-0.5 mol/dm3 citric acid, while leaching of Sb2O3 is quantitative. On the other side, it was proved that Sb2O3 as well as Sb2S3 traces are soluble in 6 HCl solution in 60 min, whilst Sb2O4 is not destroyed. So, the Sb2O3 and Sb2S3 content of a flying dust can be determined. The GFAAS temperature program had to be modified in order to be capable to analyze high organic matrix as citric or tartaric acid even in 0.5 mol/dm3 concentration. Concerning their decomposition temperature an additional step was inserted into the temperature program, pyrolysis on 300 and 400 deg C, respectively. The antimony concentration of the highly acidic leachates were determined by hydride generation GFAAS. The reproducibility of

  18. Selective determination of antimony(III) and antimony(V) with ammonium pyrrolidinedithiocarbamate, sodium diethyldithiocarbamate and dithizone by atomic-absorption spectrometry with a carbon-tube atomizer. (United States)

    Kamada, T; Yamamoto, Y


    The extraction behaviour of antimony(III) and antimony(V) with ammonium pyrrolidinedithiocarbamate, sodium diethyldithiocarbamate and dithizone in organic solvents has been investigated by means of frameless atomic-absorption spectrophotometry with a carbon-tube atomizer. The selective extraction of antimony(III) and differential determination of antimony(III) and antimony(V) have been developed. With ammonium pyrrolidinedithiocarbamate and methyl isobutyl ketone, when the aqueous phase/solvent volume ratio is 50 ml/10 ml and the injection volume in the carbon tube is 20 mul, the sensitivity for antimony is 0.2 ng/ml for 1% absorption. The relative standard deviations are ca. 2%. Interferences by many metal ions can be prevented by masking with EDTA. The proposed methods have been applied satisfactorily to determination of antimony(III) and antimony(V) in various types of water. PMID:18962096

  19. Structural and electrical characterization of zinc oxide doped with antimony

    Directory of Open Access Journals (Sweden)

    G. Juárez Díaz


    Full Text Available In this work we report the results of structural and electrical characterization realized on zinc oxide single crystal samples with (001 orientation, which were doped with antimony. Doping was carried out by antimony thermal diffusion at 1000 °C for periods of 1 and 2 hours under nitrogen environment from a solid source formed by antimony oxide. Electrical characterization by I-V curves and Hall effect shown an increase in acceptor concentration which demonstrates that doping is effective and create holes in zinc oxide samples.

  20. Deposition of rod-shaped antimony sulfide thin films from single-source antimony thiosemicarbazone precursors

    Energy Technology Data Exchange (ETDEWEB)

    Biswal, Jasmine B.; Sawant, Narayan V. [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai - 400 098 (India); Garje, Shivram S., E-mail: [Department of Chemistry, University of Mumbai, Vidyanagari, Santacruz (East), Mumbai - 400 098 (India)


    Antimony sulfide thin films were deposited on glass substrates by aerosol assisted chemical vapour deposition technique using single source precursors, namely, antimony(III) thiosemicarbazones, SbCl{sub 3}(L) (L = thiosemicarbazones of thiophene-2-carboxaldehyde (1) and cinnamaldehyde (2)). The deposited films were characterized by X-ray diffraction, scanning electron microscopy, energy dispersive X-ray analysis and UV-visible spectroscopy in order to identify their phases, morphologies, compositions and optical properties respectively. These characterizations revealed that the films were comprised of rod-shaped particles of orthorhombic stibnite (Sb{sub 2}S{sub 3}) with a Sb:S stoichiometry of {approx} 1:1.3. The calculated optical band gap from UV-vis absorption spectrum is found to be 3.48 eV.

  1. Tissue distribution of residual antimony in rats treated with multiple doses of meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Deise Riba Coelho


    Full Text Available Meglumine antimoniate (MA and sodium stibogluconate are pentavalent antimony (SbV drugs used since the mid-1940s. Notwithstanding the fact that they are first-choice drugs for the treatment of leishmaniases, there are gaps in our knowledge of their toxicological profile, mode of action and kinetics. Little is known about the distribution of antimony in tissues after SbV administration. In this study, we evaluated the Sb content of tissues from male rats 24 h and three weeks after a 21-day course of treatment with MA (300 mg SbV/kg body wt/d, subcutaneous. Sb concentrations in the blood and organs were determined by inductively coupled plasma-mass spectrometry. In rats, as with in humans, the Sb blood levels after MA dosing can be described by a two-compartment model with a fast (t1/2 = 0.6 h and a slow (t1/2 >> 24 h elimination phase. The spleen was the organ that accumulated the highest amount of Sb, while bone and thyroid ranked second in descending order of tissues according to Sb levels (spleen >> bone, thyroid, kidneys > liver, epididymis, lungs, adrenals > prostate > thymus, pancreas, heart, small intestines > skeletal muscle, testes, stomach > brain. The pathophysiological consequences of Sb accumulation in the thyroid and Sb speciation in the liver, thyroid, spleen and bone warrant further studies.

  2. How can we adapt to geological scarcity of antimony? Investigation of antimony's substitutability and of other measures to achieve a sustainable use

    NARCIS (Netherlands)

    Henckens, M.L.C.M.; Driessen, P.P.J.; Worrell, E.


    Abstract Antimony is an element that is applied in many useful applications for mankind. However, antimony resources are very scarce, when comparing the current extraction rates with the availability of antimony containing ores. From an inter-temporal sustainability perspective, current generations

  3. Cloud point extraction combined with electrothermal atomic absorption spectrometry for the speciation of antimony(III) and antimony(V) in food packaging materials

    International Nuclear Information System (INIS)

    A simple, sensitive method for the speciation of inorganic antimony by cloud point extraction combined with electrothermal atomic absorption spectrometry (ETAAS) is presented and evaluated. The method based on the fact that formation of a hydrophobic complex of antimony(III) with ammonium pyrrolidine dithiocarbamate (APDC) at pH 5.0 and subsequently the hydrophobic complex enter into surfactant-rich phase, whereas antimony(V) remained in aqueous solutions. Antimony(III) in surfactant-rich phase was analyzed by ETAAS after dilution by 0.2 mL nitric acid in methanol (0.1 M), and antimony(V) was calculated by subtracting antimony(III) from the total antimony after reducing antimony(V) to antimony(III) by L-cysteine. The main factors affecting the cloud point extraction, such as pH, concentration of APDC and Triton X-114, equilibrium temperature and incubation time, sample volume were investigated in detail. Under the optimum conditions, the detection limit (3σ) of the proposed method was 0.02 ng mL-1 for antimony(III), and the relative standard deviation was 7.8% (c = 1.0 ng mL-1, n = 7). The proposed method was successfully applied to speciation of inorganic antimony in the leaching solutions of different food packaging materials with satisfactory results.

  4. Cloud point extraction combined with electrothermal atomic absorption spectrometry for the speciation of antimony(III) and antimony(V) in food packaging materials. (United States)

    Jiang, Xiuming; Wen, Shengping; Xiang, Guoqiang


    A simple, sensitive method for the speciation of inorganic antimony by cloud point extraction combined with electrothermal atomic absorption spectrometry (ETAAS) is presented and evaluated. The method based on the fact that formation of a hydrophobic complex of antimony(III) with ammonium pyrrolidine dithiocarbamate (APDC) at pH 5.0 and subsequently the hydrophobic complex enter into surfactant-rich phase, whereas antimony(V) remained in aqueous solutions. Antimony(III) in surfactant-rich phase was analyzed by ETAAS after dilution by 0.2 mL nitric acid in methanol (0.1M), and antimony(V) was calculated by subtracting antimony(III) from the total antimony after reducing antimony(V) to antimony(III) by l-cysteine. The main factors affecting the cloud point extraction, such as pH, concentration of APDC and Triton X-114, equilibrium temperature and incubation time, sample volume were investigated in detail. Under the optimum conditions, the detection limit (3 sigma) of the proposed method was 0.02 ng mL(-1) for antimony(III), and the relative standard deviation was 7.8% (c=1.0 ng mL(-1), n=7). The proposed method was successfully applied to speciation of inorganic antimony in the leaching solutions of different food packaging materials with satisfactory results. PMID:19853991

  5. Cloud point extraction combined with electrothermal atomic absorption spectrometry for the speciation of antimony(III) and antimony(V) in food packaging materials

    Energy Technology Data Exchange (ETDEWEB)

    Jiang Xiuming; Wen Shengping [School of Chemistry and Chemical Engineering, Henan University of Technology, South Song Shan Road No. 140, Zhengzhou City 450001 (China); Xiang Guoqiang, E-mail: [School of Chemistry and Chemical Engineering, Henan University of Technology, South Song Shan Road No. 140, Zhengzhou City 450001 (China)


    A simple, sensitive method for the speciation of inorganic antimony by cloud point extraction combined with electrothermal atomic absorption spectrometry (ETAAS) is presented and evaluated. The method based on the fact that formation of a hydrophobic complex of antimony(III) with ammonium pyrrolidine dithiocarbamate (APDC) at pH 5.0 and subsequently the hydrophobic complex enter into surfactant-rich phase, whereas antimony(V) remained in aqueous solutions. Antimony(III) in surfactant-rich phase was analyzed by ETAAS after dilution by 0.2 mL nitric acid in methanol (0.1 M), and antimony(V) was calculated by subtracting antimony(III) from the total antimony after reducing antimony(V) to antimony(III) by L-cysteine. The main factors affecting the cloud point extraction, such as pH, concentration of APDC and Triton X-114, equilibrium temperature and incubation time, sample volume were investigated in detail. Under the optimum conditions, the detection limit (3{sigma}) of the proposed method was 0.02 ng mL{sup -1} for antimony(III), and the relative standard deviation was 7.8% (c = 1.0 ng mL{sup -1}, n = 7). The proposed method was successfully applied to speciation of inorganic antimony in the leaching solutions of different food packaging materials with satisfactory results.

  6. Heat-treated Saccharomyces cerevisiae for antimony speciation and antimony(III) preconcentration in water samples

    International Nuclear Information System (INIS)

    An analytical method was developed for antimony speciation and antimony(III) preconcentration in water samples. The method is based on the selective retention of Sb(III) by modified Saccharomyces cerevisiae in the presence of Sb(V). Heat, caustic and solvent pretreatments of the biomass were investigated to improve the kinetics and thermodynamics of Sb(III) uptake process at room temperature. Heating for 30 min at 80 deg. C was defined as the optimal treatment. Antimony accumulation by the cells was independent of pH (5-10) and ionic strength (0.01-0.1 mol L-1). 140 mg of yeast and 2 h of contact were necessary to ensure quantitative sequestration of Sb(III) up to 750 μg L-1. In these conditions, Sb(V) was not retained. Sb(V) was quantified in sorption supernatant by inductively coupled plasma mass spectrometry (ICP-MS) or inductively coupled plasma optical emission spectrometry (ICP-OES). Sb(III) was determined after elution with 40 mmol L-1 thioglycolic acid at pH 10. A preconcentration factor close to nine was achieved for Sb(III) when 100 mL of sample was processed. After preconcentration, the detection limits for Sb(III) and Sb(V) were 2 and 5 ng L-1, respectively, using ICP-MS, 7 and 0.9 μg L-1 using ICP-OES. The proposed method was successfully applied to the determination of Sb(III) and Sb(V) in spiked river and mineral water samples. The relative standard deviations (n = 3) were in the 2-5% range at the tenth μg L-1 level and less than 10% at the lowest Sb(III) and Sb(V) tested concentration (0.1 μg L-1). Corrected recoveries were in all cases close to 100%

  7. Noninferiority of Miltefosine Versus Meglumine Antimoniate for Cutaneous Leishmaniasis in Children


    Rubiano, Luisa Consuelo; Miranda, María Consuelo; Muvdi Arenas, Sandra; Montero, Luz Mery; Rodríguez-Barraquer, Isabel; Garcerant, Daniel; Prager, Martín; Osorio, Lyda; Rojas, Maria Ximena; Pérez, Mauricio; Nicholls, Ruben Santiago; Gore Saravia, Nancy


    Background. Children have a lower response rate to antimonial drugs and higher elimination rate of antimony (Sb) than adults. Oral miltefosine has not been evaluated for pediatric cutaneous leishmaniasis.

  8. 33 CFR 117.403 - Wabash River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Wabash River. 117.403 Section 117.403 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Indiana § 117.403 Wabash River. See § 117.397, Wabash...

  9. The influence of pet containers on antimony concentration in bottled drinking water


    Perić-Grujić Aleksandra A.; Radmanovac Aleksandar R.; Stojanov Aleksander M.; Pocajt Viktor V.; Ristić Mirjana Đ.


    Antimony trioxide (Sb2O3) is the most frequently used catalyst in the polyethylene terephthalate (PET) manufacture. As a result, antimony is incorporated into PET bottles at concentration level of 100-300 mg/kg. PET containers are used for drinking water and beverages, as well as food packaging and in the pharmaceutical industry. Thus, it is important to understand the factors that may influence the release of antimony from the catalysts into water and other products, since antimony is potent...

  10. The influence of pet containers on antimony concentration in bottled drinking water

    Directory of Open Access Journals (Sweden)

    Perić-Grujić Aleksandra A.


    Full Text Available Antimony trioxide (Sb2O3 is the most frequently used catalyst in the polyethylene terephthalate (PET manufacture. As a result, antimony is incorporated into PET bottles at concentration level of 100-300 mg/kg. PET containers are used for drinking water and beverages, as well as food packaging and in the pharmaceutical industry. Thus, it is important to understand the factors that may influence the release of antimony from the catalysts into water and other products, since antimony is potentially toxic trace element. In this paper, the antimony content in nine brands of bottled mineral and spring water from Serbia, and seven brands of bottled mineral and spring water from EU countries was analyzed. The measurements were conducted using the inductively coupled plasma-mass spectrometry (ICP-MS technique. In the all examined samples the antimony concentration was bellow the maximum contaminant level of 5 μg/L prescribed by the Serbian and EU regulations. Comparison of the content of antimony in PET bottled waters with the content of antimony in water bottled commercially in glass and the natural content of antimony in pristine groundwaters, provides explicit evidence of antimony leaching from PET containers. Since waters bottled in PET have much greater concentration ratio of Sb to Pb than corresponding pristine groundwaters, it can be assumed that bottled waters cannot be used as the relavant source for the study of the natural antimony content in groundwaters. There is a clear relation between the quality of water in bottles (composition, ion strength and antimony leaching rate. Moreover, while the rate of antimony leaching is slow at temperatures below 60 oC, at the temperature range of 60-80 oC antimony release occurs and reaches maximum contaminant level rapidly. As antimony can cause both acute and chronic health problems, factors that promote the increase of antimony concentration should be avoided.

  11. Antimony Doped Tin Oxide Thin Films: Co Gas Sensor

    Directory of Open Access Journals (Sweden)

    P.S. Joshi


    Full Text Available Tin dioxide (SnO2 serves as an important base material in a variety of resistive type gas sensors. The widespread applicability of this semicoducting oxide is related both to its range of conductance variability and to the fact that it responds to both oxidising and reducing gases. The antimony doped tin-oxide films were prepared by spray pyrolysis method. The as-deposited films are blackish in colour. Addition of antimony impurity showed little increase in the thickness. The X-ray diffraction pattern shows characteristic tin oxide peaks with tetragonal structure. As the doping concentration of antimony was increased, new peak corresponding to Sb was observed. The intensity of this peak found to be increased when the Sb concentration was increased from 0.01 % to the 1 % which indicates the antimony was incorporated into the tin oxide. For gas sensing studies ohmic contacts were preferred to ensure the changes in resistance of sensor is due to only adsorption of gas molecule. The graph of I-V shows a straight line in nature which indicates the ohmic contact. The sensitivity of the sensor for CO gas was tested. The sensitivity of antimony doped tin oxide found to be increased with increasing Sb concentration. The maximum sensitivity was observed for Sb = 1 % at a working temperature of 250 °C.

  12. Behavior of arsenic impurity at antimony electric precipitation

    International Nuclear Information System (INIS)

    In the paper the arsenic impurity electrochemical behavior and it purification from antimony by electric precipitation out of fluoride solutions was studied. For this the arsenic sample with mass 0.003-0.006 g has been irradiated at the WWR-SM nuclear reactor during 3-5 hour in the thermal neutron flux 1013 n/cm2 s, after 24 h keeping the sample has being dissolved in the concentrated nitric acid, and then it has been evaporated several times with distillation water addition up to wet precipitation state. It is shown, that arsenic impurity behavior character in the antimony electric precipitation out to fluoride electrolyte depends on the electrolyte content, electrolysis conditions, arsenic valency state in arsenic impurity existence in the five-valency state its joint electric reduction with antimony is practically not observing. In the case the arsenic being in three-valency state, it joint electric reduction with antimony is taking place. In this time the electrolytic antimony contents arsenic impurities less in dozen time than initial material

  13. Martensite transformation in antimony implanted stainless steel

    International Nuclear Information System (INIS)

    The authors have used Rutherford backscattering analysis (RBS) and transmission electron microscopy (TEM) and diffraction to investigate austenitic stainless steel crystals implanted at room temperature with 80 keV Sb+ ions to a fluence of 5 x 1020 ions/m2, thus providing implantation with a heavy group V element. RBS channeling spectra from implanted crystals show a damage peak which approaches the height of the random level and therefore indicates a very high degree of disorder in the implanted layers. The distribution of the disorder extends to a depth 3-5 times the depth of the primary radiation damage. The Sb peaks under channeling as well as random conditions are indistinguishable, confirming that substitutionality during implantation is negligible. To establish the nature of the disorder which cannot be assessed from the RBS analysis alone, and in particular to assess whether an amorphous alloy is formed in the implanted layer as indicated from the RBS spectra, samples implanted under similar conditions were investigated in the TEM. Significant extra spots in the patterns can be ascribed to the presence of a radiation induced b.c.c. phase of martensitic origin. The result that a significant amount of martensite can be induced by antimony implantation seems to indicate that the main driving force for the transition is due to damage induced stress concentrations. (Auth.)

  14. Antimony Resistance in Leishmania, Focusing on Experimental Research

    Directory of Open Access Journals (Sweden)

    Fakhri Jeddi


    Full Text Available Leishmaniases are parasitic diseases that spread in many countries with a prevalence of 12 million cases. There are few available treatments and antimonials are still of major importance in the therapeutic strategies used in most endemic regions. However, resistance toward these compounds has recently emerged in areas where the replacement of these drugs is mainly limited by the cost of alternative molecules. In this paper, we reviewed the studies carried out on antimonial resistance in Leishmania. Several common limitations of these works are presented before prevalent approaches to evidence antimonial resistance are related. Afterwards, phenotypic determination of resistance is described, then confronted to clinical outcome. Finally, we detail molecular mechanisms and targets involved in resistance and already identified in vitro within selected mutant strains or in clinical isolates.

  15. Lattice dynamics of femtosecond laser-excited antimony (United States)

    Abdel-Fattah, Mahmoud Hanafy; Bugayev, Aleksey; Elsayed-Ali, Hani E.


    Ultrafast electron diffraction is used to probe the lattice dynamics of femtosecond laser-excited antimony thin film. The temporal hierarchies of the intensity and position of diffraction orders are monitored. The femtosecond laser excitation of antimony film was found to lead to initial compression after the laser pulse, which gives way to tension vibrating at new equilibrium displacement. A damped harmonic oscillator model, in which the hot electron-blast force contributes to the driving force of oscillations in lattice spacing, is used to interpret the data. The electron-phonon energy-exchange rate and the electronic Grüneisen parameter were obtained.

  16. Heat-treated Saccharomyces cerevisiae for antimony speciation and antimony(III) preconcentration in water samples

    Energy Technology Data Exchange (ETDEWEB)

    Marcellino, Sebastien [Universite de Lyon, Lyon1, Laboratoire des Sciences Analytiques, CNRS UMR 5180, bat CPE, 43, boulevard du 11 novembre 1918, 69622 Villeurbanne cedex (France); Attar, Hossein [Universite Louis Pasteur de Strasbourg, Laboratoire de Chimie Analytique et Sciences Separatives, CNRS UMR 7178, ECPM, 25 rue Becquerel 67087 Strasbourg (France); Lievremont, Didier; Lett, Marie-Claire [Universite Louis Pasteur de Strasbourg, Laboratoire de Genetique Moleculaire, Genetique et Microbiologie, CNRS UMR 7156, 28 rue Goethe, 67000 Strasbourg (France); Barbier, Frederique [CNRS USR 59, Service Central d' Analyse, 59 Chemin du Canal BP22 69390 Vernaison (France); Lagarde, Florence [Universite de Lyon, Lyon1, Laboratoire des Sciences Analytiques, CNRS UMR 5180, bat CPE, 43, boulevard du 11 novembre 1918, 69622 Villeurbanne cedex (France); Universite Louis Pasteur de Strasbourg, Laboratoire de Chimie Analytique et Sciences Separatives, CNRS UMR 7178, ECPM, 25 rue Becquerel 67087 Strasbourg (France)], E-mail:


    An analytical method was developed for antimony speciation and antimony(III) preconcentration in water samples. The method is based on the selective retention of Sb(III) by modified Saccharomyces cerevisiae in the presence of Sb(V). Heat, caustic and solvent pretreatments of the biomass were investigated to improve the kinetics and thermodynamics of Sb(III) uptake process at room temperature. Heating for 30 min at 80 deg. C was defined as the optimal treatment. Antimony accumulation by the cells was independent of pH (5-10) and ionic strength (0.01-0.1 mol L{sup -1}). 140 mg of yeast and 2 h of contact were necessary to ensure quantitative sequestration of Sb(III) up to 750 {mu}g L{sup -1}. In these conditions, Sb(V) was not retained. Sb(V) was quantified in sorption supernatant by inductively coupled plasma mass spectrometry (ICP-MS) or inductively coupled plasma optical emission spectrometry (ICP-OES). Sb(III) was determined after elution with 40 mmol L{sup -1} thioglycolic acid at pH 10. A preconcentration factor close to nine was achieved for Sb(III) when 100 mL of sample was processed. After preconcentration, the detection limits for Sb(III) and Sb(V) were 2 and 5 ng L{sup -1}, respectively, using ICP-MS, 7 and 0.9 {mu}g L{sup -1} using ICP-OES. The proposed method was successfully applied to the determination of Sb(III) and Sb(V) in spiked river and mineral water samples. The relative standard deviations (n = 3) were in the 2-5% range at the tenth {mu}g L{sup -1} level and less than 10% at the lowest Sb(III) and Sb(V) tested concentration (0.1 {mu}g L{sup -1}). Corrected recoveries were in all cases close to 100%.

  17. Antimony to Cure Visceral Leishmaniasis Unresponsive to Liposomal Amphotericin B.

    Directory of Open Access Journals (Sweden)

    Gloria Morizot


    Full Text Available We report on 4 patients (1 immunocompetent, 3 immunosuppressed in whom visceral leishmaniasis had become unresponsive to (or had relapsed after treatment with appropriate doses of liposomal amphotericin B. Under close follow-up, full courses of pentavalent antimony were administered without life-threatening adverse events and resulted in rapid and sustained clinical and parasitological cure.

  18. Antimony to Cure Visceral Leishmaniasis Unresponsive to Liposomal Amphotericin B. (United States)

    Morizot, Gloria; Jouffroy, Romain; Faye, Albert; Chabert, Paul; Belhouari, Katia; Calin, Ruxandra; Charlier, Caroline; Miailhes, Patrick; Siriez, Jean-Yves; Mouri, Oussama; Yera, Hélène; Gilquin, Jacques; Tubiana, Roland; Lanternier, Fanny; Mamzer, Marie-France; Legendre, Christophe; Peyramond, Dominique; Caumes, Eric; Lortholary, Olivier; Buffet, Pierre


    We report on 4 patients (1 immunocompetent, 3 immunosuppressed) in whom visceral leishmaniasis had become unresponsive to (or had relapsed after) treatment with appropriate doses of liposomal amphotericin B. Under close follow-up, full courses of pentavalent antimony were administered without life-threatening adverse events and resulted in rapid and sustained clinical and parasitological cure.

  19. Discovery of palladium, antimony, tellurium, iodine, and xenon isotopes


    Kathawa, J.; Fry, C; Thoennessen, M


    Currently, thirty-eight palladium, thirty-eight antimony, thirty-nine tellurium, thirty-eight iodine, and forty xenon isotopes have been observed and the discovery of these isotopes is discussed here. For each isotope a brief synopsis of the first refereed publication, including the production and identification method, is presented.

  20. 33 CFR 117.979 - Sabine Lake. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Sabine Lake. 117.979 Section 117.979 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.979 Sabine Lake. The draw of the S82 bridge, mile...

  1. 33 CFR 117.434 - Caddo Lake. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Caddo Lake. 117.434 Section 117.434 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.434 Caddo Lake. The draw of the Kansas...

  2. 33 CFR 117.917 - Battery Creek. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Battery Creek. 117.917 Section 117.917 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements South Carolina § 117.917 Battery Creek. The draw...

  3. 33 CFR 117.600 - Lagoon Pond. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lagoon Pond. 117.600 Section 117.600 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.600 Lagoon Pond. The draw of the Lagoon...

  4. 7 CFR 15.117 - Evidence. (United States)


    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Evidence. 15.117 Section 15.117 Agriculture Office of... and Administrative Review Under the Civil Rights Act of 1964 Hearing Procedures § 15.117 Evidence. Irrelevant, immaterial, unreliable, and unduly repetitious evidence will be excluded, and technical rules...

  5. 33 CFR 117.309 - Nassau Sound. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Nassau Sound. 117.309 Section 117.309 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.309 Nassau Sound. The draw of the Fernandina...

  6. 33 CFR 117.335 - Taylor Creek. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Taylor Creek. 117.335 Section 117.335 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.335 Taylor Creek. The draw of US441 bridge, mile...

  7. 33 CFR 117.987 - Taylor Bayou. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Taylor Bayou. 117.987 Section 117.987 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.987 Taylor Bayou. The draws of the Union...

  8. 32 CFR 724.117 - Discharge review. (United States)


    ... 32 National Defense 5 2010-07-01 2010-07-01 false Discharge review. 724.117 Section 724.117 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Definitions § 724.117 Discharge review. A nonadversary administrative reappraisal at the level...

  9. 33 CFR 117.1095 - Root River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Root River. 117.1095 Section 117.1095 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1095 Root River. (a) The draw of the Main...

  10. 33 CFR 117.713 - Cooper River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cooper River. 117.713 Section 117.713 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.713 Cooper River. (a) The drawspans for...

  11. 33 CFR 117.925 - Cooper River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cooper River. 117.925 Section 117.925 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements South Carolina § 117.925 Cooper River. The draw of the...

  12. 33 CFR 117.438 - Company Canal. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Company Canal. 117.438 Section 117.438 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.438 Company Canal. (a) The draw of...

  13. 33 CFR 117.415 - Green River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Green River. 117.415 Section 117... OPERATION REGULATIONS Specific Requirements Kentucky § 117.415 Green River. (a) The draw of the CSX... vicinity. (b) The draw of the CSX Transportation Railroad bridge, Mile 79.6 at Small-house, is...

  14. 33 CFR 117.107 - Chattahoochee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chattahoochee River. 117.107 Section 117.107 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Alabama § 117.107 Chattahoochee River. The draws...

  15. 33 CFR 117.486 - Pearl River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pearl River. 117.486 Section 117.486 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.486 Pearl River. (a) The draw of the...

  16. 33 CFR 117.547 - Bush River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bush River. 117.547 Section 117... OPERATION REGULATIONS Specific Requirements Maryland § 117.547 Bush River. The draw of the Amtrak bridge... Superintendent at 301-291-4278 by an authorized representative of the Bush River Yacht Club by noon on the...

  17. 33 CFR 117.359 - Chattahoochee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chattahoochee River. 117.359... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.359 Chattahoochee River. See § 117.107, Chattahoochee River, listed under Alabama....

  18. 33 CFR 117.337 - Trout River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Trout River. 117.337 Section 117... OPERATION REGULATIONS Specific Requirements Florida § 117.337 Trout River. The draw of the CSX Railroad Bridge across the Trout River, mile 0.9 at Jacksonville, operates as follows: (a) The bridge is...

  19. 33 CFR 117.131 - Little River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little River. 117.131 Section 117.131 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.131 Little River. The draws of the...

  20. 33 CFR 117.523 - Back River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Back River. 117.523 Section 117.523 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.523 Back River. The draw of the Maine Department...

  1. 33 CFR 117.109 - Coosa River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Coosa River. 117.109 Section 117.109 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Alabama § 117.109 Coosa River. The draw of the...

  2. 33 CFR 117.121 - Arkansas River (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Arkansas River 117.121 Section 117.121 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.121 Arkansas River The draw of...

  3. 33 CFR 117.567 - Patuxent River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Patuxent River. 117.567 Section 117.567 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.567 Patuxent River. The draw of...

  4. 33 CFR 117.139 - White River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false White River. 117.139 Section 117.139 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.139 White River. (a) The draws of the St....

  5. 33 CFR 117.187 - Petaluma River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Petaluma River. 117.187 Section 117.187 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.187 Petaluma River. (a) The draws...

  6. 33 CFR 117.365 - Oconee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Oconee River. 117.365 Section 117.365 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.365 Oconee River. The draw of the SR46...

  7. 33 CFR 117.319 - Oklawaha River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Oklawaha River. 117.319 Section 117.319 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.319 Oklawaha River. (a) The draw of...

  8. 33 CFR 117.575 - Susquehanna River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Susquehanna River. 117.575 Section 117.575 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.575 Susquehanna River. The draw of...

  9. 33 CFR 117.480 - Mermentau River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mermentau River. 117.480 Section 117.480 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.480 Mermentau River. The draw of...

  10. 33 CFR 117.389 - Calumet River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Calumet River. 117.389 Section 117.389 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Illinois § 117.389 Calumet River. The draws of...

  11. 33 CFR 117.423 - Atchafalaya River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Atchafalaya River. 117.423 Section 117.423 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.423 Atchafalaya River. The draw of...

  12. 33 CFR 117.381 - Clearwater River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Clearwater River. 117.381 Section 117.381 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Idaho § 117.381 Clearwater River. The draws of...

  13. 33 CFR 117.127 - Current River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Current River. 117.127 Section 117.127 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.127 Current River. The draws of...

  14. 33 CFR 117.219 - Pequonnock River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pequonnock River. 117.219 Section 117.219 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.219 Pequonnock River. (a)...

  15. 33 CFR 117.588 - Bass River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bass River. 117.588 Section 117.588 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.588 Bass River. The Hall Whitaker...

  16. 33 CFR 117.551 - Chester River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chester River. 117.551 Section 117.551 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.551 Chester River. The draw of the...

  17. 33 CFR 117.361 - Flint River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Flint River. 117.361 Section 117.361 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.361 Flint River. The draws of the...

  18. 33 CFR 117.205 - Connecticut River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Connecticut River. 117.205 Section 117.205 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.205 Connecticut River. (a)...

  19. 33 CFR 117.533 - Sheepscot River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Sheepscot River. 117.533 Section 117.533 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.533 Sheepscot River. The draw of the...

  20. 33 CFR 117.503 - Tensas River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Tensas River. 117.503 Section 117.503 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.503 Tensas River. The draws of the S15...

  1. 33 CFR 117.553 - Choptank River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Choptank River. 117.553 Section 117.553 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.553 Choptank River. (a) The draw of...

  2. 33 CFR 117.211 - Mystic River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mystic River. 117.211 Section 117.211 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.211 Mystic River. (a) The draw of the...

  3. 33 CFR 117.457 - Houston River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Houston River. 117.457 Section 117.457 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.457 Houston River. The draw of...

  4. 33 CFR 117.367 - Ogeechee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ogeechee River. 117.367 Section 117.367 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.367 Ogeechee River. (a) The draw of...

  5. 33 CFR 117.363 - Ocmulgee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ocmulgee River. 117.363 Section 117.363 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.363 Ocmulgee River. The draws of...

  6. 33 CFR 117.587 - Apponagansett River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apponagansett River. 117.587 Section 117.587 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.587 Apponagansett River. (a)...

  7. 33 CFR 117.525 - Kennebec River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Kennebec River. 117.525 Section 117.525 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.525 Kennebec River. (a) The draw of...

  8. 33 CFR 117.473 - Little River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little River. 117.473 Section 117.473 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.473 Little River. The draw of the Louisiana...

  9. 33 CFR 117.500 - Tchefuncta River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Tchefuncta River. 117.500 Section 117.500 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.500 Tchefuncta River. The draw of...

  10. 33 CFR 117.295 - Kissimmee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Kissimmee River. 117.295 Section 117.295 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.295 Kissimmee River. The draw of the...

  11. 33 CFR 117.125 - Black River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Black River. 117.125 Section 117.125 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.125 Black River. The following draws need not...

  12. 33 CFR 117.417 - Ohio River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ohio River. 117.417 Section 117.417 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Kentucky § 117.417 Ohio River. The draw of the Southern...

  13. 33 CFR 117.407 - Missouri River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Missouri River. 117.407 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Iowa § 117.407 Missouri River. See § 117.691, Missouri River listed under Nebraska. Kansas...

  14. 33 CFR 117.101 - Alabama River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Alabama River. 117.101 Section 117.101 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Alabama § 117.101 Alabama River. (a) The...

  15. 33 CFR 117.207 - Housatonic River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Housatonic River. 117.207 Section 117.207 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.207 Housatonic River. (a) The...

  16. 33 CFR 117.397 - Wabash River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Wabash River. 117.397 Section 117... OPERATION REGULATIONS Specific Requirements Illinois § 117.397 Wabash River. The draws of the bridges across the Wabash River need not be opened for the passage of vessels. Indiana...

  17. 33 CFR 117.585 - Acushnet River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Acushnet River. 117.585 Section 117.585 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.585 Acushnet River. (a)...

  18. 33 CFR 117.271 - Blackwater River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Blackwater River. 117.271 Section 117.271 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.271 Blackwater River. The draw of...

  19. 33 CFR 117.483 - Ouachita River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ouachita River. 117.483 Section 117.483 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.483 Ouachita River. The draw of the...

  20. 33 CFR 117.529 - Narraguagus River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Narraguagus River. 117.529 Section 117.529 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.529 Narraguagus River. The draw of...

  1. 33 CFR 117.183 - Old River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Old River. 117.183 Section 117... OPERATION REGULATIONS Specific Requirements California § 117.183 Old River. The draw of the California... notice is given to the drawtender at the Rio Vista bridge across the Sacramento River, mile 12.8....

  2. 33 CFR 117.241 - Mispillion River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mispillion River. 117.241 Section 117.241 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.241 Mispillion River. The draw of...

  3. 33 CFR 117.369 - Satilla River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Satilla River. 117.369 Section 117.369 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.369 Satilla River. The draw of...

  4. 33 CFR 117.371 - Savannah River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Savannah River. 117.371 Section 117.371 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.371 Savannah River. (a) The draw of...

  5. 33 CFR 117.509 - Vermilion River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Vermilion River. 117.509 Section 117.509 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.509 Vermilion River. (a) The draw...

  6. 33 CFR 117.253 - Anacostia River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Anacostia River. 117.253 Section 117.253 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements District of Columbia § 117.253 Anacostia River....

  7. 33 CFR 117.113 - Tensaw River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Tensaw River. 117.113 Section 117.113 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Alabama § 117.113 Tensaw River. The draw of the...

  8. 33 CFR 117.245 - Smyrna River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Smyrna River. 117.245 Section 117.245 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.245 Smyrna River. The draw of the...

  9. 33 CFR 117.422 - Amite River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Amite River. 117.422 Section 117.422 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.422 Amite River. (a) The draw of the S22...

  10. 33 CFR 117.569 - Pocomoke River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pocomoke River. 117.569 Section 117.569 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.569 Pocomoke River. (a) The...

  11. 33 CFR 117.351 - Altamaha River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Altamaha River. 117.351 Section 117.351 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Georgia § 117.351 Altamaha River. (a) The draws of...

  12. 33 CFR 117.224 - Thames River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Thames River. 117.224 Section 117.224 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.224 Thames River. The draw of the...

  13. 33 CFR 117.141 - American River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false American River. 117.141 Section 117.141 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.141 American River. The draw of...

  14. 33 CFR 117.133 - Ouachita River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Ouachita River. 117.133 Section 117.133 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.133 Ouachita River. The draw of the...

  15. 33 CFR 117.255 - Potomac River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Potomac River. 117.255 Section 117.255 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements District of Columbia § 117.255 Potomac River. (a)...

  16. 33 CFR 117.427 - Black River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Black River. 117.427 Section 117.427 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.427 Black River. The draw of the US84...

  17. 33 CFR 117.209 - Mianus River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mianus River. 117.209 Section 117.209 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.209 Mianus River. The draw of the...

  18. 33 CFR 117.171 - Middle River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Middle River. 117.171 Section 117... OPERATION REGULATIONS Specific Requirements California § 117.171 Middle River. (a) The draw of the San..., mile 9.8 near Middle River Station, shall open on signal if at least 12 hours notice is given to...

  19. 33 CFR 117.493 - Sabine River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Sabine River. 117.493 Section 117.493 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.493 Sabine River. (a) The draw of the...

  20. 33 CFR 117.243 - Nanticoke River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Nanticoke River. 117.243 Section 117.243 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.243 Nanticoke River. (a) The draw...

  1. 33 CFR 117.221 - Saugatuck River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Saugatuck River. 117.221 Section 117.221 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.221 Saugatuck River. (a)...

  2. 33 CFR 117.313 - New River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false New River. 117.313 Section 117.313 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.313 New River. (a) The draw of the SE....

  3. 33 CFR 117.565 - Miles River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Miles River. 117.565 Section 117.565 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.565 Miles River. The draw of the Route...

  4. 33 CFR 117.424 - Belle River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Belle River. 117.424 Section 117... OPERATION REGULATIONS Specific Requirements Louisiana § 117.424 Belle River. The draw of the S70 bridge, mile 23.8 (Landside Route) near Belle River, shall open on signal; except that, from 10 p.m. to 6...

  5. 33 CFR 117.557 - Curtis Creek. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Curtis Creek. 117.557 Section 117.557 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.557 Curtis Creek. The draw of the I695...

  6. 7 CFR 1260.117 - Importer. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Importer. 1260.117 Section 1260.117 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... Promotion and Research Order Definitions § 1260.117 Importer. Importer means any person who imports...

  7. 33 CFR 117.331 - Snake Creek. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake Creek. 117.331 Section 117.331 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.331 Snake Creek. The draw of the Snake...

  8. 33 CFR 117.1058 - Snake River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake River. 117.1058 Section 117... OPERATION REGULATIONS Specific Requirements Washington § 117.1058 Snake River. (a) The draw of the Burlington Northern Santa Fe railroad bridge across the Snake River at mile 1.5 between Pasco and Burbank...

  9. 33 CFR 117.385 - Snake River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake River. 117.385 Section 117.385 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Idaho § 117.385 Snake River. The drawspan of the U.S. 12...

  10. 33 CFR 117.135 - Red River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Red River. 117.135 Section 117.135 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.135 Red River. The draws of the bridges...

  11. 33 CFR 117.491 - Red River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Red River. 117.491 Section 117.491 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.491 Red River. (a) The draw of the Union...

  12. 33 CFR 117.263 - Banana River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Banana River. 117.263 Section 117.263 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.263 Banana River. (a) The draw of the Mathers...

  13. 33 CFR 117.177 - Mud Slough. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mud Slough. 117.177 Section 117.177 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.177 Mud Slough. The draw of the Union...

  14. 42 CFR 435.117 - Newborn children. (United States)


    ... 42 Public Health 4 2010-10-01 2010-10-01 false Newborn children. 435.117 Section 435.117 Public..., Children Under 8, and Newborn Children § 435.117 Newborn children. (a) The agency must provide Medicaid eligibility to a child born to a woman who has applied for, has been determined eligible and is...

  15. 33 CFR 117.324 - Rice Creek. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Rice Creek. 117.324 Section 117.324 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.324 Rice Creek. The CSX Railroad Swingbridge,...

  16. 25 CFR 117.11 - Insurance. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Insurance. 117.11 Section 117.11 Indians BUREAU OF INDIAN... MEMBERS OF THE OSAGE TRIBE OF INDIANS WHO DO NOT HAVE CERTIFICATES OF COMPETENCY § 117.11 Insurance. The superintendent may obtain policies of insurance covering the restricted property, real or personal, of...

  17. 33 CFR 117.955 - Buffalo Bayou. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo Bayou. 117.955 Section 117.955 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.955 Buffalo Bayou. (a) The draw of...

  18. 33 CFR 117.965 - Cow Bayou. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cow Bayou. 117.965 Section 117.965 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.965 Cow Bayou. The draws of the Orange...

  19. 33 CFR 117.1049 - Lake Washington. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lake Washington. 117.1049 Section 117.1049 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Washington § 117.1049 Lake Washington. The draw of...

  20. 33 CFR 117.959 - Chocolate Bayou. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chocolate Bayou. 117.959 Section 117.959 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.959 Chocolate Bayou. The draw of the...

  1. 33 CFR 117.755 - Shrewsbury River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Shrewsbury River. 117.755 Section 117.755 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.755 Shrewsbury River. (a) The...

  2. 33 CFR 117.622 - West Bay (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false West Bay 117.622 Section 117.622 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.622 West Bay The draw of the West Bay Bridge, mile...

  3. The determination of the thermodynamic activity of antimony in alpha-iron

    International Nuclear Information System (INIS)

    In this paper a method is suggested for determining the thermodynamic activity of antimony dissolved in alpha-iron, based on the study of antimony distribution between the two phases: liquid lead and solid iron. By this method, it was found that solid solutions of antimony in alpha-iron can be distinguished by positive divergences from the ideal state. Over a fairly wide range of concentrations, solutions of antimony in iron obey Henry's law. Special experiments on the distribution of antimony between lead and liquid iron showed that in the liquid state also the iron-antimony system is marked by positive divergences from the ideal state when small concentrations of antimony are present. The heat required for the solution of antimony in alpha-iron, and the excess partial molar entropy, were calculated from the activity temperature. The results were used for accurately locating the line showing the solubility limit of antimony in alpha-iron. Since alloys of antimony with iron were obtained by diffusion saturation and not by cooling from the liquid state, there was no liquefaction. Thus the lattice constant of the alloys and its relation to the alloy concentration could be reliably determined. The solubility limit established from X-ray data agrees with that obtained with Sb124. (author)

  4. In Vitro antileishmanial properties of neutron-irradiated meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema


    Full Text Available Pentavalent antimony, as meglumine antimoniate (Glucantime® or sodium stibogluconate (Pentostam® , is the main treatment for leishmaniasis, a complex of diseases caused by the protozoan Leishmania, and an endemic and neglected threat in Brazil. Despite over half a century of clinical use, their mechanism of action, toxicity and pharmacokinetic data remain unknown. The analytical methods for determination of antimony in biological systems remain complex and have low sensitivity. Radiotracer studies have a potential in pharmaceutical development. The aim of this study was to obtain a radiotracer for antimony, with suitable physical and biological properties. Meglumine antimoniate was neutron irradiated inside the IEA-R1 nuclear reactor, producing two radioisotopes 122Sb and 124Sb, with high radionuclidic purity and good specific activity. This compound showed the same antileishmanial activity as the native compound. The use of the radiotracers, easily created by neutron irradiation, could be an interesting tool to solve important questions in antimonial pharmacology.Os antimoniais pentavalentes, como o antimoniato de meglumina (Glucantime® ou estibogluconato de sódio (Pentostam® , são o principal tratamento para a leishmaniose, um complexo de doenças causadas pelo protozoário parasita Leishmania, uma doença endêmica e negligenciada no Brasil. Apesar do seu uso clínico por mais de meio século, seu mecanismo de ação, toxicidade e dados de farmacocinética permanecem desconhecidos. Os métodos analíticos para determinação de antimônio em sistemas biológicos são complexos e apresentam baixa sensibilidade. Estudos utilizando radiotraçadores têm papel potencial no desenvolvimento farmacológico. O objetivo deste estudo foi desenvolver um radiotraçador de antimônio, com propriedades físicas e biológicas adequadas. O antimoniato de meglumina foi irradiado por nêutrons no reator nuclear IEA-R1, produzindo dois radioisótopos: 122

  5. Antimony and arsenic biogeochemistry in the western Atlantic Ocean (United States)

    Cutter, Gregory A.; Cutter, Lynda S.; Featherstone, Alison M.; Lohrenz, Steven E.

    The subtropical to equatorial Atlantic Ocean provides a unique regime in which one can examine the biogeochemical cycles of antimony and arsenic. In particular, this region is strongly affected by inputs from the Amazon River and dust from North Africa at the surface, and horizontal transport at depth from high-latitude northern (e.g., North Atlantic Deep Water) and southern waters (e.g., Antarctic Bottom and Intermediate Waters). As a part of the 1996 Intergovernmental Oceanographic Commission's Contaminant Baseline Survey, data for dissolved As(III+V), As(III), mono- and dimethyl arsenic, Sb(III+V), Sb(III), and monomethyl antimony were obtained at six vertical profile stations and 44 sites along the 11,000 km transect from Montevideo, Uruguay, to Bridgetown, Barbados. The arsenic results were similar to those in other oceans, with moderate surface depletion, deep-water enrichment, a predominance of arsenate (>85% As(V)), and methylated arsenic species and As(III) in surface waters that are likely a result of phytoplankton conversions to mitigate arsenate "stress" (toxicity). Perhaps the most significant discovery in the arsenic results was the extremely low concentrations in the Amazon Plume (as low as 9.8 nmol/l) that appear to extend for considerable distances offshore in the equatorial region. The very low concentration of inorganic arsenic in the Amazon River (2.8 nmol/l; about half those in most rivers) is probably the result of intense iron oxyhydroxide scavenging. Dissolved antimony was also primarily in the pentavalent state (>95% antimonate), but Sb(III) and monomethyl antimony were only detected in surface waters and displayed no correlations with biotic tracers such as nutrients and chlorophyll a. Unlike As(III+V)'s nutrient-type vertical profiles, Sb(III+V) displayed surface maxima and decreased into the deep waters, exhibiting the behavior of a scavenged element with a strong atmospheric input. While surface water Sb had a slight correlation with

  6. BioGeochemistry of antimony, Sources, Transfers, Impacts and Assessment (United States)

    Le Roux, Gael; Pinelli, Eric; Hedde, Mickael; Guiresse, Maritxu; De Vleeschouwer, François; Silvestre, Jérôme; Enrico, Maxime; Gandois, Laure; Monna, Fabrice; Gers, Charles; Probst, Anne


    BioGeoSTIB is a project funded by ADEME (French Environmental Protection Agency). Its aim is to provide a better understanding of biogeochemical cycle disturbances of antimony by man. Specifically, it is focused on the atmosphere-soil-organism interfaces. Based on a multi-scale approach, the impact of antimony on organisms and organism communities and the factors of Sb dispersion in the environment aim to better characterized. This report gives the main results of 2 and 1 -2 years of research. Using peat bogs as environmental archives, we show that Sb contamination in soils date back to the beginning of the metallurgy. Atmospheric deposition of Sb largely increased by 100 times during the Industrial Revolution compared to natural levels (~0,001-0,01 mg m-2 an-1) estimated in the deepest peat layers. This disturbance in the antimony geochemical cycle modified its concentrations in soils. One main source of present Sb contamination is automotive traffic due to Sb in braking lines. This emerging contamination was characterized close to a roundabout. This additional source of Sb does not seem to impact soil fauna but Sb concentrations in soil solutions exceed 1 μg L-1. Genotoxicity tests have been performed on the model plant Vicia faba and show that antimony is genotoxic at its lowest concentrations and that there is a synergistic effect lead, a trace metal frequently found in association with antimony in the environment. It is a main issue to determine Sb critical loads in the environment but main identified lacks are thermodynamic data, which are not available yet, to model the behavior of Sb in soil solutions and the fact the antimony is always associated with other anthropogenic trace metals like lead. Critical thresholds of Sb have been determined for the first time based on genotoxicity experiment. Simulations show that these thresholds can be exceeded in the future, whereas present limits for invertebrates (US-EPA) are and will not be reached. However

  7. States of antimony and tin atoms in lead chalcogenides

    International Nuclear Information System (INIS)

    It is shown by Mössbauer spectroscopy of the 119Sb(119mSn) isotope that impurity antimony atoms in PbS, PbSe, and PbTe lattices are distributed between cation and anion sublattices. In n-type samples, the greatest part of antimony is located in the anion sublattice; in hole ones, in the cation sublattice. The tin atoms formed as a result of radioactive decay of 119Sb (antisite state) are electrically inactive in the anion sub-lattice of PbS and PbSe, while, in the cation sublattice, they form donor U− centers. Electron exchange between the neutral and doubly ionized tin U− centers via the allowed band states is observed. The tin atoms formed after radioactive decay of 119Sb are electrically inactive in the anion and cation sublattices of PbTe.

  8. 无机锑系阻燃剂%Inorganic Antimony Series Fire Retardants

    Institute of Scientific and Technical Information of China (English)



    无机锑系阻燃剂主要包括三氧化二锑、五氧化二锑溶胶和锑酸钠等。介绍了它们的性质、生产工艺、产品标准、阻燃用途和研发方向等。%Inorganic antimony series fire retardants include antimony trioxide, antimony pentoxide sol and sodium antimonate, etc. The properties, production process, production standard and uses of several inorganic antimony series fire retardants are introduced.

  9. Correlation of CsK{sub 2}Sb photocathode lifetime with antimony thickness

    Energy Technology Data Exchange (ETDEWEB)

    Mamun, M. A., E-mail:; Elmustafa, A. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529 (United States); The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606 (United States); Hernandez-Garcia, C.; Poelker, M. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606 (United States)


    CsK{sub 2}Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  10. Correlation of CsK2Sb photocathode lifetime with antimony thickness

    Energy Technology Data Exchange (ETDEWEB)

    Mamun, M. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529, USA; The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Hernandez-Garcia, C. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Poelker, M. [Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA; Elmustafa, A. A. [Department of Mechanical and Aerospace Engineering, Old Dominion University, Norfolk, Virginia 23529, USA; The Applied Research Center, Thomas Jefferson National Accelerator Facility, Newport News, Virginia 23606, USA


    CsK2Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  11. Correlation of CsK2Sb photocathode lifetime with antimony thickness

    Directory of Open Access Journals (Sweden)

    M. A. Mamun


    Full Text Available CsK2Sb photocathodes with quantum efficiency on the order of 10% at 532 nm, and lifetime greater than 90 days at low voltage, were successfully manufactured via co-deposition of alkali species emanating from an effusion source. Photocathodes were characterized as a function of antimony layer thickness and alkali consumption, inside a vacuum chamber that was initially baked, but frequently vented without re-baking. Photocathode lifetime measured at low voltage is correlated with the antimony layer thickness. Photocathodes manufactured with comparatively thick antimony layers exhibited the best lifetime. We speculate that the antimony layer serves as a reservoir, or sponge, for the alkali.

  12. Resistance to Arsenic- and Antimony-Based Drugs


    Milena Salerno; Arlette Garnier-Suillerot


    Organic arsenicals were the first antimicrobial agents specifically synthesized for the treatment of infectious diseases such as syphilis and sleeping sickness. For the treatment of diseases caused by trypanosomatid parasites, organic derivatives of arsenic and the related metalloid antimony are still the drugs of choice. Arsenic trioxide, As203, has been used for a long time in traditional Chinese medicines for treatment of various diseases, and it has recently been shown to be clinically ac...

  13. Crystallization of antimony orthotantalate and its physical properties

    International Nuclear Information System (INIS)

    Physicochemical conditions of monophase synthesis of antimony orthoniobate monocrystals in the system SbO3-Ta2O5-KHF2-H2O2-H2O were investigated. In the area of monophase synthesis of SbTaO4 monocrystals kinetic studies of its growth conditions for inoculation, depending on solvent concentration, temperature, pyroelectric properties of the monocrystal grown were studied and conclusion was made on their practical use

  14. 33 CFR 117.487 - Pierre Pass. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Pierre Pass. 117.487 Section 117... OPERATION REGULATIONS Specific Requirements Louisiana § 117.487 Pierre Pass. The draw of the S70 bridge, mile 1.0 at Pierre Part, shall open on signal; except that, from 10 p.m. to 6 a.m., the draw shall...

  15. 33 CFR 117.305 - Miami River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Miami River. 117.305 Section 117... OPERATION REGULATIONS Specific Requirements Florida § 117.305 Miami River. (a) General. Public vessels of.... 27th Avenue Bridge, mile 3.7 at Miami, shall open on signal; except that, from 7:35 a.m. to 8:59...

  16. Antimony leaching from polyethylene terephthalate (PET) plastic used for bottled drinking water. (United States)

    Westerhoff, Paul; Prapaipong, Panjai; Shock, Everett; Hillaireau, Alice


    Antimony is a regulated contaminant that poses both acute and chronic health effects in drinking water. Previous reports suggest that polyethylene terephthalate (PET) plastics used for water bottles in Europe and Canada leach antimony, but no studies on bottled water in the United States have previously been conducted. Nine commercially available bottled waters in the southwestern US (Arizona) were purchased and tested for antimony concentrations as well as for potential antimony release by the plastics that compose the bottles. The southwestern US was chosen for the study because of its high consumption of bottled water and elevated temperatures, which could increase antimony leaching from PET plastics. Antimony concentrations in the bottled waters ranged from 0.095 to 0.521 ppb, well below the US Environmental Protection Agency (USEPA) maximum contaminant level (MCL) of 6 ppb. The average concentration was 0.195+/-0.116 ppb at the beginning of the study and 0.226+/-0.160 ppb 3 months later, with no statistical differences; samples were stored at 22 degrees C. However, storage at higher temperatures had a significant effect on the time-dependent release of antimony. The rate of antimony (Sb) release could be fit by a power function model (Sb(t)=Sb 0 x[Time, h]k; k=8.7 x 10(-6)x[Temperature ( degrees C)](2.55); Sb 0 is the initial antimony concentration). For exposure temperatures of 60, 65, 70, 75, 80, and 85 degrees C, the exposure durations necessary to exceed the 6 ppb MCL are 176, 38, 12, 4.7, 2.3, and 1.3 days, respectively. Summertime temperatures inside of cars, garages, and enclosed storage areas can exceed 65 degrees C in Arizona, and thus could promote antimony leaching from PET bottled waters. Microwave digestion revealed that the PET plastic used by one brand contained 213+/-35 mgSb/kg plastic; leaching of all the antimony from this plastic into 0.5L of water in a bottle could result in an antimony concentration of 376 ppb. Clearly, only a small

  17. Recent advances on antimony(III/V) compounds with potential activity against tumor cells. (United States)

    Hadjikakou, S K; Ozturk, I I; Banti, C N; Kourkoumelis, N; Hadjiliadis, N


    Antimony one of the heavier pnictogens, has been in medical use against microbes and parasites as well. Antimony-based drugs have been prescribed against leishmaniasis since the parasitic transmission of the tropical disease was understood in the beginning of the 20th century. The activity of arsenic against visceral leishmaniasis led to the synthesis of an array of arsenic-containing parasitic agents, among them the less toxic pentavalent antimonials: Stibosan, Neostibosan, and Ureastibamine. Other antimony drugs followed: sodium stibogluconate (Pentostam) and melglumine antimoniate (Glucantim or Glucantime); both continue to be in use today despite their toxic side effects and increasing loss in potency due to the growing resistance of the parasite against antimony. Antimony compounds and their therapeutic potentials are under consideration from many research groups, while a number of early reviews recording advances of antimony biomedical applications are also available. However, there are only few reports on the screening for antitumor potential of antimony compounds. This review focuses upon results obtained on the anti-proliferative activity of antimony compounds in the past years. This survey shows that antimony(III/V) complexes containing various types of ligands such as thiones, thiosemicarbazones, dithiocarbamates, carboxylic acids, or ketones, nitrogen donor ligands, exhibit selectivity against a variety of cancer cells. The role of the ligand type of the complex is elucidated within this review. The complexes and their biological activity are already reported elsewhere. However quantitative structure-activity relationship (QSAR) modeling studies have been carried out and they are reported for the first time here. PMID:26092367

  18. Heavy weight vehicle traffic and its relationship with antimony content in human blood. (United States)

    Quiroz, Waldo; De Gregori, Ida; Basilio, Paola; Bravo, Manuel; Pinto, Marcela; Lobos, Maria Gabriela


    Brake pads systems are nowadays considered as one of the most important sources of antimony in airborne particulate matter. One way that antimony can enter the body is through the lungs and specially by the interaction of antimony with -SH groups present in erythrocyte membrane cells. In spite of that, there are no studies about antimony enrichment in blood of workers exposed to high vehicle traffic. Port workers are generally exposed to heavy weight vehicle traffic. In Chile the biggest marine port is found in Valparaíso City. In this study antimony in whole blood and its fractions (erythrocytes-plasma and erythrocytes membranes-cytoplasm) of 45 volunteers were determined. The volunteers were port workers from Valparaíso city, and two control groups, one from Valparaíso and another from Quebrada Alvarado, the latter being a rural area located about 100 Km away from Valparaíso. The results demonstrate that port workers are highly impacted by antimony emissions from heavy weight vehicle traffic showing an average concentration of 27 +/- 9 ng Sb kg(-1), 5-10 times higher than the concentration of antimony in the blood of control groups. These are the highest antimony levels in blood ever reported in the literature. The highest antimony percentages (>60%) were always found in the erythrocyte fractions. However, the exposure degree to vehicle traffic is significant over antimony distribution in plasma, erythrocytes and cytoplasm. This results shows that the antimony mass in the erythrocyte membranes, was approximately constant at 1.0 +/- 0.1 ng Sb g(-1) of whole blood in all blood samples analyzed.

  19. Tin dioxide sol-gel derived films doped with platinum and antimony deposited on porous silicon

    NARCIS (Netherlands)

    Savaniu, C.; Arnautu, A.; Cobianu, C.; Craciun, G.; Flueraru, C.; Zaharescu, M.; Parlog, C.; Paszti, F.; Berg, van den A.


    SnO2 sol-gel derived thin films doped simultaneously with Pt and Sb are obtained and reported for the first time. The Sn sources were tin(IV) ethoxide or tin(II) ethylhexanoate, while hexachloroplatinic acid (H2PtCl6) and antimony chloride (SbCl3) were used as platinum and antimony sources, respecti

  20. Oxidation and mobilization of metallic antimony in aqueous systems with simulated groundwater (United States)

    Ilgen, A. G.; Majs, F.; Barker, A. J.; Douglas, T. A.; Trainor, T. P.


    Antimony (Sb) is a contaminant of concern that can be present in elevated concentrations in shooting range soils due to mobilization from spent lead/antimony bullets. Antimony in shooting range soils has been observed as either metallic Sb(0) or as Sb(V) immobilized by iron (hydr)oxides. The absence of Sb(III) in soils is indicative of rapid Sb(III) oxidation to Sb(V) under surface soil conditions. However, the major controls on antimony oxidation and mobility are poorly understood. To better understand these controls we performed multiple batch experiments under oxic conditions to quantify the oxidation and dissolution of antimony in systems where Sb(0) is oxidized to Sb(III) and further to Sb(V). We also tested how variations in the aqueous matrix composition and the presence of metallic lead (Pb) affect the dissolution, solid phase speciation, and oxidation of antimony. We monitored changes in the aqueous antimony speciation using liquid chromatography inductively coupled plasma mass spectrometry (LC-ICP-MS). To test which solid phases form as a result of Sb(0) oxidation, and therefore potentially limit the mobility of antimony in our studied systems, we characterized the partially oxidized Sb(0) powders by means of extended X-ray absorption fine structure (EXAFS) spectroscopy and powder X-ray diffraction (XRD).

  1. Leishmania donovani: an in vitro study of antimony-resistant amphotericin B-sensitive isolates

    DEFF Research Database (Denmark)

    Sharief, Abdalla Hassan; Gasim Khalil, Eltahir Awad; Theander, Thor G;


    Drug sensitivity of clinically antimony-unresponsive Leishmania donovani isolates from Eastern Sudan was evaluated in an in vitro culture system against sodium stibogluconate (Pentostam) and Amphotericin B. Eight isolates, six from antimony-resistant and two from clinically responsive patients were...

  2. Dicty_cDB: CHS117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS117 (Link to dictyBase) - - - Contig-U16471-1 CHS117P (Link to Original site) CHS1...17F 501 CHS117Z 771 CHS117P 1252 - - Show CHS117 Library CH (Link to library) Clone ID CHS1...e URL Representative seq. ID CHS1...17P (Link to Original site) Representative DNA sequence >CHS117 (CHS117Q) /CSM/CH/CHS1-A/CHS1...oducing significant alignments: (bits) Value CHS117 (CHS117Q) /CSM/CH/CHS1-A/CHS117Q.Seq.d/ 1487 0.0 SHJ637

  3. 40 CFR 117.14 - Demonstration projects. (United States)


    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Demonstration projects. 117.14 Section... DETERMINATION OF REPORTABLE QUANTITIES FOR HAZARDOUS SUBSTANCES Applicability § 117.14 Demonstration projects... research or demonstration projects relating to the prevention, control, or abatement of hazardous...

  4. 33 CFR 117.603 - Manchester Harbor. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Manchester Harbor. 117.603... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.603 Manchester Harbor. The Massachusetts Bay Transportation Authority Bridge at mile 1.0 in Manchester, shall operate as follows: (a)...

  5. 14 CFR 91.117 - Aircraft speed. (United States)


    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Aircraft speed. 91.117 Section 91.117... speed. (a) Unless otherwise authorized by the Administrator, no person may operate an aircraft below 10... than the maximum speed prescribed in this section, the aircraft may be operated at that minimum speed....

  6. 33 CFR 117.215 - Niantic River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Niantic River. 117.215 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.215 Niantic River. (a) The draw of the Amtrak bridge, mile 0.0 at Niantic, shall open on signal; except that, from April 1...

  7. 38 CFR 11.117 - Missing applications. (United States)


    ....117 Section 11.117 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS LOANS BY BANKS ON AND PAYMENT OF ADJUSTED SERVICE CERTIFICATES Application for Payment of Adjusted Service... intention to claim the benefits of this Act, has been filed and the application cannot be found,...

  8. 33 CFR 117.189 - Sacramento River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Sacramento River. 117.189 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.189 Sacramento River. (a) The draws of each bridge from Isleton to American River junction shall open on signal from May 1...

  9. 33 CFR 117.175 - Mokelumne River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mokelumne River. 117.175 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.175 Mokelumne River. (a) The draw of the California Department of Transportation highway bridge, the Mokelumne River Bridge, mile 3.0,...

  10. 33 CFR 117.527 - Kennebunk River. (United States)


    ... board gages in accordance with 33 CFR 118.160, of this chapter. ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Kennebunk River. 117.527 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.527 Kennebunk River. The Dock...

  11. 33 CFR 117.217 - Norwalk River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Norwalk River. 117.217 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.217 Norwalk River. (a) The draw of.... to 12 p.m., on the first Saturday in December, to facilitate the running of the annual Norwalk...

  12. 33 CFR 117.299 - Loxahatchee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Loxahatchee River. 117.299... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.299 Loxahatchee River. The draw of the Florida East Coast Railway bridge across the Loxahatchee River, mile 1.2 at Jupiter, operates as...

  13. 33 CFR 117.291 - Hillsborough River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Hillsborough River. 117.291... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.291 Hillsborough River. (a) The... the CSX Railroad Bridge across the Hillsborough River, mile 0.7, at Tampa, operates as follows:...

  14. 33 CFR 117.258 - Apalachicola River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apalachicola River. 117.258... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.258 Apalachicola River. The draw of the CSX Railroad bridge, mile 105.9, at River Junction shall open on signal Monday through Friday from 8...

  15. 33 CFR 117.391 - Chicago River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chicago River. 117.391 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Illinois § 117.391 Chicago River. The draws of the bridges operated by the City of Chicago over the Main Branch of Chicago River, the bridges on the...

  16. 33 CFR 117.593 - Chelsea River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chelsea River. 117.593 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.593 Chelsea River. All drawbridges across the Chelsea River shall open on signal. The opening signal for each drawbridge is two...

  17. 33 CFR 117.531 - Piscataqua River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Piscataqua River. 117.531 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maine § 117.531 Piscataqua River. (a) The following requirements apply to all bridges across the Piscataqua River: (1) Public vessels of the United...

  18. 33 CFR 117.411 - Missouri River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Missouri River. 117.411 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Kansas § 117.411 Missouri River. The draws of the bridges across the Missouri River shall open on signal; except during the winter season between the...

  19. 33 CFR 117.333 - Suwannee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Suwannee River. 117.333 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.333 Suwannee River. The draw of Suwannee River bridge, mile 35 at Old Town need not be opened for the passage of vessels, however, the draw...

  20. 33 CFR 117.570 - Sassafras River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Sassafras River. 117.570 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.570 Sassafras River. The draw of the Sassafras River (Route 213) bridge, mile 10.0 at Georgetown, Maryland, shall open on signal; except...

  1. 49 CFR 194.117 - Training. (United States)


    ... for emergency response operations in 29 CFR 1910.120, including volunteers or casual laborers employed during a response who are subject to those standards pursuant to 40 CFR part 311. ... 49 Transportation 3 2010-10-01 2010-10-01 false Training. 194.117 Section 194.117...

  2. 33 CFR 117.300 - Manatee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Manatee River. 117.300 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.300 Manatee River. The draw of the CSX Railroad Bridge across the Manatee River, mile 4.5 Bradenton, operates as follows: (a) The bridge is...

  3. 33 CFR 117.773 - Buffalo River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo River. 117.773 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New York § 117.773 Buffalo River. (a) The draw of the Michigan Avenue bridge, mile 1.3, at Buffalo, shall operate as follows: (1) From March 22 through...

  4. 9 CFR 117.2 - Animal facilities. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Animal facilities. 117.2 Section 117.2 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED ESTABLISHMENTS §...

  5. 46 CFR 117.25 - Additional requirements. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Additional requirements. 117.25 Section 117.25 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150... the requirements of this part inadequate; or (2) The vessel is operated in Arctic, Antarctic, or...

  6. 13 CFR 117.12 - Mediation. (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Mediation. 117.12 Section 117.12... Mediation. (a) SBA shall, after ensuring that the complaint falls within the coverage of this Act and all... clearly within an exception, promptly refer the complaint to the Federal Mediation and...

  7. 9 CFR 117.4 - Test animals. (United States)



  8. 33 CFR 117.549 - Cambridge Harbor. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cambridge Harbor. 117.549 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.549 Cambridge Harbor. The draw of the S342 bridge, mile 0.1 at Cambridge, shall open on signal from 6 a.m. to 8 p.m.; except that, from...

  9. Research on Percolation Network and Physical Properties of Graphite/Antimony Composites

    Institute of Scientific and Technical Information of China (English)

    HU Ya-fei; HE Min; WANG Qi-li


    The microstructure, friction and wear behaviour of graphite preform and graphite/antimony composites are analysed based on the percolation theory of hydrodynamics to investigate the relationship between the percolation network and physical properties of graphite/antimony composites. The result shows that there are two important factors to enhance friction and wear behaviour of graphite/antimony composites at high temperature: 1) the formation of the pore network in the preform, which is called the first percolation and 2) the optimization of infiltration method in the process of infiltrating antimony, which is called the second percolation. By adding some pyrolysate and controlling the roasting process, perfect net pores and sub-micron percolation microstructure may be formed in the graphite preform. By controlling the infiltration process, the saturation of molten antimony infiltrating into perfect pores can be optimized.

  10. Testing of antimony selective media for treatment of liquid radwaste

    International Nuclear Information System (INIS)

    Nuclear power plants have sought radiation source term reduction and reduced discharge of radioactive constituents for many years. In the case of pressurized water reactors (PWRs), the latter efforts have been directed toward capture and immobilization of recalcitrant (ubiquitous radionuclides with long half-lives) species such as Cs-134 and Cs-137 and Co-58 and Co-60. As these plants resolved, or at least mitigated, the problems with radiocesium and radio-cobalt, antimony radionuclides (Sb-122, Sb-124, and Sb-125) have become a primary concern in liquid liquid radwaste systems Graver Technologies developed a granular composite metal oxide media with good selectivity for radio-antimony. Initial laboratory data were collected using non-radioactive salts of antimony, cesium, and cobalt to judge efficacy of selective removal of antimony. Based on success of those trials, the media, designated Gravex GX187, was tested in partnership with Energy Solutions (nee Duratek) using actual liquid liquid radwaste in two PWR plants. One of these plants performed extensive slip-stream trials comparing the GX187 with strong base anion resins. With more than 2500 bed volumes of throughput, the GX187 outperformed the other competitors by reducing both Sb-124 and Sb-125 radionuclides below minimum detectable activity (MDA) with average decontamination factors (DF's) of 170, even when subjected to high levels of borate. Based on these favorable results, Energy Solutions installed the GX187 in a layered bed in their ALPS liquid radwaste processing system at this plant in August 2005. After one year of intermittent, batchwise operation including an outage, the GX187 processed more than 2.25 million liters (>600,000 gallons) of liquid liquid radwaste while reducing the Sb-125 activity to 2.9 E-08 Bq/L (DF=111) on average. This evaluation is ongoing and will continue at least until the fall 2006 outage at this plant. Concurrently, Graver developed a second generation antimony selective

  11. Behavior of ruthenium, cesium and antimony during simulated HLLW vitrification

    International Nuclear Information System (INIS)

    The behavior of ruthenium, cesium, and antimony during the vitrification of simulated high-level radioactive liquid wastes (HLLW) in a liquid fed melter was studied on a laboratory scale and on a semi-pilot scale. In the laboratory melter of a 2.5 kg capacity, a series of tests with the simulate traced with 103Ru, 134Cs and 124Sb, has shown that the Ru and Cs losses to the melter effluent are generally higher than 10% whereas the antimony losses remain lower than 0.4%. A wet purification system comprising in series, a dust scrubber, a condenser, an ejector venturi and an NOx washing column retains most of the activity present in the off-gas so that the release fractions for Ru at the absolute filter inlet ranges between 5.10-3 to 5.10-5% of the Ru fed, for Cs the corresponding release fraction ranges between 3.10-3 to 10-4% and for Sb the release fraction ranges between 1.7 10-4 to 1.7 10-5%. The same experiments were performed at a throughput of 1 to 2 1 h-1 of simulated solution in the semi-pilot scale unit RUFUS. The RUFUS unit comprises a glass melter with a 50 kg molten glass capacity and the wet purification train comprises in series a dust scrubber, a condenser, an ejector venturi and an NOx washing column. The tracer tests were restricted to 103Ru and 134Cs since the laboratory tests had shown that the antimony losses were very low. The results of the tests are presented

  12. The Hydrothermal Chemistry of Gold, Arsenic, Antimony, Mercury and Silver

    Energy Technology Data Exchange (ETDEWEB)

    Bessinger, Brad; Apps, John A.


    A comprehensive thermodynamic database based on the Helgeson-Kirkham-Flowers (HKF) equation of state was developed for metal complexes in hydrothermal systems. Because this equation of state has been shown to accurately predict standard partial molal thermodynamic properties of aqueous species at elevated temperatures and pressures, this study provides the necessary foundation for future exploration into transport and depositional processes in polymetallic ore deposits. The HKF equation of state parameters for gold, arsenic, antimony, mercury, and silver sulfide and hydroxide complexes were derived from experimental equilibrium constants using nonlinear regression calculations. In order to ensure that the resulting parameters were internally consistent, those experiments utilizing incompatible thermodynamic data were re-speciated prior to regression. Because new experimental studies were used to revise the HKF parameters for H2S0 and HS-1, those metal complexes for which HKF parameters had been previously derived were also updated. It was found that predicted thermodynamic properties of metal complexes are consistent with linear correlations between standard partial molal thermodynamic properties. This result allowed assessment of several complexes for which experimental data necessary to perform regression calculations was limited. Oxygen fugacity-temperature diagrams were calculated to illustrate how thermodynamic data improves our understanding of depositional processes. Predicted thermodynamic properties were used to investigate metal transport in Carlin-type gold deposits. Assuming a linear relationship between temperature and pressure, metals are predicted to predominantly be transported as sulfide complexes at a total aqueous sulfur concentration of 0.05 m. Also, the presence of arsenic and antimony mineral phases in the deposits are shown to restrict mineralization within a limited range of chemical conditions. Finally, at a lesser aqueous sulfur

  13. Electrostatically defined silicon quantum dots with counted antimony donor implants

    Energy Technology Data Exchange (ETDEWEB)

    Singh, M., E-mail:; Luhman, D. R.; Lilly, M. P. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States); Center for Integrated Nanotechnologies, Sandia National Laboratories, Albuquerque, New Mexico 87175 (United States); Pacheco, J. L.; Perry, D.; Garratt, E.; Ten Eyck, G.; Bishop, N. C.; Wendt, J. R.; Manginell, R. P.; Dominguez, J.; Pluym, T.; Bielejec, E.; Carroll, M. S. [Sandia National Laboratories, Albuquerque, New Mexico 87185 (United States)


    Deterministic control over the location and number of donors is crucial to donor spin quantum bits (qubits) in semiconductor based quantum computing. In this work, a focused ion beam is used to implant antimony donors in 100 nm × 150 nm windows straddling quantum dots. Ion detectors are integrated next to the quantum dots to sense the implants. The numbers of donors implanted can be counted to a precision of a single ion. In low-temperature transport measurements, regular Coulomb blockade is observed from the quantum dots. Charge offsets indicative of donor ionization are also observed in devices with counted donor implants.

  14. Antimony implanted strained Si for nMOSFET applications


    Zamani, Atieh


    Incorporation of implanted antimony (Sb) in strained-silicon (s-Si) formed on relaxed-SiGe virtual substrates (10 and 30% Ge) has been studied. The implantation doses were 5×1013- 5×1014 cm-2 with an energy of 20 keV. The activation of dopant was performed by an rapid thermal annealing (RTA) treatment at 700 and 800 °C for 30 sec. Projected range of this implantation is about 20 nm which was also confirmed by different techniques. The layers were analyzed in terms of strain relaxation, sheet ...

  15. Formation of $^{117}In-H$ pairs after annealing of GaN implanted with $^{117}Cd(^{117}In)$

    CERN Document Server

    Dietrich, M; Stötzler, A; Weissenborn, R


    We report on the annealing behaviour of GaN grown on sapphire after implantation of 117Cd(117In). Isochronic annealing has been performed in order to remove the implantation induced lattice damage in evacuated quartz ampoules with additional Al. The extent of the lattice damage is investigated with perturbed gg-angular correlation spectroscopy (PAC). The implantation damage is annealed at temperatures above 1073 K to a large extent. 82(5) % of the probes are found on the Ga-site characterized by a quadrupole coupling constant of 20.9(1) MHz. After H loading, an additional interaction appears which is attributed to 117Cd(117In)-H pairs.

  16. Solubility behaviour of antimony(III) and antimony(V) solids in basic aqueous solutions at 300{sup o}C

    Energy Technology Data Exchange (ETDEWEB)

    Lemire, R.J.; Tosello, N.B.; Halliday, J.D


    The major contributions of the isotopes {sup 122}Sb and {sup 124}Sb to activity transport in a CANDU reactor primary heat transport system (HTS), have been associated with oxygen ingress during reactor shutdown. As part of a program to minimize the release and redeposition of these isotopes, the solubilities of antimony(III) and (V) oxides and salts have been measured in basic solutions at temperatures from 25 to 300{sup o}C. The results provide information on the charge and the stability as a function of temperature of antimony solution species and, hence, a guide to the trends in the temperature dependence of the solubilities of antimony solids. In solutions in which oxidation of antimony(III) to antimony(V) is minimized, the solubility of Sb{sub 2}O{sub 3} increases by about two orders of magnitude between 25 and 200{sup o}C, and then levels out or decreases slightly. At 250{sup o}C, in oxidizing solutions, Sb{sub 2}O{sub 5}{center_dot}xH{sub 2}O and simple sodium antimonate(V) were found to be unstable in sodium hydroxide solutions with respect to the solid, Na{sub 2{alpha}}[H(H{sub 2}O)]{sub 2-2{alpha}}Sb{sub 2}O{sub 6}, which has a pyrochlore structure. The solubility of this partially protonated sodium antimonate increases from 25 to 200{sup o}C and decreases at temperatures above 250{sup o}C. These solubility changes for the antimony (V) solids reflect changes in the stability of the anionic antimony solution species (SbO{sub 3}{sup -} or Sb(OH){sub 6}{sup -}), even though the compositions of antimony-containing solids in basic oxidizing solutions are strongly dependent on the cations and their aqueous phase concentrations. All solids used in the present experiments would be expected to generate total solution antimony concentrations {>=} 0.00005 mol{center_dot}dm{sup -3} in any neutral or basic aqueous solutions (assuming no added sodium salts). Therefore, under HTS conditions, precipitation of any antimony oxides or mixed oxides is unlikely. It cannot be

  17. Antimony removal from the polyethylene terephthalate manufacture wastewater

    Directory of Open Access Journals (Sweden)

    Tomas Vengris


    Full Text Available In this study, antimony removal by coagulation from polyethylene terephthalate resin production wastewater of „Orion Global PET“ factory in Klaipėda city was investigated, with regard to the dependence of coagulant type and dosage, pH and presence of organics. FeCl3 ∙6H2O, FeSO4 ∙7H2O, AlCl3∙6H2O and TiCl4 salts were used as coagulants. Ti(IV and Fe(III revealed oneself to be the most effective coagulants. Antimony removal effectiveness is moderate and low using FeSO4 ∙7H2O and AlCl3∙6H2O coagulants, respectively. The addition of 10 mg dm-3 Ti(IV and 30 mg dm-3 Fe(III reduces by ~98% of the Sb, when the initial amount of Sb in wastewater is about 1200 mkg/l. The action of Fe(III is practically independent in the pH range 4-9, and that of Ti(IV slightly decreases in the same pH interval. The Sb amount in wastewater can be reduced to 13-20 mkg dm-3, while the initial Sb concentration is 1200 mkg dm-3. The presence of organic compounds in wastewater determines the reduction of Sb removal by coagulation.

  18. Alkali oxide-tantalum, niobium and antimony oxide ionic conductors (United States)

    Roth, R. S.; Brower, W. S.; Parker, H. S.; Minor, D. B.; Waring, J. L.


    The phase equilibrium relations of four systems were investigated in detail. These consisted of sodium and potassium antimonates with antimony oxide and tantalum and niobium oxide with rubidium oxide as far as the ratio 4Rb2O:llB2O5 (B=Nb, Ta). The ternary system NaSbO3-Sb2O4-NaF was investigated extensively to determine the actual composition of the body centered cubic sodium antimonate. Various other binary and ternary oxide systems involving alkali oxides were examined in lesser detail. The phases synthesized were screened by ion exchange methods to determine mobility of the mobility of the alkali ion within the niobium, tantalum or antimony oxide (fluoride) structural framework. Five structure types warranted further investigation; these structure types are (1) hexagonal tungsten bronze (HTB), (2) pyrochlore, (3) the hybrid HTB-pyrochlore hexagonal ordered phases, (4) body centered cubic antimonates and (5) 2K2O:3Nb2O5. Although all of these phases exhibit good ion exchange properties only the pyrochlore was prepared with Na(+) ions as an equilibrium phase and as a low porosity ceramic. Sb(+3) in the channel interferes with ionic conductivity in this case, although relatively good ionic conductivity was found for the metastable Na(+) ion exchanged analogs of RbTa2O5F and KTaWO6 pyrochlore phases.

  19. Antimony contamination and its effect on Trifolium plants (United States)

    Corrales, Isabel; Barceló, Juan; Bech, Jaume; Poschenrieder, Charlotte


    Antimony is not an essential element and soil Sb contents usually are low.However, soil contamination by Sb has increased in the last years due to the human activities (combustion of fossil fuels, mining, waste incineration, smelting, shooting and road traffic). The main objective of this work was to study the effect of different concentrations of antimony (KSb(OH)6) in order to evaluate the effect on growth and Sb uptake on Trifolium pratense cv. Milvus and Trifolium repens. Our results show that Sb accumulated both in roots and shoots of clover without any negative effect on root growth, cellular viability and lipid peroxidation. This absence of toxicity sympthoms in clover plants could be very dangerous because Sb can be inadvertedly incorporated into the trophic chain causing toxic effects both in animals and humans. The absence of toxic effects on plants does not seem to be due to detoxification by phytochelatins because the use of the gamma-glutamylcysteine synthetase inhibitor, L-buthionine-[S,R]-sulphoximine (BSO) did not enhance Sb toxicity to plants. (Supported by the Spanish MICINN project BFU2010-14873)

  20. Thermal decomposition kinetics of antimony oxychloride in air

    Institute of Scientific and Technical Information of China (English)

    阳卫军; 唐谟堂; 金胜明


    The DTA and XRD techniques were employed to study thermal decomposition mechanism of antimony oxychloride SbOCl in the air. The thermal decomposition reaction occurs in four steps, and the former three steps as: SbOCl(s)→Sb4O5Cl2(s)+SbCl3(g)→Sb8O11Cl2(s)+SbCl3(g)→Sb2O3(s)+SbCl3(g). The forth step is the oxidation of Sb2O3 by air, Sb2O3(s)+O2→Sb2O4(s). The activation energy and the order of the thermal decomposition reaction of antimony oxychloride in three steps presented in DTA curves were calculated according to Kinssinger methods from DTA curves. The values of activation energy and the order are respectively 91.97kJ/mol, 0.73 in the first step, 131.14kJ/mol, 0.63 in the second step and 146.94kJ/mol, 1.58 in the third step.

  1. BSA activated CdTe quantum dot nanosensor for antimony ion detection. (United States)

    Ge, Shenguang; Zhang, Congcong; Zhu, Yuanna; Yu, Jinghua; Zhang, Shuangshuang


    A novel fluorescent nanosensor for Sb(3+) determination was reported based on thioglycolic acid (TGA)-capped CdTe quantum dot (QD) nanoparticles. It was the first antimony ion sensor using QD nanoparticles in a receptor-fluorophore system. The water-soluable TGA-capped CdTe QDs were prepared through a hydrothermal route, NaHTe was used as the Te precursor for CdTe QDs synthesis. Bovine serum albumin (BSA) conjugated to TGA-capped CdTe via an amide link interacting with carboxyl of the TGA-capped CdTe. When antimony ion enters the BSA, the lone pair electrons of the nitrogen and oxygen atom become involved in the coordination, switching off the QD emission and a dramatic quenching of the fluorescence intensity results, allowing the detection of low concentrations of antimony ions. Using the operating principle, the antimony ion sensor based on QD nanoparticles showed a very good linearity in the range 0.10-22.0 microg L(-1), with the detection limit lower than 2.94 x 10(-8) g L(-1) and the relative standard deviation (RSD) 2.54% (n = 6). In a study of interferences, the antimony-sensitive TGA-QD-BSA sensor showed good selectivity. Therefore, a simple, fast, sensitive, and highly selective assay for antimony has been built. The presented method has been applied successfully to the determination of antimony in real water samples (n = 6) with satisfactory results.

  2. Removal of cobalt from zinc sulphate solution using rude antimony trioxide as additive

    Institute of Scientific and Technical Information of China (English)

    戴军; 王德全; 姜澜; 金曼


    The process of cobalt removal from zinc sulphate solution using rude antimony trioxide as an additive was investigated. The rude antimony trioxide was produced in treatment of copper and lead anode mud and its main components are antimony trioxide, antimony arsenate and lead antimonate. Using the rude antimony trioxide as the additive of cobalt removal can not only decrease operation cost of purification but also find out a new way for utilization of the rude antimony trioxide. The effects of temperature, dosage of zinc dust, the rude antimony trioxide, copper ion and solution pH on removal of cobalt were studied. And experimental data using the rude Sb2O3 as additive were compared with those using Sb2O3. The results indicate that using rude Sb2O3 as additive, cobalt concentration in solution could be decreased from 24mg/L to below 1mg/L under about the same conditions as using Sb2O3.

  3. Leaching Mechanism of Complicated Antimony-Lead Concentrate and Sulfur Formation in Slurry Electrolysis

    Institute of Scientific and Technical Information of China (English)

    WangChengyan; QiuDingfan; JiangPeihai


    Anodic reaction mechanism of complicated antimony-lead concentrate in slurry electrolysis was investigated by the anodic polarization curves determined under various conditions. The main reactions on the anode are the oxidations of FeCln(2-n) . Though the oxidation of jamesonite particle on the anode can occur during the whole process, it is less. With the help of mineralogy studies and relevant tests, the leaching reaction mechanism of jameson[to and gudmundite during slurry electrolysis was ascertained. Because of the oxidation reaction of FeCl3 produced by antimony-lead concentrate itself, the non-oxidation complex acid dissolution of jameson[re, the oxidation complex acid dissolution of gudmundite, and the oxidation of air carried by stirring, the leaching ratio of antimony reaches about 35% when HCl-NH4Cl solution is used to leach antimony-lead concentrate directly. So when the theoretical electric quantity is given to oxidation of antimony in slurry electrolysis, all of antimony, lead and iron containing in antimony-lead concentrate, are leached. The formation of sulfur is through the directly redox reaction of Fe3+ and jameson[re. The S2- in jamesonite is oxidized into S0 , and forms the crystals of sulfur again on the spot. The redox reaction of Fe3+ and H2S formed by non-oxidative acid dissolution of jamesonite is less.

  4. In Vitro Antiparasitic and Apoptotic Effects of Antimony Sulfide Nanoparticles on Leishmania infantum

    Directory of Open Access Journals (Sweden)

    Saied Soflaei


    Full Text Available Visceral leishmaniasis is one of the most important sever diseases in tropical and subtropical countries. In the present study the effects of antimony sulfide nanoparticles on Leishmania infantum in vitro were evaluated. Antimony sulfide NPs (Sb2S5 were synthesized by biological method from Serratia marcescens bacteria. Then the cytotoxicity effects of different concentrations (5, 10, 25, 50, and 100 μg/mL of this nanoparticle were assessed on promastigote and amastigote stages of L. infantum. MTT method was used for verification results of promastigote assay. Finally, the percentages of apoptotic, necrotic, and viable cells were determined by flow cytometry. The results indicated the positive effectiveness of antimony sulfide NPs on proliferation of promastigote form. The IC50 (50% inhibitory concentration of antimony sulfide NPs on promastigotes was calculated 50 μg/mL. The cytotoxicity effect was dose-dependent means by increasing the concentration of antimony sulfide NPs, the cytotoxicity curve was raised and the viability curve of the parasite dropped simultaneously. Moreover, the IC50 of antimony sulfide NPs on amastigote stage was calculated 25 μg/mL. On the other hand, however, antimony sulfide NPs have a low cytotoxicity effect on uninfected macrophages but it can induce apoptosis in promastigote stage at 3 of 4 concentrations.

  5. Segregation of antimony in InP in MOVPE

    Energy Technology Data Exchange (ETDEWEB)

    Weeke, Stefan


    In this work the segregation of antimony in indium phosphide in metal organic vapour phase epitaxy (MOVPE)was systematically investigated. Therefore phosphine stabilized InP surfaces were treated with tri-methyl-antimony (TMSb) in MOVPE. An antimony rich Sb/InP surface was established, showing a typical spectra for the antimonides observed in reflectance anisotropy spectroscopy (RAS).Adsorption and desorption of antimony are investigated, as well as the incorporation of Sb during overgrowth of the Sb/InP surface with InP. Therefore the growth parameters temperature, TMSb partial pressure and treatment time are varied and their influence investigated. The experiments are monitored in-situ with RAS, the achieved data is correlated with ex-situ characterisation such as X-ray diffraction (XRD) and secondary ion mass spectroscopy (SIMS). It is shown that under treatment with TMSb a stable Sb/InP surface is formed within seconds, which does not change under further TMSb treatment. This process is rarely influenced by the TMSb partial pressure. On the contrary, the desorption of Sb is a very slow process. Two main processes can be distinguished: The desorption of excess Sb from the surface and the formation of the MOVPE prepared InP (2 x 1) surface. The reaction velocity of adsorption and desorption increases with temperature. Above a critical value the increase of TMSb partial pressure has no influence on the time for desorption. During overgrowth of the Sb/InP surface the opposite temperature dependence is observed: with increasing growth temperature the typical spectra for antimonides is observed longer. An analysis of the grown samples with XRD and SIMS showed the formation of an InPSb double quantum well. One layer is formed at the interface, the second one 50 nm-120 nm deep in the InP. The location of the 2nd InPSb layer can be correlated with the vanishing of the Sb signature in RAS. The distance between the quantum wells increases with growth temperature, until it

  6. Varicella zoster virus reactivation during or immediately following treatment of tegumentary leishmaniasis with antimony compounds

    Directory of Open Access Journals (Sweden)

    Andrea Barbieri Barros


    Full Text Available Antimony compounds are the cornerstone treatments for tegumentary leishmaniasis. The reactivation of herpes virus is a side effect described in few reports. We conducted an observational study to describe the incidence of herpes zoster reactivation during treatment with antimony compounds. The global incidence of herpes zoster is approximately 2.5 cases per 1,000 persons per month (or 30 cases per 1,000 persons per year. The estimated incidence of herpes zoster in patients undergoing antimony therapy is higher than previously reported.

  7. Structural and optical characterization of thermally evaporated bismuth and antimony films for photovoltaic applications (United States)

    Srimathy, N.; Ruban Kumar, A.


    In this present study, the thin film of bismuth and antimony is coated by thermal evaporation system equipped with the inbuilt ultra high vacuum system. XRD analysis confirmed the rhombohedral structure of Bismuth and Antimony on the prepared film. The surface roughness and physical appearance is analyzed by Atomic force microscopy. The results of Raman Spectroscopy show the wave functions and the spectrum of electrons. The preparation technique and conditions strongly influence the crystalline structure and the phase composition of bismuth and antimony thin films. The electrical and optical properties for the prepared film are analyzed. The results show a great interest and promising applications in Photovoltaic devices.

  8. Coordination- and Redox-Noninnocent Behavior of Ambiphilic Ligands Containing Antimony. (United States)

    Jones, J Stuart; Gabbaï, François P


    Stimulated by applications in catalysis, the chemistry of ambiphilic ligands featuring both donor and acceptor functionalities has experienced substantial growth in the past several years. The unique opportunities in catalysis offered by ambiphilic ligands stem from the ability of their acceptor functionalities to play key roles via metal-ligand cooperation or modulation of the reactivity of the metal center. Ligands featuring group 13 centers, most notably boranes, as their acceptor functionalities have undoubtedly spearheaded these developments, with remarkable results having been achieved in catalytic hydrogenation and hydrosilylation. Motivated by these developments as well as by our fundamental interest in the chemistry of heavy group 15 elements, we became fascinated by the possibility of employing antimony centers as Lewis acids within ambiphilic ligands. The chemistry of antimony-based ligands, most often encountered as trivalent stibines, has historically been considered to mirror that of their lighter phosphorus-based congeners. There is growing evidence, however, that antimony-based ligands may display unique coordination behavior and reactivity. Additionally, despite the diverse Lewis acid and redox chemistry that antimony exhibits, there have been only limited efforts to explore this chemistry within the coordination sphere of a transition metal. By incorporation of antimony into the framework of polydentate ligands in order to enforce the main group metal-transition metal interaction, the effect of redox and coordination events at the antimony center on the structure, electronics, and reactivity of the metal complex may be investigated. This Account describes our group's continuing efforts to probe the coordination behavior, reactivity, and application of ambiphilic ligands incorporating antimony centers. Structural and theoretical studies have established that both Sb(III) and Sb(V) centers in polydentate ligands may act as Z-type ligands toward late

  9. Coordination- and Redox-Noninnocent Behavior of Ambiphilic Ligands Containing Antimony. (United States)

    Jones, J Stuart; Gabbaï, François P


    Stimulated by applications in catalysis, the chemistry of ambiphilic ligands featuring both donor and acceptor functionalities has experienced substantial growth in the past several years. The unique opportunities in catalysis offered by ambiphilic ligands stem from the ability of their acceptor functionalities to play key roles via metal-ligand cooperation or modulation of the reactivity of the metal center. Ligands featuring group 13 centers, most notably boranes, as their acceptor functionalities have undoubtedly spearheaded these developments, with remarkable results having been achieved in catalytic hydrogenation and hydrosilylation. Motivated by these developments as well as by our fundamental interest in the chemistry of heavy group 15 elements, we became fascinated by the possibility of employing antimony centers as Lewis acids within ambiphilic ligands. The chemistry of antimony-based ligands, most often encountered as trivalent stibines, has historically been considered to mirror that of their lighter phosphorus-based congeners. There is growing evidence, however, that antimony-based ligands may display unique coordination behavior and reactivity. Additionally, despite the diverse Lewis acid and redox chemistry that antimony exhibits, there have been only limited efforts to explore this chemistry within the coordination sphere of a transition metal. By incorporation of antimony into the framework of polydentate ligands in order to enforce the main group metal-transition metal interaction, the effect of redox and coordination events at the antimony center on the structure, electronics, and reactivity of the metal complex may be investigated. This Account describes our group's continuing efforts to probe the coordination behavior, reactivity, and application of ambiphilic ligands incorporating antimony centers. Structural and theoretical studies have established that both Sb(III) and Sb(V) centers in polydentate ligands may act as Z-type ligands toward late

  10. Synthesis and characterisation of nano-pore antimony imprinted polymer and its use in the extraction and determination of antimony in water and fruit juice samples. (United States)

    Shakerian, Farid; Dadfarnia, Shayessteh; Haji Shabani, Ali Mohammad; Nili Ahmad Abadi, Maryam


    A solid phase extraction method using antimony ion imprinted polymer (IIP) sorbent combined with electrothermal atomic absorption spectrometry (ETAAS) was developed for the extraction and speciation of antimony. The sorbent has been synthesised in the presence of Sb(III) and ammonium pyrrolidine dithiocarbamate (APDC) using styrene as the monomer and ethylene glycol dimethacrylate (EGDMA) as the cross linker. The imprinted Sb(III) ions were removed by leaching with HCl (50%v/v) and the polymer was characterised by FT-IR and scanning electron microscopy. The maximum sorption capacity of the IIP for Sb(III) ions was found to be 6.7 mg g(-1). With preconcentration of 60 mL of sample, an enhancement factor of 232 and detection limit of 3.9 ng L(-1) was obtained. Total antimony was determined after the reduction of Sb(V) to Sb(III). The method was successfully applied to the determination of antimony species in water samples and total antimony in fruit juices.

  11. Anthropogenic impacts on the biogeochemistry and cycling of antimony. (United States)

    Shotyk, William; Krachler, Michael; Chen, Bin


    Antimony is a potentially toxic trace element with no known biological function. Antimony is commonly enriched in coals, and fossil fuel combustion appears to be the largest single source of anthropogenic Sb to the global atmosphere. Abundant in sulfide minerals, its emission to the atmosphere from anthropogenic activities is linked to the mining and metallurgy of non-ferrous metals, especially Pb, Cu, and Zn. In particular, the geochemical and mineralogical association of Sb with Pb minerals implies that, like Pb, Sb has been emitted to the environment for thousands of years because of Pb mining, smelting, and refining. In the US alone, there are more than 400 former secondary lead smelting operations and worldwide there are 133 Pb-Zn smelters in operation today. Antimony is used in creating and improving dozens of industrial and commercial materials including various alloys, ceramics, glasses, plastics, and synthetic fabrics, making waste incineration another important source of Sb to the environment. Enrichments of Sb in atmospheric aerosols, plants, soils, sediments, as well as alpine and polar snow and ice suggest that Sb contamination is extensive, but there are very few quantitative studies of the geographic extent, intensity, and chronology of this contamination. There is an urgent need to quantify the extent of human impacts and how these have changed with time. The decreasing inventories of anthropogenic Sb with time in peat cores from Switzerland and Scotland suggest that the atmospheric Sb flux may be declining, but there have been too few studies to make any general conclusions. In fact, some studies of sediments and biomonitors in central Europe show little decline in Sb concentrations during the past decades. There is an obvious need for reliable data from well dated archives such as polar snow and ice, peat bogs, and sediments. The air concentrations, extent of enrichment, particle size distribution, and rate of deposition of Sb in urban areas is

  12. Biogeochemistry of Antimony(V) in Microcosms under Sulfidogenic Conditions (United States)

    O'Loughlin, E. J.; Johnson, C. R.; Antonopoulos, D. A.; Boyanov, M.; Flynn, T. M.; Koval, J. C.; Kemner, K. M.


    As the mining and use of antimony continues to increase, environmental concerns involving the element have grown. Antimony(V) and (III) are the two most environmentally-relevant oxidation states, but little is known about the redox transitions between the two in natural systems. To better understand the behavior of antimony in anoxic environments, we examined the transformations of Sb(V) under Fe(III)- and sulfate-reducing conditions in aqueous suspensions that contained 2 mM KSb(OH)6, 50 mM Fe(III) (as ferrihydrite), 10 mM sulfate, and 10 mM lactate, and were inoculated with sediment from a wetland on the campus of Argonne National Laboratory in Argonne, Illinois. Samples were collected over time to track changes in the concentrations of Sb, Fe(II), sulfate, and lactate, as well as the composition of the microbial community as determined by 16S rRNA gene inventories. We also examined the interaction of Sb(V) with pure Fe(II) mineral phases in aqueous suspensions containing 2 mM KSb(OH)6 and 50 mM Fe(II) as either magnetite, sideritre, vivianite, green rust, or mackinawite. X-ray absorption fine-structure spectroscopy was used to determine the valence state of Sb and its chemical speciation. Lactate was rapidly fermented to acetate and propionate concomittant with a bloom of Veillonellaceae. Utilization of propionate for dissimilatory sulfate reduction (DSR) was accompanied by an increase in Desulfobulbaceae. Sb K-edge X-Ray absorption near edge structure (XANES) analysis showed reduction of Sb(V) to Sb(III) within 4 weeks, concurrent with DSR and the formation of FeS. We observed variable responses in the ability of specific Fe(II) minerals to reduce Sb(V). No reduction was observed with magnetite, siderite, vivianite, or green rust. In the presence of mackinawite (FeS), however, Sb(V) was reduced to Sb(III) sulfide. These results suggest that the reduction of Sb(V) to Sb(III) is not likely under solely Fe(III)-reducing conditions, but is expected in sulfidogenic

  13. Geochemical Studies on Dachang Antimony Ore Deposit in Qinglong,Guizhou Province

    Institute of Scientific and Technical Information of China (English)



    The Dachang antimony deposit in Qinglong,Guizhou Province,is strictly controlled by the “Dachang Layer” which is a complex altered rock occurring at unconformity between the Permian Emeishan basalt and the Maokou limestone.Based on the studies of the hanging-and foot-wall rocks,the trace elements and REE contents of the rocks and ores and heavy placer minerals in the basalt,this paper is focused on the relations between these data and the “Dachang Layer”and its hanging- and oot-wall rocks.The author pointed out that the “Dachang Layer” and basalt are the source-beds of antimony;ilmenite and magnetite are the major mineral carriers of antimony.In the processes of halmyrosis and burial metamorphism of the “Dachang Layer” an basalt,antimony was mobilized along with the mobilization of iron and was preliminarily concentrated in the“ Dachang Layer”.

  14. Effect of filler on the self-lubrication performance of graphite antimony composites

    Institute of Scientific and Technical Information of China (English)

    WANG Qi-li; HU Ya-fei; HE Min


    Graphite antimony composites were prepared using a mechanical pressure infiltration method to force molten antimony into graphite preforms having a percolation micro-structure and a hop-pocket power filler. The micro-structural and macroscopic properties of the graphite antimony composites were analysed. Observations included metallographic analysis, physical properties and friction and wear behaviour. The results show that the wear loss is decreased by 12.24% and that the friction coefficient is re-duced by 32.61% after hop-pocket power was used. The research indicates that the hop-pocket power method gives a useful way to reduce friction coefficients and wear loss, and to increase service life and self-lubrication properties, of the graphite antimony seal-ing material as compared to carbon black.

  15. Geochemistries of arsenic, antimony, mercury, and related elements in sediments of puget sound (United States)

    Crecelius, E.A.; Bothner, Michael H.; Carpenter, R.


    The natural distributions of arsenic, antimony mercury, chromium, cobalt, iron, aluminum, and carbon in the surface sediments of Puget Sound are perturbed by two major anthropogenic sources of trace metals: a copper smelter near Tacoma, Wash., that discharges large amounts of arsenic and antimony, and a chlor-alkali plant in Bellingham, Wash., which, in the recent past, discharged significant amounts of mercury. Arsenic and antimony inputs from the smelter over the past 80 years are evident in sediment cores whose accumulation rates have been determined by the lead-210 technique. An arsenic budget for Puget Sound reveals the importance of atmospheric input resulting from smokestack emissions of the smelter. Chemical extraction studies of sediments showed that more than 82% of the mercury was associated with easily oxidizable organic matter, whereas about 50% of both arsenic and antimony was associated with extractable iron and aluminum compounds.


    Directory of Open Access Journals (Sweden)



    Full Text Available Five new S2- adducts with SbIII and SbV halides have been synthesized and studied by infrared. Discrete structures have been suggested, the environment around the antimony being tetrahedral, trigonal bipyramidal or octahedral.

  17. Crystal structure and thermodynamic properties of potassium antimony tungsten oxide

    Energy Technology Data Exchange (ETDEWEB)

    Knyazev, Aleksandr V., E-mail: [Nizhny Novgorod State University, Gagarin Prospekt 23/2, Nizhny Novgorod, 603950 (Russian Federation); Tananaev, Ivan G. [Institute of Physical Chemistry and Electrochemistry, Russian Academy of Sciences, 31 Leninsky prospect, Moscow GSP-1, 119991 (Russian Federation); Kuznetsova, Nataliya Yu.; Smirnova, Nataliya N.; Letyanina, Irene A.; Ladenkov, Igor V. [Nizhny Novgorod State University, Gagarin Prospekt 23/2, Nizhny Novgorod, 603950 (Russian Federation)


    In the present work potassium antimony tungsten oxide with pyrochlore structure is refined by the Rietveld method (space group Fd3m, Z = 8). The temperature dependences of heat capacity have been measured for the first time in the range from 7 to 370 K for this compound. The experimental data were used to calculate standard thermodynamic functions, namely the heat capacity C{sub p}{sup o}(T), enthalpy H{sup o}(T) - H{sup o}(0), entropy S{sup o}(T) - S{sup o}(0) and Gibbs function G{sup o}(T) - H{sup o}(0), for the range from T {yields} 0 to 370 K. The differential scanning calorimetry was applied to measure the incongruent melting temperature of compound under study. The high-temperature X-ray diffraction was used for the determining thermal expansion coefficients.

  18. Coherent and Incoherent Structural Dynamics in Laser-Excited Antimony

    CERN Document Server

    Waldecker, Lutz; Bertoni, Roman; Vasileiadis, Thomas; Garcia, Martin E; Zijlstra, Eeuwe S; Ernstorfer, Ralph


    We investigate the excitation of phonons in photoexcited antimony and demonstrate that the entire electron-lattice interactions, in particular coherent and incoherent electron-phonon coupling, can be probed simultaneously. Using femtosecond electron diffraction (FED) with high temporal resolution, we observe the coherent excitation of the fully symmetric \\Ag\\ optical phonon mode via the shift of the minimum of the atomic potential energy surface. Molecular dynamics simulations are performed to quantify the change in lattice potential and the associated real-space amplitude of the coherent atomic oscillations. In addition, our experimental configuration allows observing the energy transfer from electrons to phonons via incoherent electron-lattice scattering events. Applying a modified two-temperature model, the electron-phonon coupling is determined from the data as a function of electronic temperature.

  19. Atomistic mechanisms governing structural stability change of zinc antimony thermoelectrics

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Xiaolong [Frontier Institute of Science and Technology, Xi' an Jiaotong University, Xi' an 710054 (China); Lin, Jianping, E-mail: [School of Materials Science and Engineering, Xiamen University of Technology, Xiamen 361024 (China); Qiao, Guanjun [State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China); Wang, Zhao, E-mail: [Frontier Institute of Science and Technology, Xi' an Jiaotong University, Xi' an 710054 (China); State Key Laboratory for Mechanical Behavior of Materials, Xi' an Jiaotong University, Xi' an 710049 (China)


    The structural stability of thermoelectric materials is a subject of growing importance for their energy harvesting applications. Here, we study the microscopic mechanisms governing the structural stability change of zinc antimony at its working temperature, using molecular dynamics combined with experimental measurements of the electrical and thermal conductivity. Our results show that the temperature-dependence of the thermal and electrical transport coefficients is strongly correlated with a structural transition. This is found to be associated with a relaxation process, in which a group of Zn atoms migrates between interstitial sites. This atom migration gradually leads to a stabilizing structural transition of the entire crystal framework, and then results in a more stable crystal structure of β–Zn{sub 4}Sb{sub 3} at high temperature.

  20. Antimonial drugs entrapped into phosphatidylserine liposomes: physicochemical evaluation and antileishmanial activity


    Samanta Etel Treiger Borborema; João Alberto Osso Junior; Heitor Franco de Andrade Junior; Nanci do Nascimento


    Abstract: INTRODUCTION: Leishmaniasis is a disease caused by the protozoan Leishmania that resides mainly in mononuclear phagocytic system tissues. Pentavalent antimonials are the main treatment option, although these drugs have toxic side effects and high resistance rates. A potentially alternative and more effective therapeutic strategy is to use liposomes as carriers of the antileishmanial agents. The aims of this study were to develop antimonial drugs entrapped into phosphatidylserine l...

  1. New low-antimony alloy for straps and cycling service in lead-acid batteries (United States)

    Prengaman, R. David

    Lead-antimony alloys used for the positive grids in lead-acid batteries for cycling service have generally used antimony contents of 4.5 wt.% and above. Tubular batteries for cycling service that impart high compression of the active material to the grid surface via gauntlet use alloys with antimony contents as low as 1.5 wt.%. These batteries are generally employed in less-severe cycling service. Value-regulated lead-acid (VRLA) batteries can give good cycling service without lead-antimony in the positive grid, but require a high tin content and high compression. The change in automotive battery positive grid alloys to lead-calcium-tin and the tin contents of VRLA positive grids and straps have dramatically increased the tin content of the recycled grid and strap lead in the USA, Europe, and Australia. The higher tin contents can contaminate the lead used for lead-antimony battery grids and generally must be removed to low levels to meet the specifications. This study describes a low-antimony alloy that contains a substantial amount of tin. The high tin content reduces the rate of corrosion of low-antimony positive grid alloys, improves conductivity, increases the bond between the grid and the active material, and cycles as well as the traditional 5-6 wt.% antimony alloys employed in conventional flat-plate batteries. The alloy is also used as a corrosion-resistant cast-on strap alloy for automotive batteries for high temperature service, as well as for posts, bushings, and connectors for all wet batteries.

  2. 49 CFR 571.117 - Standard No. 117; Retreaded pneumatic tires. (United States)


    ... Federal Motor Vehicle Safety Standards § 571.117 Standard No. 117; Retreaded pneumatic tires. S1. Scope... car tires to meet safety criteria similar to those for new pneumatic passenger car tires. S3... 1948. S4. Definitions. S4.1Casing means a used tire to which additional tread may be attached for...

  3. Effect of Antimony, Phosphorous and Salinity on Growth, Root Membrane Permeability and Root Antimony, Iron and Zinc Concentration of Corn in Hydroponic Media


    H. Barangizi; M. Afyuni; B. Rezaee


    Antimony (Sb) pollution has increased in recent years because of human activities and extensive usage of antimony compounds. To date, only a few researches have been conducted in this field in Iran. The purpose of this research is to determine fresh and dry weight, root permeability percentage and root concentration of Sb, Fe and Zn in the corn. This greenhouse research was performed in hydroponics. A factorial experiment (3 × 2 × 3) with three Sb concentrations (0, 6, 18 mgL-1), with and wit...

  4. Effects of antimony on aquatic organisms (Larva and embryo of Oryzias latipes, Moina macrocopa, Simocephalus mixtus, and Pseudokirchneriella subcapitata). (United States)

    Nam, Sun-Hwa; Yang, Chang-Yong; An, Youn-Joo


    Antimony is widespread in aquatic environment. Trivalent forms of antimony are known to be more toxic than other chemical species of antimony. In the present study, antimony potassium tartrate (APT), the trivalent inorganic forms of antimony, was selected as a test antimony compound due to its high water solubility. The effects of antimony on Japanese medaka (Oryzias latipes), planktonic crustacea (Moina macrocopa and Simocephalus mixtus), and green algae (Pseudokirchneriella subcapitata) were evaluated. Larval survival and the embryonic development were measured for fish assay. APT was less toxic to larval medaka (24-h LC50, 261; 48-h LC50, 238 mg L(-1)). Simocephalus mixtus was killed by very low concentrations of APT (24-h LC50, 4.92 mg L(-1)), and antimony was also toxic to Moina macrocopa (24-h LC50, 12.83 mg L(-1)). Toxicities of APT to S. mixtus and Moina macrocopa were about 50 and 20 times more toxic to Oryzias latipes larvae, respectively, in terms of 24-h LC50 value. Growth inhibition of Pseudokirchneriella subcapitata was observed in the presence of APT (72-h EC50, 206 mg L(-1)). This study demonstrated that APT is more toxic to planktonic crustacea than fish and green algae, and planktonic crustacea appears a better indicator of antimony pollution in aquatic environment. PMID:19264343

  5. Arsenic and Antimony Content in Soil and Plants from Baia Mare Area, Romania

    Directory of Open Access Journals (Sweden)

    Gabriela Oprea


    Full Text Available Problem statement: The objective of this research was to evaluate the degree of soil contamination with arsenic and antimony in Baia Mare, a nonferrous mining and metallurgical center located in the North West region of Romania. The soil in the area is affected by the emissions of powders containing metals from metallurgical factories. Previous studies indicated the soil contamination with copper, zinc, cadmium and lead, but there is few data about the actual level of soil pollution with arsenic and antimony. Approach: The soil samples were collected from 2 districts of Baia Mare: Ferneziu, which is located in the proximity of a lead smelter and Săsar district which is located along the Sasar River in the preferential direction of the wind over a metallurgical factory producing lead. As reference was considered Dura area located in a less polluted hilly area, in the west part of the town. Samples of soil and plants from the residential area of Ferneziu, Săsar and Dura districts were collected. The arsenic determination was carried out by inductively coupled plasma atomic emission spectrometry and the antimony determination by inductively coupled plasma mass spectrometry. Results: In Ferneziu area, the concentration of arsenic in soil ranged between 0.25 and 255 mg kg-1. In Săsar district the arsenic concentration in the soil ranged between 5.5 and 295 mg kg-1. Regarding antimony, in Ferneziu area the concentration ranged between 5.3 and 40.6 mg kg-1; while in Săsar, antimony soils concentrations vary in the range: 0.9-18.4. Arsenic and antimony concentrations in plants were low for almost of the samples, both in Ferneziu and Săsar area indicating a low mobility of these elements in the studied soils. Conclusion: This study indicated the soil pollution with arsenic both in Ferneziu district and in Săsar district. The soil pollution with antimony was found especially in Ferneziu district.

  6. 38 CFR 75.117 - Notification. (United States)


    ...) INFORMATION SECURITY MATTERS Data Breaches § 75.117 Notification. (a) With respect to individuals found under... that were involved in the data breach (e.g., full name, Social Security number, date of birth, home... personal information is possibly included in the data breach. (c) In those cases deemed by the Secretary...

  7. 33 CFR 117.743 - Rahway River. (United States)


    ...; except, as provided in 33 CFR 117.31(b). However, if a train moving toward the bridge has crossed the... lights anytime the bridge is not in the full open position. (d) An infrared sensor system shall be... the infrared sensor system. (g) If the infrared sensors detect a vessel or other...

  8. 9 CFR 117.1 - Applicability. (United States)


    ... the Act of August 24, 1966 (Pub. L. 89-544) as amended by the Animal Welfare Act of 1970 (Pub. L. 91... welfare of such animals shall be qualified by education, training, and experience to carry out the... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Applicability. 117.1 Section...

  9. 24 CFR 206.117 - General. (United States)


    ... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOME EQUITY CONVERSION MORTGAGE INSURANCE Contract Rights and Obligations Hud Responsibility to Mortgagors § 206.117... because of the default of the mortgagee. The Secretary may hold a second mortgage to secure repayment...

  10. Antimony distribution and mobility in topsoils and plants (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa) from polluted Sb-mining areas in Extremadura (Spain)

    International Nuclear Information System (INIS)

    A study about topsoil antimony distribution and mobility from the soils to the biomass has been afforded in three abandoned Sb mining areas located at Extremadura. Physico-chemical characteristics of the soils and total antimony levels were measured in soils and autochthonous plant species (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa). Comparison with corresponding values in reference areas isolated from the mining activities is discussed. Antimony mobility in the soils was estimated by measuring the water extractable fraction; low results were obtained for the three soil areas, with no statistical differences. Plant ability to accumulate antimony was estimated by use of plant accumulation coefficients (PAC). Seasonal (spring vs. autumn) effects on the antimony content in the plant species. Cytisus striatus from Mari Rosa mine presented antimony excluder characteristics, whereas Dittrichia viscosa specimens growing in San Antonio mine showed a significant antimony bioaccumulation. - Bioaccumulation of antimony in vegetal species growing in mining areas

  11. Antimony distribution and mobility in topsoils and plants (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa) from polluted Sb-mining areas in Extremadura (Spain)

    Energy Technology Data Exchange (ETDEWEB)

    Murciego, A. Murciego [Area de Cristalografia y Mineralogia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Sanchez, A. Garcia [IRNA-CSIC, Departamento de Geoquimica Ambiental, Aptdo. 257, Salamanca (Spain); Gonzalez, M.A. Rodriguez [Area de Cristalografia y Mineralogia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Gil, E. Pinilla [Departamento de Quimica Analitica y Electroquimica, Facultad de Ciencias, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain)]. E-mail:; Gordillo, C. Toro [Departamento de Quimica Analitica y Electroquimica, Facultad de Ciencias, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Fernandez, J. Cabezas [Area de Ecologia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain); Triguero, T. Buyolo [Area de Ecologia, Universidad de Extremadura, Avda. Elvas, s/n, E-06071 Badajoz (Spain)


    A study about topsoil antimony distribution and mobility from the soils to the biomass has been afforded in three abandoned Sb mining areas located at Extremadura. Physico-chemical characteristics of the soils and total antimony levels were measured in soils and autochthonous plant species (Cytisus striatus, Cistus ladanifer and Dittrichia viscosa). Comparison with corresponding values in reference areas isolated from the mining activities is discussed. Antimony mobility in the soils was estimated by measuring the water extractable fraction; low results were obtained for the three soil areas, with no statistical differences. Plant ability to accumulate antimony was estimated by use of plant accumulation coefficients (PAC). Seasonal (spring vs. autumn) effects on the antimony content in the plant species. Cytisus striatus from Mari Rosa mine presented antimony excluder characteristics, whereas Dittrichia viscosa specimens growing in San Antonio mine showed a significant antimony bioaccumulation. - Bioaccumulation of antimony in vegetal species growing in mining areas.

  12. The MRP1-mediated effluxes of arsenic and antimony do not require arsenic-glutathione and antimony-glutathione complex formation. (United States)

    Salerno, Milena; Petroutsa, Maria; Garnier-Suillerot, Arlette


    Arsenic trioxide is an effective treatment for acute promyelocytic leukemia, but resistance to metalloid salts is found in humans. Using atomic absorption spectroscopy, we have measured the rate of uptake of arsenic trioxide and of antimony tartrate in GLC4 and GLC4/ADR cells overexpressing MRP1 and the rate of their MRP1-mediated effluxes as a function of the intracellular GSH concentration. In sensitive cells, after 1 h, a pseudosteady state is reached where intra- and extracellular concentrations of metalloid are the same. This precludes the formation, at short term, of complexes between arsenic or antimony with GSH. In resistant cells reduced intracellular accumulation of arsenic (or antimony), reflecting an increased rate of arsenic (or antimony) efflux from the cells, is observed. No efflux of the metalloid is observed in GSH depleted cells. The two metalloids and GSH are pumped out by MRP1 with the same efficiency. Moreover for the three compounds 50% of the efflux is inhibited by 2 microM MK571. This led us to suggest that As- and Sb-containing species could be cotransported with GSH. PMID:12018890

  13. Levels and risk factors of antimony contamination in human hair from an electronic waste recycling area, Guiyu, China. (United States)

    Huang, Yue; Ni, Wenqing; Chen, Yaowen; Wang, Xiaoling; Zhang, Jingwen; Wu, Kusheng


    The primitive electronic waste (e-waste) recycling has brought a series of environmental pollutants in Guiyu, China. Antimony is one of the important metal contaminants and has aroused the global concerns recently. We aimed to investigate concentrations of antimony in human hair from Guiyu and compared them with those from a control area where no e-waste recycling exists, and assessed the potential risk factors. A total of 205 human hair samples from Guiyu and 80 samples from Jinping were collected for analysis. All volunteers were asked to complete a questionnaire including socio-demographic characteristics and other possible factors related to hair antimony exposure. The concentrations of hair antimony were analyzed using atomic absorption spectrophotometer. Our results indicated that the level of hair antimony in volunteers from Guiyu (median, 160.78; range, 6.99-4412.59 ng/g) was significantly higher than those from Jinping (median, 61.74; range, 2.98-628.43 ng/g). The residents who engaged in e-waste recycling activities in Guiyu had higher hair antimony concentrations than others (P < 0.001). There was no significant difference of hair antimony concentrations among different occupation types in e-waste recycling. Multiple stepwise regression analysis indicated that hair antimony concentrations were associated with education level (β = -0.064), the time of residence in Guiyu (β = 0.112), living house also served as e-waste workshop (β = 0.099), the work related to e-waste (β = 0.169), and smoking (β = 0.018). The elevated hair antimony concentrations implied that the residents in Guiyu might be at high risk of antimony contamination, especially the e-waste recycling workers. Work related to e-waste recycling activities and long-time residence in Guiyu contributed to the high hair antimony exposure. PMID:25501644

  14. Predictors of an unsatisfactory response to pentavalent antimony in the treatment of American visceral leishmaniasis

    Directory of Open Access Journals (Sweden)

    Santos Mácia A.


    Full Text Available Although treatment of visceral leishmaniasis with pentavalent antimony is usually successful, some patients require second-line drug therapy, most commonly with amphotericin B. To identify the clinical characteristics that predict an inadequate response to pentavalent antimony, a case-control study was undertaken in Teresina, Piaui, Brazil. Over a two-year period, there were 19 cases of VL in which the staff physicians of a hospital prescribed second-line therapy with amphotericin B after determining that treatment with pentavalent antimony had failed. The control group consisted of 97 patients that were successfully treated with pentavalent antimony. A chart review using univariate and multivariate analysis was performed. The cure rate was 90% with amphotericin B. The odds ratio for the prescription of amphotericin B was 10.2 for children less than one year old, compared with individuals aged over 10 years. Patients who presented coinfection had an OR of 7.1 while those on antibiotics had an OR of 2.8. These data support either undertaking a longer course of therapy with pentavalent antimony for children or using amphotericin B as a first-line agent for children and individuals with coinfections. It also suggests that chemoprophylaxis directed toward bacterial coinfection in small children with VL may be indicated.

  15. Arsenic and antimony removal from drinking water by adsorption on granular ferric oxide. (United States)

    Sazakli, Eleni; Zouvelou, Stavroula V; Kalavrouziotis, Ioannis; Leotsinidis, Michalis


    Arsenic and antimony occur in drinking water due to natural weathering or anthropogenic activities. There has been growing concern about their impact on health. The aim of this study was to assess the efficiency of a granular ferric oxide adsorbent medium to remove arsenic and antimony from drinking water via rapid small-scale column tests (RSSCTs). Three different water matrices - deionized, raw water treated with a reverse osmosis domestic device and raw water - were spiked with arsenic and/or antimony to a concentration of 100 μg L⁻¹. Both elements were successfully adsorbed onto the medium. The loadings until the guideline value was exceeded in the effluent were found to be 0.35-1.63 mg g⁻¹ for arsenic and 0.12-2.11 mg g⁻¹ for antimony, depending on the water matrix. Adsorption of one element was not substantially affected by the presence of the other. Aeration did not affect significantly the adsorption capacity. Granular ferric oxide could be employed for the simultaneous removal of arsenic and antimony from drinking water, whereas full-scale systems should be assessed via laboratory tests before their implementation.

  16. Determination of traces of uranium and thorium in antimony(III) oxide by ICP-MS

    International Nuclear Information System (INIS)

    Traces of uranium and thorium in antimony(III) oxide were determined by inductively coupled plasma mass spectrometry (ICP-MS). A method of vaporization as the halide was applied to the separation of the analytes from the antimony matrix. Because the above separation method is so simple, reduced of external contamination was expected. In the case of vaporization using hydrochloric acid, however, it was found that antimony trichloride ions overlapped thorium ion of 232 (m/z). To find the most suitable conditions for matrix separation, vaporization behaviors were studied by using different acidic solutions such as HBr, HBr-HClO4 and HBr-H2SO4. Neither HBr+HClO4 nor HBr+H2SO4 was able to reduce the antimony matrix down to an unaffected level on ICP-MS measurement. On the other hand, in the case of the vaporization using hydrobromic acid, almost all the antimony matrix was removed. Determination limits obtained by this method were 0.02 and 0.03 ng g-1 for uranium and thorium, respectively. (author)

  17. Antimony bioavailability: knowledge and research perspectives for sustainable agricultures. (United States)

    Pierart, Antoine; Shahid, Muhammad; Séjalon-Delmas, Nathalie; Dumat, Camille


    The increasing interest in urban agriculture highlights the crucial question of crop quality. The main objectives for environmental sustainability are a decrease in chemical inputs, a reduction in the level of pollutants, and an improvement in the soil's biological activity. Among inorganic pollutants emitted by vehicle traffic and some industrial processes in urban areas, antimony (Sb) is observed on a global scale. While this metalloid is known to be potentially toxic, it can transfer from the soil or the atmosphere to plants, and accumulate in their edible parts. Urban agriculture is developing worldwide, and could therefore increasingly expose populations to Sb. The objective of this review was in consequences to gather and interpret actual knowledge of Sb uptake and bioaccumulation by crops, to reveal investigative fields on which to focus. While there is still no legal maximal value for Sb in plants and soils, light has to be shed on its accumulation and the factors affecting it. A relative absence of data exists about the role of soil flora and fauna in the transfer, speciation and compartmentation of Sb in vegetables. Moreover, little information exists on Sb ecotoxicity for terrestrial ecosystems. A human risk assessment has finally been reviewed, with particular focus on Sb bioaccessibility.

  18. Dicty_cDB: SLA117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA117 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SLA117Z 649 - - - - Show SLA117 Library SL (Link to library) Clone ID SLA117 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...--EPMHRNYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...SYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANP HAKGKVLLVKNNILTRVKDGGFTLSLKPMCCSGHNSHIPLYF

  19. 13 CFR 117.20 - Supervision and coordination. (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Supervision and coordination. 117... AMENDED § 117.20 Supervision and coordination. The Administrator may from time to time assign to officials... responsibility for final decision as provided in § 117.17), including the achievement of effective...

  20. 33 CFR 117.129 - Little Red River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little Red River. 117.129 Section 117.129 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Arkansas § 117.129 Little Red River. The draws of...

  1. 25 CFR 117.15 - Collections from insurance companies. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Collections from insurance companies. 117.15 Section 117... COMPETENCY § 117.15 Collections from insurance companies. Moneys collected from insurance companies for loss... property. Moneys collected from insurance companies for loss or damage to unrestricted real or...

  2. 33 CFR 117.297 - Little Manatee River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little Manatee River. 117.297 Section 117.297 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.297 Little Manatee River. The draw...

  3. 33 CFR 117.9 - Delaying opening of a draw. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Delaying opening of a draw. 117.9... DRAWBRIDGE OPERATION REGULATIONS General Requirements § 117.9 Delaying opening of a draw. No person shall unreasonably delay the opening of a draw after the signals required by § 117.15 have been given. Note:...

  4. 23 CFR 660.117 - Funding, records and accounting. (United States)


    ... their FH records according to 49 CFR part 18. (f) Funds provided to the FHWA by a cooperator should be... 23 Highways 1 2010-04-01 2010-04-01 false Funding, records and accounting. 660.117 Section 660.117... SPECIAL PROGRAMS (DIRECT FEDERAL) Forest Highways § 660.117 Funding, records and accounting. (a)...

  5. 46 CFR 117.130 - Stowage of survival craft. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Stowage of survival craft. 117.130 Section 117.130... AND ARRANGEMENTS Survival Craft Arrangements and Equipment § 117.130 Stowage of survival craft. (a) Each survival craft must be: (1) Secured to the vessel by a painter with a float-free link...

  6. 46 CFR 117.175 - Survival craft equipment. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft equipment. 117.175 Section 117.175... AND ARRANGEMENTS Survival Craft Arrangements and Equipment § 117.175 Survival craft equipment. (a) General. Each item of survival craft equipment must be of good quality, and efficient for the purpose...

  7. 46 CFR 117.200 - Survival craft-general. (United States)


    ... by this subpart. Such boats must meet the requirements for safe loading and flotation in 33 CFR Part... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-general. 117.200 Section 117.200 Shipping... Number and Type of Survival Craft § 117.200 Survival craft—general. (a) Each survival craft required on...

  8. 46 CFR 201.117 - Inclusion in record. (United States)


    ... 46 Shipping 8 2010-10-01 2010-10-01 false Inclusion in record. 201.117 Section 201.117 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION POLICY, PRACTICE AND PROCEDURE RULES OF PRACTICE AND PROCEDURE Discovery and Depositions (Rule 11) § 201.117 Inclusion in record. No deposition or part...

  9. 33 CFR 117.167 - Little Potato Slough. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little Potato Slough. 117.167 Section 117.167 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.167 Little Potato Slough. The draw...

  10. 33 CFR 117.1051 - Lake Washington Ship Canal. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lake Washington Ship Canal. 117.1051 Section 117.1051 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Washington § 117.1051 Lake Washington...

  11. 33 CFR 117.751 - Shark River (South Channel). (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Shark River (South Channel). 117.751 Section 117.751 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.751 Shark River...

  12. 32 CFR 643.117 - Hunting, trapping, and fishing. (United States)


    ... 32 National Defense 4 2010-07-01 2010-07-01 true Hunting, trapping, and fishing. 643.117 Section 643.117 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) REAL PROPERTY REAL ESTATE Additional Authority of Commanders § 643.117 Hunting, trapping, and...

  13. 46 CFR 117.70 - Ring life buoys. (United States)


    ... the body of the ring life buoy. (3) Each floating waterlight installed after March 11, 1997, on a... 46 Shipping 4 2010-10-01 2010-10-01 false Ring life buoys. 117.70 Section 117.70 Shipping COAST... Ring Life Buoys and Life Jackets § 117.70 Ring life buoys. (a) A vessel must have one or more ring...

  14. 24 CFR 27.117 - Transfer of title and possession. (United States)


    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Transfer of title and possession. 27.117 Section 27.117 Housing and Urban Development Office of the Secretary, Department of Housing... Foreclosure of Single Family Mortgages § 27.117 Transfer of title and possession. (a) If the Secretary is...

  15. 25 CFR 117.10 - Purchase of automotive equipment. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Purchase of automotive equipment. 117.10 Section 117.10... COMPETENCY § 117.10 Purchase of automotive equipment. The superintendent may disburse from the surplus funds of an adult Indian not to exceed $2,000 for the purchase of automotive equipment when the...

  16. 47 CFR 95.117 - Where to contact the FCC. (United States)


    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Where to contact the FCC. 95.117 Section 95.117... SERVICES General Mobile Radio Service (GMRS) § 95.117 Where to contact the FCC. Additional GMRS information may be obtained from any of the following sources: (a) FCC National Call Center at 1-888-225-5322....

  17. 28 CFR 0.117 - Office of Chief Immigration Judge. (United States)


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Office of Chief Immigration Judge. 0.117 Section 0.117 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Executive Office for Immigration Review § 0.117 Office of Chief Immigration Judge. The Chief...


    Frizzell, Virgil A.; Hale, William N.


    The study area, consisting of the Sespe-Frazier, Diablo, Matilija, Dry Lakes, Sawmill-Badlands, Cuyama, Antimony, and Quatal Roadless Areas, occupies about 872 sq mi in the Los Padres National Forest, California. Studies indicate that the Sespe-Frazier Roadless Area contains demonstrated resources of gold, gypsum, phosphate and bentonite; deposits in the Cuyama Roadless Area have demonstrated resources of gypsum; mines in the Antimony Roadless Area have demonstrated resources of antimony, gold, silver, and marble; and the Quatal Roadless Area has demonstrated resources of bentonite. The Sespe-Frazier Roadless Area has substantiated potential for geothermal resources suitable for direct-heat purposes, probable and substantiated potential for oil and gas resources, and probable potential for gold resources. Small areas of probable resource potential for antimony and gold were identified in Antimony Roadless Area.

  19. Mixed Antimony(V Complexes with Different Sugars to Modulate the Oral Bioavailability of Pentavalent Antimonial Drugs

    Directory of Open Access Journals (Sweden)

    Weverson A. Ferreira


    Full Text Available Previous studies have shown that the association of the drug meglumine antimoniate (MA with β-cyclodextrin can improve its bioavailability by the oral route. In this work, ribose and maltose were investigated for their ability to form mixed or association complexes with MA, release MA and modulate the serum levels of Sb after oral administration in mice. Analysis of the MA/ribose composition by high performance liquid chromatography coupled to mass spectrometry (LCMS-IT-TOF revealed the presence of mixed meglumine-Sb-ribose and Sb-ribose complexes. Analysis of the MA/maltose composition suggested the formation of MA-maltose association compounds. Circular dichroism characterization of these compositions following dilution in water at 37 °C suggested a partial and slow dissociation of the association compounds. When the MA/ribose composition was administered orally and compared to MA, the serum concentration of Sb was significantly lower after 1 h and greater after 3 h. On the other hand, the MA/maltose composition showed similar serum Sb concentration after 1 h and higher level of Sb after 3 h, when compared to MA. In conclusion, the present study has demonstrated the formation of mixed or association complexes of MA with sugars, such as maltose and ribose, which promoted sustained serum level of Sb after oral administration.

  20. Anodic stripping voltammetry of antimony using gold nanoparticle-modified carbon screen-printed electrodes

    International Nuclear Information System (INIS)

    Carbon screen-printed electrodes (CSPE) modified with gold nanoparticles present an interesting alternative in the determination of antimony using differential pulse anodic stripping voltammetry. Metallic gold nanoparticles deposits have been obtained by direct electrochemical deposition. Scanning electron microscopy measurements show that the electrochemically synthesized gold nanoparticles are deposited in aggregated form. Any undue effects caused by the presence of foreign ions in the solution were also analyzed to ensure that common interferents in the determination of antimony by ASV. The detection limit for Sb(III) obtained was 9.44 x 10-10 M. In terms of reproducibility, the precision of the above mentioned method in %R.S.D. values was calculated at 2.69% (n = 10). The method was applied to determine levels of antimony in seawater samples and pharmaceutical preparations

  1. Synthesis of barium mercaptides and application of antimony/barium mercaptides

    Institute of Scientific and Technical Information of China (English)

    瞿龙; 张露露; 舒万艮


    Mercaptoacetic acid, isooctyl thioglycolate and barium hydroxide used as start materials, barium bis (2-ethylhexyl thioglycolate) (Ba(2EHTG)2), barium thioglycolate (Ba(TG)) and barium bisthioglycolate (Ba(TG)2) were synthesized. Their optimum synthetic techniques were discussed, and some physicochemical data were reported. Infrared spectroscopy and elemental analysis methods were used to identify the structures. They were put into PVC plastic products together with antimony tris (2-ethylhexyl thioglycolate) (Sb(2EHTG)3) under the suitable compounding, and their heat stability to PVC was studied. It is shown that these barium mercaptides have remarkable synergisms with antimony mercaptides and the long-term stabilizing effect of organoantimony stabilizer can be effectively improved, reducing the amount of antimony compounds so as to avoid the decrease of its stabilizing effect.

  2. Response of cutaneous leishmaniasis (chiclero's ulcer) to treatment with meglumine antimoniate in Southeast Mexico. (United States)

    Vargas-Gonzalez, A; Canto-Lara, S B; Damian-Centeno, A G; Andrade-Narvaez, F J


    Cutaneous leishmaniasis, known as chiclero's ulcer in southeastern Mexico, is characterized by a predominantly single, painless, ulcerated lesion, without lymphangitis or adenopathy. When located on the ear, it tends to become chronic, causing destruction of the pinna and disfigurement. It is caused predominantly by Leishmania (L.) mexicana. Although pentavalent antimonials (Sb5+) are the mainstay of leishmanial therapy and have been used for more than 50 years, dosage regimens have been repeatedly modified and the best one has not been fully identified. The main purpose of the present study was to investigate the response of chiclero's ulcer to treatment with meglumine antimoniate. One hundred five patients were treated with meglumine antimoniate at a daily dose of 1 ampule per day (425 mg of Sb5+) until healing. The lesions healed after a mean of 25 days (range = 5-60 days). PMID:10674678

  3. Geothermal and fluid flowing simulation of ore-forming antimony deposits in Xikuangshan

    Institute of Scientific and Technical Information of China (English)

    YANG Ruiyan; MA Dongsheng; BAO Zhengyu; PAN Jiayong; CAO Shuanglin; XIA Fei


    The Xikuangshan Antimony Deposit located in the Mid-Hunan Basin, China, is the largest antimony deposit in the world. Based on the hydrogeological and geochemical data collected from four sections, Xikuangshan-Dajienao (AO), Xikuangshan-Dashengshan (BO), Xikuangshan-Longshan (CO) and Dafengshan (DO) in the Basin, an advanced metallogenic model related to deep-cyclic meteoric water of Xikuangshan Antimony Deposit is put forward in this paper using a model of heat-gravity-driving fluid flow transportation. The simulation results show that the ore-forming fluid of the deposit mainly comes from the Dashengshan and Longshan areas where BO and CO sections are located if the overall basin keeps a constant atmospheric precipitation and infiltration rate during mineralization, and that the average transportation speed of the ore-forming fluids is about 0.2-0.4 m/a.

  4. On-line lab-in-syringe cloud point extraction for the spectrophotometric determination of antimony. (United States)

    Frizzarin, Rejane M; Portugal, Lindomar A; Estela, José M; Rocha, Fábio R P; Cerdà, Victor


    Most of the procedures for antimony determination require time-consuming sample preparation (e.g. liquid-liquid extraction with organic solvents), which are harmful to the environment. Because of the high antimony toxicity, a rapid, sensitive and greener procedure for its determination becomes necessary. The goal of this work was to develop an analytical procedure exploiting for the first time the cloud point extraction on a lab-in-syringe flow system aiming at the spectrophotometric determination of antimony. The procedure was based on formation of an ion-pair between the antimony-iodide complex and H(+) followed by extraction with Triton X-114. The factorial design showed that the concentrations of ascorbic acid, H2SO4 and Triton X-114, as well as second and third order interactions were significant at the 95% confidence level. A Box-Behnken design was applied to obtain the response surfaces and to identify the critical values. System is robust at the 95% confidence level. A linear response was observed from 5 to 50 µg L(-1), described by the equation A=0.137+0.050C(Sb) (r=0.998). The detection limit (99.7% confidence level), the coefficient of variation (n=5; 15 µg L(-1)) and the sampling rate was estimated at 1.8 µg L(-1), 1.6% and 16 h(-1), respectively. The procedure allows quantification of antimony in the concentrations established by environmental legislation (6 µg L(-1)) and it was successfully applied to the determination of antimony in freshwater samples and antileishmanial drugs, yielding results in agreement with those obtained by HGFAAS at the 95% confidence level.

  5. Future trends of global atmospheric antimony emissions from anthropogenic activities until 2050 (United States)

    Zhou, Junrui; Tian, Hezhong; Zhu, Chuanyong; Hao, Jiming; Gao, Jiajia; Wang, Yong; Xue, Yifeng; Hua, Shenbin; Wang, Kun


    This paper presents the scenario forecast of global atmospheric antimony (Sb) emissions from anthropogenic activities till 2050. The projection scenarios are built based on the comprehensive global antimony emission inventory for the period 1995-2010 which is reported in our previous study. Three scenarios are set up to investigate the future changes of global antimony emissions as well as their source and region contribution characteristics. Trends of activity levels specified as 5 primary source categories are projected by combining the historical trend extrapolation with EIA International energy outlook 2013, while the source-specific dynamic emission factors are determined by applying transformed normal distribution functions. If no major changes in the efficiency of emission control are introduced and keep current air quality legislations (Current Legislation scenario), global antimony emissions will increase by a factor of 2 between 2010 and 2050. The largest increase in Sb emissions is projected from Asia due to large volume of nonferrous metals production and waste incineration. In case of enforcing the pollutant emission standards (Strengthened Control scenario), global antimony emissions in 2050 will stabilize with that of 2010. Moreover, we can anticipate further declines in Sb emissions for all continents with the best emission control performances (Maximum Feasible Technological Reduction scenario). Future antimony emissions from the top 10 largest emitting countries have also been calculated and source category contributions of increasing emissions of these countries present significant diversity. Furthermore, global emission projections in 2050 are distributed within a 1° × 1°latitude/longitude grid. East Asia, Western Europe and North America present remarkable differences in emission intensity under the three scenarios, which implies that source-and-country specific control measures are necessary to be implemented for abating Sb emissions from

  6. Studies on Thin Films of Antimony Vacuum Evaporated from a Knudsen-Type Source

    Directory of Open Access Journals (Sweden)

    K.L. Chaudhary


    Full Text Available A Knudsen-type evaporation source was used for the deposition of thin films of antimony to study their growth and microstructure under different rates of evaporation and substrate temperatures when vacuum evaporated onto air-cleaved KC1, mica, amorphous carbon and doped KCl substrates. The crystallisation of these films on exposure to an electron beam of moderate intensity inside the electron microscope was studied, and the orientations of the crystallised films wrt the substrate were established. It has been concluded that antimony films prepared by this source compare well with those prepared by other sources of vacuum evaporation.

  7. Co-doping with antimony to control phosphorous diffusion in germanium

    KAUST Repository

    Tahini, H. A.


    In germanium, phosphorous and antimony diffuse quickly and as such their transport must be controlled in order to design efficient n-typed doped regions. Here, density functional theory based calculations are used to predict the influence of double donor co-doping on the migration activation energies of vacancy-mediated diffusion processes. The migration energy barriers for phosphorous and antimony were found to be increased significantly when larger clusters involving two donor atoms and a vacancy were formed. These clusters are energetically stable and can lead to the formation of even larger clusters involving a number of donor atoms around a vacancy, thereby affecting the properties of devices.

  8. Influence of cooling rate and antimony addition content on graphite morphology and mechanical properties of a ductile iron

    Directory of Open Access Journals (Sweden)

    Liu Zhe


    Full Text Available Cooling rate and inoculation practice can greatly affect the graphite morphology of ductile irons. In the present research, the effects of the cooling rate and antimony addition on the graphite morphology and mechanical properties of ductile irons have been studied. Three ductile iron castings were prepared through solidification under cooling conditions S (slow, M (medium and F (fast. The cooling rates around the equilibrium eutectic temperature (1,150 ℃ for these cooling conditions (S, M and F were set at 0.21 ℃·min-1, 0.32 ℃·min-1 and 0.37 ℃·min-1, respectively. In addition, four ductile iron castings were prepared by adding 0.01%, 0.02%, 0.03% and 0.04% (by weight antimony, respectively under the slow cooling condition. The results show that the nodularity index, tensile strength and hardness of the ductile iron castings without antimony addition are all improved with the increase of cooling rate, while the ductile iron casting solidified under the medium cooling rate possesses the largest number of graphite nodules. Furthermore, for the four antimony containing castings, the graphite morphology and tensile strength are also improved by the antimony additions, and the effect of antimony addition is intensified when the addition increases from 0.01% to 0.03%. Moreover, the rare earth elements (REE/antimony ratio of 2 appears to be the most effective for fine nodular graphite formation in ductile iron.

  9. Commerce Ministry Announced the Export Quotas for Zinc,Antimony,Tungsten,Tin and Silver

    Institute of Scientific and Technical Information of China (English)


    <正> The Ministry of Commerce recently announcedits decision on the export quotas for zinc,anti-mony,tungsten,tin and silver in 2004.Accord-ing to the data released,all the export quotasare reduced except for silver.Relevant peoplesay that the raw materials shortage is a majorissue for the production of antimony and tin,

  10. Determination of barium and antimony in gun shot residues by neutron activation analysis

    International Nuclear Information System (INIS)

    The antimony contents on both hands of 7 persons before and after firing an automatic pistol were determined by instrumental neutron activation analysis. The gun shot residues were removed from hands by a 4% solution of cellulose acetate in acetone. The average content of antimony on both hands before firing obtained from 70 measurements (35 from each hand) was 0.040 ± 0.010 micro gram, whereas the average contents on the right and the left hands after 1 firing were 0.385 ± 0.036 and 0.144 ± 0.029 micro gram respectively. The ration of the antimony contents after 1 firing to the normal level (before firing) was 9.9 for the right and 3.6 for the left. No significant difference was observed between male and female, smoker and non-smoker. The antimony content after several firings was not much different from that of 1 firing and it reduced to the normal level within 2 days after firing. The barium contents before and after firing were studied from one person. Barium was precipitated as Ba SO4 before counting. An average contents of 0.936 ± 0.551 micro gram for both hands before firing, 4.092 ± 2.687 micro gram for the right hand and 1.363 ± 0.879 micro gram for the left hand after 1 firing were found

  11. Investigation on the thermal radiation properties of antimony doped tin oxide particles

    Institute of Scientific and Technical Information of China (English)

    Fu Cheng-Wu; Zhang Shuan-Qin; Chen Ming-Qing


    This paper reports the preparation of antimony doped tin oxide crystalline powders by chemical coprecipitation method. The influence of sintering temperature and the sintering retention time on the thermal infrared emissivity is analysed. The thermal infrared reflectivity is measured and the optimum doping concentration is proposed.

  12. Thermodynamics for arsenic and antimony in copper matte converting—computer simulation (United States)

    Chaubal, P. C.; Nagamori, M.


    Thermodynamic data for arsenic and antimony and their sulfide and oxide gases have been critically reviewed and compiled. The entropy values for AsS(g), SbS(g), and BiS(g) have been recalculated based on a statistical thermodynamic method. The standard heat of formation and entropy of As2O3(g) have been newly assessed to be △H{298/0} = -81,500 cal/mole and S{298/0} = 81.5 cal/deg/mole. Copper matte converting has been mathematically described using the stepwise equilibrium simulation technique together with quadratic approximations of oxygen and magnetite solubilities in molten mattes. A differential equation for the volatilization of arsenic and antimony has been derived and solved for successive reaction microsteps, whereby the volatilization, slagging, and alloying of the minor elements in copper matte converting have been examined as functions of reaction time and other process variables. Only the first (slag-making) stage of converting is responsible for the elimination of arsenic and antimony by volatilization. Arsenic volatilizes mainly as AsS(g) and AsO(g), with As2(g) also contributing when initial mattes are unusually rich in arsenic (above 0.5 pct arsenic). Antimony volatilizes chiefly as SbS(g), and the contributions of other gases such as SbO(g) and Sb(g) always remain negligibly low. The results of the stepwise equilibrium simulation compare favorably with the industrial operating data.

  13. Synthesis of antimony tris(mercaptoethyl carboxylates) as thermal stabilizer for polyvinyl chloride

    Institute of Scientific and Technical Information of China (English)

    舒万艮; 刘又年; 陈启元


    A novel type of thermal stabilizers-antimony tris(mercaptoethyl carboxylates) (Sb(SCH2CH2OOCR) 3), was synthesized from carboxylic acid, antimony trioxide and 2-mercaptoethanol in two steps. The experimental results show that the molar ratio of carboxylic acid to antimony tris(2-hydroxyethyl mercaptide) is 1.2, when adding 0.6% tetra-n-butyl titanate as catalyst and xylene as isotropic solvent, heating and refluxing for about 2~4h. The thermal stability was measured by heat-aging oven test. The thermal stability time is about 8~40min(at 200℃) when adding 2% tetra-n-butyl titanate in polyvinyl chloride(PVC). Among these stabilizers, antimony tris(mercaptoethyl stearate) has best thermal stability. Its thermal stability is better than that of Ca-Zn complex and basic lead stabilizers, and equal to that of organotin. In addition, the stabilization mechanism of this kind of stabilizers for PVC was discussed briefly.

  14. Antimony production by carbothermic reduction of stibnite in the presence of lime

    Directory of Open Access Journals (Sweden)

    Padilla R.


    Full Text Available Experimental work on the carbothermic reduction of Sb2S3 in the presence of lime was carried out in the temperature range of 973 to 1123 K to produce antimony in an environmentally friendly manner. The results demonstrated the technical feasibility of producing antimony by this method without producing SO2 gas. Complete conversion of Sb2S3 was obtained at 1023 K in about 1000 seconds and at 1123 K in less than 250 seconds using stibnite-carbon-lime mixtures with molar ratios Sb2S3:CaO:C = 1:3:3. It was found that the reduction proceeds through the formation of an intermediate oxide SbO2, which is subsequently reduced by CO(g to yield antimony metal and CaS. The kinetics of the Sb2S3 reduction was analyzed by using the equation ln(1-X = -kt. The activation energy was 233 kJ mol-1 in the temperature range of 973 to 1123 K. This value would correspond to an antimony catalyzed carbon oxidation by CO2.

  15. Antimonial drugs entrapped into phosphatidylserine liposomes: physicochemical evaluation and antileishmanial activity

    Directory of Open Access Journals (Sweden)

    Samanta Etel Treiger Borborema


    Full Text Available Abstract: INTRODUCTION: Leishmaniasis is a disease caused by the protozoan Leishmania that resides mainly in mononuclear phagocytic system tissues. Pentavalent antimonials are the main treatment option, although these drugs have toxic side effects and high resistance rates. A potentially alternative and more effective therapeutic strategy is to use liposomes as carriers of the antileishmanial agents. The aims of this study were to develop antimonial drugs entrapped into phosphatidylserine liposomes and to analyze their biological and physicochemical characteristics. METHODS: Liposomes containing meglumine antimoniate (MA or pentavalent antimony salt (Sb were obtained through filter extrusion (FEL and characterized by transmission electron microscopy. Promastigotes of Leishmania infantum were incubated with the drugs and the viability was determined with a tetrazolium dye (MTT assay. The effects of these drugs against intracellular amastigotes were also evaluated by optical microscopy, and mammalian cytotoxicity was determined by an MTT assay. RESULTS: Liposomes had an average diameter of 162nm. MA-FEL showed inhibitory activity against intracellular L. infantum amastigotes, with a 50% inhibitory concentration (IC50 of 0.9μg/mL, whereas that of MA was 60μg/mL. Sb-FEL showed an IC50 value of 0.2μg/mL, whereas that of free Sb was 9μg/mL. MA-FEL and Sb-FEL had strong in vitro activity that was 63-fold and 39-fold more effective than their respective free drugs. MA-FEL tested at a ten-times higher concentration than Sb-FEL did not show cytotoxicity to mammalian cells, resulting in a higher selectivity index. CONCLUSIONS: Antimonial drug-containing liposomes are more effective against Leishmania-infected macrophages than the non-liposomal drugs.

  16. Electrodes modified with bismuth, antimony and tin precursor compounds for electrochemical stripping analysis of trace metals (a short review)


    Lezi, Nikolitsa; Economou, Anastasios; Barek, Jiří


    Over the last decade, intensive research is being carried out towards the development of “green” electrochemical sensors. Bismuth, antimony and tin electrodes have been proposed as potential substitutes of mercury electrodes in electrochemical stripping analysis of trace metals. The main advantage of these metals as electrode materials is their lower toxicity compared to mercury. Among the different configuration of bismuth, antimony and tin electrodes, one of the most attractive inv...

  17. Investigation into properties of the mixture of perfluoro-2-methyl-bicyclo(4,4,0) decane with antimony fluoride

    International Nuclear Information System (INIS)

    State diagram was constructed for a binary system formed by antimony fluoride and perfluoro-2-methyl-bicyclo-(4,4,0)decane in the temperature range of -58 deg to +56 deg C. Temperature dependence of solubility and the differential molar heat of solubility of solid Sb F5 were determined. Above the melting point of antimony fluoride these components were found to form a system of two sparingly miscible liquids with upper critical dissolution temperature

  18. Electrodeposition of SnSbCu Alloy on Copper from an Electrolyte with Varied Content of Antimony Chloride (United States)

    Valeeva, A. Kh.; Valeev, I. Sh.


    The microstructure and chemical composition of electrodeposited alloys of the SnSbCu system with varied concentration of antimony chloride in the electrolyte have been investigated. It is shown that during electrodeposition mechanical-mixture alloys are not formed, but rather intermetallic compounds. It is found that increasing the concentration of antimony chloride in the electrolyte leads to a decrease in the tin content and cracking of the coating.

  19. The Ministry of Land and Resources Continued to Impose Total Exploitation Control on Tungsten, Antimony and Rare Earth

    Institute of Scientific and Technical Information of China (English)


    <正>The General Office of the Ministry of Land and Resources distributed "Notice on Issuing Total Exploitation Control Quota of Tungsten Mine, Antimony Mine and Rare Earth Mine (First Batch) for 2013" (the "Notice") on January 5, it issued total exploitation control quota of tungsten mine, antimony mine and rare earth mine (first batch) for 2013. According to the Notice, the first batch of national

  20. CD117 expression on blast cells in acute myeloid leukemia

    Directory of Open Access Journals (Sweden)

    Goryainova N.V.


    Full Text Available The aim of the present work was to analyze the frequency of CD117 (c-KIT antigen expression on the blast cells in acute myeloid leukemia (AML, evaluation of the presence of the relationship between the expression of the c-KIT and leukemia according to the FAB classification and definition of co-expression of the antigen CD117, antigens CD33 and CD34. The data of 47 patients with AML were diagnosed. M0 AML variant was established in 3 (6% patients, M1 – in 2 (4%, M2 – in 9 (20%, M4 – in 22 (47% and M5 – in 11 (23%. For immunophenotypic stu¬dies monoclonal antibodies (mAb that detect antigens of anti-CD34, anti-CD33 and anti-CD117 (Becton Dickinson, USA were used. The presence of the antigen CD117 was detected in 39 people, accounting for 83% of all surveyed. Antigen c-KIT was present in 48.117.0% cells on average: in all 3 cases – AML M0, in2 cases of AML M1, in 6 cases – AML M2, 20 of 22 cases – AML M4 and in 8 of 11 AML M5 cases. Average levels of CD117 in investigated leukemia cases statistically differed significantly (p=0.0067. Among 39 CD117- positive patients in 25 (53% co-expression of CD117+/CD34+ was revealed. Expression of CD117+/CD34- was observed in 14 cases (30%, CD117-/CD34+ – in 4 cases (8,5%, CD117-/CD34- – in 4 cases (8.5%. CD34 had of 64% of cells of myeloid origin. A high positive cor¬relation between expression of CD117 and CD34 (r=+0,5169 was determined, being statistically significant (p0,0067.

  1. Treatment of antimony mine drainage: challenges and opportunities with special emphasis on mineral adsorption and sulfate reducing bacteria. (United States)

    Li, Yongchao; Hu, Xiaoxian; Ren, Bozhi


    The present article summarizes antimony mine distribution, antimony mine drainage generation and environmental impacts, and critically analyses the remediation approach with special emphasis on iron oxidizing bacteria and sulfate reducing bacteria. Most recent research focuses on readily available low-cost adsorbents, such as minerals, wastes, and biosorbents. It is found that iron oxides prepared by chemical methods present superior adsorption ability for Sb(III) and Sb(V). However, this process is more costly and iron oxide activity can be inhibited by plenty of sulfate in antimony mine drainage. In the presence of sulfate reducing bacteria, sulfate can be reduced to sulfide and form Sb(2)S(3) precipitates. However, dissolved oxygen and lack of nutrient source in antimony mine drainage inhibit sulfate reducing bacteria activity. Biogenetic iron oxide minerals from iron corrosion by iron-oxidizing bacteria may prove promising for antimony adsorption, while the micro-environment generated from iron corrosion by iron oxidizing bacteria may provide better growth conditions for symbiotic sulfate reducing bacteria. Finally, based on biogenetic iron oxide adsorption and sulfate reducing bacteria followed by precipitation, the paper suggests an alternative treatment for antimony mine drainage that deserves exploration.

  2. 33 CFR 117.615 - Plum Island River. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Plum Island River. 117.615... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.615 Plum Island River. The draw of the Plum Island Turnpike Bridge, mile 3.3 between Newburyport and Plum Island, shall operate...

  3. 33 CFR 117.598 - Eel Pond Channel. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Eel Pond Channel. 117.598 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Massachusetts § 117.598 Eel Pond Channel. The following requirements apply to the draw of Eel Pond (Water Street) drawbridge at mile 0.0 at...

  4. 33 CFR 117.927 - Coosaw River (Whale Branch). (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Coosaw River (Whale Branch). 117.927 Section 117.927 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... (Whale Branch). The draw of the Seaboard System Railroad bridge, mile 5.3 at Seabrook, and the draw...

  5. 49 CFR 382.117 - Public interest exclusion. (United States)


    ... ALCOHOL USE AND TESTING General § 382.117 Public interest exclusion. No employer shall use the services of a service agent who is subject to public interest exclusion in accordance with 49 CFR part 40... 49 Transportation 5 2010-10-01 2010-10-01 false Public interest exclusion. 382.117 Section...

  6. 25 CFR 117.14 - Miscellaneous expenditure of surplus funds. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Miscellaneous expenditure of surplus funds. 117.14... AND EXPENDITURE OF INDIVIDUAL FUNDS OF MEMBERS OF THE OSAGE TRIBE OF INDIANS WHO DO NOT HAVE CERTIFICATES OF COMPETENCY § 117.14 Miscellaneous expenditure of surplus funds. Upon application by an...

  7. 27 CFR 479.117 - Action by Customs. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Action by Customs. 479.117... OTHER FIREARMS Importation and Exportation Exportation § 479.117 Action by Customs. Upon receipt of a... of Customs may order such inspection as deemed necessary prior to lading of the merchandise....

  8. 29 CFR 784.117 - Combinations of exempt work. (United States)


    ... under another section of the Act, is permitted. Where a part of an employee's covered work in a workweek... work exempt from both the minimum wage and overtime requirements under another section of the Act. In... 29 Labor 3 2010-07-01 2010-07-01 false Combinations of exempt work. 784.117 Section 784.117...

  9. 27 CFR 24.117 - Maintenance of application file. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Maintenance of application file. 24.117 Section 24.117 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Maintenance of application file. The proprietor shall maintain an application file with the...

  10. 40 CFR 89.117 - Test fleet selection. (United States)


    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Test fleet selection. 89.117 Section... Certification Provisions § 89.117 Test fleet selection. (a) The manufacturer must select for testing, from each... of maximum torque and secondarily at rated speed. (b) Each engine in the test fleet must...

  11. 43 CFR 4.117 - Service of papers. (United States)


    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Service of papers. 4.117 Section 4.117... Service of papers. A copy of all pleadings, briefs, motions, letters, or other papers filed with the Board, shall be served upon the other party at the time of filing. Service of papers may be made personally...

  12. 9 CFR 117.6 - Removal of animals. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Removal of animals. 117.6 Section 117.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED...

  13. 9 CFR 117.3 - Admittance of animals. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Admittance of animals. 117.3 Section 117.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT...

  14. 9 CFR 117.5 - Segregation of animals. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Segregation of animals. 117.5 Section 117.5 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT...

  15. 33 CFR 117.307 - Miami River, North Fork. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Miami River, North Fork. 117.307... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.307 Miami River, North Fork. The draw of the FDOT Railroad Bridge, mile 5.3 at Miami, shall open on signal if at least 48-hour notice is...

  16. 14 CFR 121.117 - Airports: Required data. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airports: Required data. 121.117 Section... Operations § 121.117 Airports: Required data. (a) No certificate holder conducting supplemental operations may use any airport unless it is properly equipped and adequate for the proposed...

  17. [Physico-chemical characteristics of meglumine antimoniate in different storage conditions]. (United States)

    Romero, G A; de Oliveira, M R; Correia, D; Marsden, P D


    During the period October 1992 to July 1995 we measured the osmolarity and pH of ampoules of meglumine antimoniate (glucantime) from lot 9206L-004 (manufactured by Rhodia Farma Ltd, of São Paulo, SP, Brazil) maintained in three temperature conditions namely 4 degrees C, 37 degrees C and ambiental. Although we observed statistically significant differences in osmolarity between samples, the limited number of measurements and the variation of this property in ampoules maintained at the same temperature were obstacles to obtain definitive conclusions. Such a variation was not found with pH. Assuming these parameters could reflect structural changes in the pentavalent antimony molecule, clearly further better controlled experiments are indicated.

  18. Antimony segregation in stressed SiGe heterostructures grown by molecular beam epitaxy

    International Nuclear Information System (INIS)

    The effects of the growth temperature, composition, and elastic strains in separate layers on the segregation of antimony are studied experimentally for stressed SiGe structures grown by molecular beam epitaxy. It is established that the growth conditions and parameters of the structures exert an interrelated influence on the segregation of Sb: the degree of the influence of the composition and elastic stresses in the SiGe layers on Sb segregation depends on the growth temperature. It is shown that usage of a method previously proposed by us for the selective doping of silicon structures with consideration for the obtained dependences of Sb segregation on the growth conditions and parameters of the SiGe layers makes it possible to form SiGe structures selectively doped with antimony

  19. Deciphering lead and cadmium stripping peaks for porous antimony deposited electrodes

    Directory of Open Access Journals (Sweden)

    Taimoor Aqeel Ahmad


    Full Text Available Cadmium and lead are generally taken as model heavy metal ions in water to scale the detection limit of various electrode sensors, using electrochemical sensing techniques. These ions interact with the electrochemically deposited antimony electrodes depending on the diffusion limitations. The phenomenon acts differently for the in-situ and ex-situ deposition as well as for porous and non-porous electrodes. A method has been adopted in this study to discourage the stripping and deposition of the working ions (antimony to understand the principle of heavy metal ion detection. X-ray photoelectron spectroscopy (XPS technique was used to establish the interaction between the working and dissolved ions. In addition to the distinct peaks for each analyte, researchers also observed a shoulder peak. A possible reason for the presence of this peak was provided. Different electrochemical tests were performed to ascertain the theory on the basis of the experimental observations.

  20. A facile and fast route to prepare antimony (Sb) nanostructures without additives

    KAUST Repository

    Shah, M.A.


    Herein, we report a safe, low cost and reproducible approach for the synthesis of antimony (Sb) nanostructures with most of them having prism like morphology and having well defined faces in the range of ∼70210 nm. The organics free approach is based on a reaction of antimony powder and pure water at ∼210 °C without using any harmful additives and amines. The XRD pattern confirmed the composition and crystallinity of the grown nanostructures. The reported method besides being organics free is economical, fast and free of pollution, which will make it suitable for large scale production. Furthermore, it is well expected that such a technique could be extended to prepare many other important metal and metal oxide nanostructures. The prospects of the process are bright and promising. © 2012 Sharif University of Technology. Production and hosting by Elsevier B.V. All rights reserved.

  1. Bi-antimony capped Keggin polyoxometalate modified with Cu-ligand fragment

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Jiao [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Han, Zhangang, E-mail: [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Zhang, Heng; Yu, Haitao [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China); Zhai, Xueliang, E-mail: [College of Chemistry and Material Science, Hebei Normal University, No. 20 Road East of 2nd Ring South, Yuhua District, Shijiazhuang, Hebei 050024 (China)


    Three polyoxometalates consisting of bi-antimony capped Keggin-type clusters: [Cu(mbpy){sub 2}]{sub 2}[PMo{sub 12}O{sub 40}Sb{sub 2}]{center_dot}4H{sub 2}O (1), [Cu(mbpy){sub 2}][PMo{sub 12}O{sub 40}Sb{sub 2}] (2) and {l_brace}Cu(mbpy)[Cu(mbpy){sub 2}]{sub 2}{r_brace}[VMo{sub 8}V{sub 4}O{sub 40}Sb{sub 2}]{center_dot}2H{sub 2}O (3) (mbpy=4,4 Prime -dimethyl-2,2 Prime - dipyridyl in 1 and 2; 5,5 Prime -dimethyl-2,2 Prime -dipyridyl in 3) have been synthesized and characterized by IR, X-ray powder diffraction, TG analysis and electrochemical property. Single-crystal analysis revealed that all of three compounds are built upon bi-antimony capped Keggin-type polyoxoanions and Cu-mbpy cations. In 1-3, two Sb{sup III} centers located at the two opposite of anionic surface adopt fundamentally tetragonal pyramidal coordination geometry. Both compounds 1 and 2 consist of P-centered Keggin structure, while compound 3 presents a V-centered Keggin anion. The Keggin-type anions present different structural features: isolated cluster in 1 and Cu-ligand-supported cluster in 2 and 3. - Graphical abstract: Three hybrid compounds consisting of bi-antimony capped Keggin-type clusters modified with Cu-ligand cations have been synthesized and characterized. Highlights: Black-Right-Pointing-Pointer Three hybrid compounds consisting of bi-antimony capped Keggin-type clusters have been synthesized. Black-Right-Pointing-Pointer Two Sb{sup III} centers located at the two opposite of anionic surface adopt tetragonal pyramidal coordination geometry. Black-Right-Pointing-Pointer The anions present different structural features: isolated and Cu-ligand-supported cluster.

  2. Metal corrosion studies with the fluorosulphonic acid-antimony pentafluoride superacid system

    International Nuclear Information System (INIS)

    Because of their rapid dissolution of many actinide metals and refractory oxides, superacids such as HSO3F/SbF5 have potential applications in actinide processing. However, material compatibility must first be addressed because of the highly corrosive nature of superacids. This paper describes the qualitative rates of attack of fluorosulphonic acid-antimony pentafluoride superacid on a variety of metal substrates relevant to nuclear processing

  3. Application of Hyphenated Techniques in Speciation Analysis of Arsenic, Antimony, and Thallium


    Rajmund Michalski; Sebastian Szopa; Magdalena Jabłońska; Aleksandra Łyko


    Due to the fact that metals and metalloids have a strong impact on the environment, the methods of their determination and speciation have received special attention in recent years. Arsenic, antimony, and thallium are important examples of such toxic elements. Their speciation is especially important in the environmental and biomedical fields because of their toxicity, bioavailability, and reactivity. Recently, speciation analytics has been playing a unique role in the studies of biogeochemi...

  4. Electrodeposition Mechanism of Trivalent Antimony%三价锑的电沉积机理

    Institute of Scientific and Technical Information of China (English)

    林艳; 谢刚; 杨大锦


    The reduction mechanism of Sb3+ in H2SO4-NH4F-SbF3 electrolyte system was studied by means of electrochemical methods, including chronopotentiometry and alternating current impedance.Analysis of potential-time transients clearly shows that antimony (Ⅲ) could be reduced to antimony metal via two-steps irreversible electron transfer process in H2SO4-NH4F-SbF3 system.The relationship between iτ1/2 and i calculated by chronopotentiometry indicates that the trivalent antimony complex undergoes chemical transformation reaction before its reduction in the cathode.The impedance results confirm the above conclusion and indicate that the adsorption states which are the middle product of trivalent antimony have different influences on two electron transfer steps.%采用恒电流阶跃法及交流阻抗法等电化学方法,研究了H2SO4-NH4F-SbF3体系中三价锑的阴极还原机理.电势~时间暂态曲线出现二步反应特征,表明Sb"还原分两步进行.由恒电流阶跃曲线中iτ1/2~i关系可知Sb3+阴极还原存在前置化学转化.Sb3+阴极还原的交流阻抗测定结果进一步验证Sb3+还原是存在化学前置转化步骤的二步反应,且电活性中间产物吸附在电极表面,吸附反应对两步电子转移步骤的影响不同.

  5. Polycrystalline thin films of antimony selenide via chemical bath deposition and post deposition treatments

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez-Lazcano, Y. [Department of Solar Energy Materials, Centro de Investigacion en Energia, Universidad Nacional Autonoma de Mexico, Temixco, Morelos-62580 (Mexico); Pena, Yolanda [Department of Solar Energy Materials, Centro de Investigacion en Energia, Universidad Nacional Autonoma de Mexico, Temixco, Morelos-62580 (Mexico); Nair, M.T.S. [Department of Solar Energy Materials, Centro de Investigacion en Energia, Universidad Nacional Autonoma de Mexico, Temixco, Morelos-62580 (Mexico)]. E-mail:; Nair, P.K. [Department of Solar Energy Materials, Centro de Investigacion en Energia, Universidad Nacional Autonoma de Mexico, Temixco, Morelos-62580 (Mexico)


    We report a method for obtaining thin films of polycrystalline antimony selenide via chemical bath deposition followed by heating the thin films at 573 K in selenium vapor. The thin films deposited from chemical baths containing one or more soluble complexes of antimony, and selenosulfate initially did not show X-ray diffraction (XRD) patterns corresponding to crystalline antimony selenide. Composition of the films, studied by energy dispersive X-ray analyses indicated selenium deficiency. Heating these films in presence of selenium vapor at 573 K under nitrogen (2000 mTorr) resulted in an enrichment of Se in the films. XRD peaks of such films matched Sb{sub 2}Se{sub 3}. Evaluation of band gap from optical spectra of such films shows absorption due to indirect transition occurring in the range of 1-1.2 eV. The films are photosensitive, with dark conductivity of about 2 x 10{sup -8} ({omega} cm){sup -1} and photoconductivity, about 10{sup -6} ({omega} cm){sup -1} under tungsten halogen lamp illumination with intensity of 700 W m{sup -2}. An estimate for the mobility life time product for the film is 4 x 10{sup -9} cm{sup 2} V{sup -1}.

  6. Studies in atomic-fluorescence spectroscopy-V The fluorescence characteristics and determination of antimony. (United States)

    Dagnall, R M; Thompson, K C; West, T S


    Atomic-fluorescence of antimony may be generated in an air-propane flame by nebulizing aqueous solutions of antimony salts whilst irradiating the flame by means of a microwave-excited electrode-less discharge tube operating at 30 W. The strongest fluorescence is exhibited by the (4)S(11 2 ) --> (4)P(1 3 ) 2311 A resonance line and weaker signals are observed at the 2068 and 2176 A resonance lines and at four intercombination lines, at 2598, 2671, 2770 and 2878 A. A process of thermally assisted direct-line fluorescence is postulated to account for the otherwise inexplicable intensity of the 2598 A line emission. Atomic-fluorescence spectroscopy at 2176 A permits the determination of antimony in the range 0.1-120 ppm with a detection limit of 0.05 ppm. With the same equipment and source, the range of measurement for atomic-absorption was 6-120 ppm and the detection limit was 1 ppm. No interferences were observed from 100-fold molar amounts of Cd, Co, Cu, Fe, Hg, K, Mg, Mn, Mo, Na, NH(4), Pb and Zn or from arsenate, chloride, nitrate, phosphate and sulphate. PMID:18960212

  7. Morphology and antimony segregation of spangles on batch hot-dip galvanized coatings

    International Nuclear Information System (INIS)

    Spangles produced by batch hot-dip galvanizing process have a rougher surface and a greater surface segregation of alloying element compared with those in continuous hot-dip galvanizing line (CGL), owing to the cooling rate of the former is much smaller than that of the later. Therefore, typical spangles on a batch hot-dipped Zn-0.05Al-0.2Sb alloy coating were investigated. The chemical, morphological characterization and identification of the phases on the spangles were examined by scanning electron microscopy (SEM), backscattered electron imaging (BSE), atomic force microscopy (AFM), energy dispersive spectroscopy (EDS) and X-ray diffraction analysis (XRD). The results showed that the coating surface usually exhibited three kinds of spangles: shiny, feathery and dull spangle, of which extensively antimony surface segregation was detected. The nature of precipitate on the coating surface was identified as β-Sb3Zn4, The precipitated β-Sb3Zn4 particles distributed randomly on the shiny spangle surface, both β-Sb3Zn4 particles and dentritic segregation of antimony dispersed in the dendritic secondary arm spacings of the feathery spangle and on the whole dull spangle surface. The dentritic segregation of antimony and precipitation of Sb3Zn4 compound are discussed by a proposed model.

  8. Antimony in the Contaminated Site of El Triunfo, Baja California Sur, Mexico

    Directory of Open Access Journals (Sweden)

    Marmolejo-Rodríguez A. J.


    Full Text Available Antimony has properties similar to arsenic with some of its compounds toxic to humans. Therefore it is necessary to control the wastes accumulated by anthropogenic activities, such as mining, where it is in tailings to be released to the environment. According to the Environment Protection Agency, the maximum value in sediments is 11.2 mg Sb kg–1 and the Earth’s crust average is 0.2 mg Sb kg–1. In this semiarid area, the drainage basin El Carrizal is impacted with wastes of an abandoned gold mine at the Mining District El Triunfo (MD – ET which have tailings with 17,600 mg kg–1 of antimony. In the main dry river (arroyo, the Sb content is between 0.6 and 122 mg kg–1. This element is transported from the source throughout the fluvial basin to discharge into the Pacific Ocean. In the arroyo mouth we collected one sedimentary core and the sediment from dunes (28.6 – 45.7 and 6.43 – 7.74 mg Sb kg–1. This research concluded the antimony is enriched in this semiarid system, with Normalized Enrichment Factors severely enriched mainly in arroyo sediments close to the MD-ET

  9. Parto prematuro após uso de antimonial pentavalente: relato de um caso Premature birth after the use of pentavalent antimonial: case report

    Directory of Open Access Journals (Sweden)

    Bruna Pinheiro Silveira


    Full Text Available Relata-se o caso de uma mulher de 19 anos, na 24ª semana de gravidez e com leishmaniose visceral. Tratada com antimonial pentavalente na posologia de 850mg/dia por 20 dias, ocorreu parto prematuro no quinto dia de tratamento e óbito da criança um dia após nascimento. Considerando a importância da protozoose no nosso meio e a raridade da associação com a gestação, julgamos de interesse a publicação do caso.A case is reported of a 19-year-old woman, at week 24 of gestation, with visceral leishmaniosis. She was treated with meglumine antimoniate at a dose of 850mg/day for 20 days. There occurred premature birth on day five of treatment and the neonate died one day after birth. Considering the importance of protozoiasis in our population and the rarity of the association with pregnancy, we resolved to publish the case.

  10. Comparison of oral itraconazole and intramuscular meglumine antimoniate in the treatment of cutaneous leishmaniasis

    International Nuclear Information System (INIS)

    To compare the efficacy and tolerability of oral itraconazole against intramuscular meglumine antimoniate in the treatment of Cutaneous Leishmaniasis (CL). Two hundred eligible and consenting patients of Cutaneous Leishmaniasis (CL) were divided in two groups with 100 patients in each. The number and location of the lesions were documented and clinical types of cutaneous leishmaniasis were noted. The diagnosis was confirmed by skin slit smear and histopathology of the lesional skin. Culture on Nicolle Novy MacNeal (NNN) medium and Leishmanin test was done in all patients. All the patients in both groups were subjected to complete blood picture, urine examination, serum urea and creatinine levels and ECG examination. One group was given itraconazole 100 mg twice daily orally for a duration of 6-8 weeks. The other group was given meglumine antimoniate 10 cc in the form of deep intramuscular injections for 15-30 days. The efficacy of the treatment was judged by clinical and parasitological response. Side effects of the agents were also noted during treatment. Out of 200 patients studied, 185 were males and 15 were females. The mean age of presentation was 30 + 6.6 years. Single lesion was seen in 132 (66%) subjects whereas 68 (34%) subjects had multiple lesions. Slit skin smears were positive in 50 (25%) of the patients. Skin biopsy yielded the presence of LT bodies in 150 (75%) subjects. The culture was positive in 102 (51%) cases. Leishmanin test was positive in 94% subjects. Seventy-five (75%) patients on itraconazole therapy showed complete clinical and parasitological cure in 4-8 weeks duration. A rise in ALT was seen in 12% subjects. Five (5%) subjects did not show any improvement till the end of therapy. Sixty-five (65%) subjects on meglumine antimoniate showed complete healing in 15-30 days. In 35 (35%) of the patients, the treatment had to be stopped due to intolerable side-effects. Four cases of lupoid leishmaniasis and 4 cases of sporotrichoid leishmaniasis

  11. Development of an analytical method for antimony speciation in vegetables by HPLC-hydride generation-atomic fluorescence spectrometry. (United States)

    Olivares, David; Bravo, Manuel; Feldmann, Jorg; Raab, Andrea; Neaman, Alexander; Quiroz, Waldo


    A new method for antimony speciation in terrestrial edible vegetables (spinach, onions, and carrots) was developed using HPLC with hydride generation-atomic fluorescence spectrometry. Mechanical agitation and ultrasound were tested as extraction techniques. Different extraction reagents were evaluated and optimal conditions were determined using experimental design methodology, where EDTA (10 mmol/L, pH 2.5) was selected because this chelate solution produced the highest extraction yield and exhibited the best compatibility with the mobile phase. The results demonstrated that EDTA prevents oxidation of Sb(III) to Sb(V) and maintains the stability of antimony species during the entire analytical process. The LOD and precision (RSD values obtained) for Sb(V), Sb(III), and trimethyl Sb(V) were 0.08, 0.07, and 0.9 microg/L and 5.0, 5.2, and 4.7%, respectively, for a 100 microL sample volume. The application of this method to real samples allowed extraction of 50% of total antimony content from spinach, while antimony extracted from carrots and onion samples ranged between 50 and 60 and 54 and 70%, respectively. Only Sb(V) was detected in three roots (onion and spinach) that represented 60-70% of the total antimony in the extracts. PMID:22970588

  12. Development of an analytical method for antimony speciation in vegetables by HPLC-hydride generation-atomic fluorescence spectrometry. (United States)

    Olivares, David; Bravo, Manuel; Feldmann, Jorg; Raab, Andrea; Neaman, Alexander; Quiroz, Waldo


    A new method for antimony speciation in terrestrial edible vegetables (spinach, onions, and carrots) was developed using HPLC with hydride generation-atomic fluorescence spectrometry. Mechanical agitation and ultrasound were tested as extraction techniques. Different extraction reagents were evaluated and optimal conditions were determined using experimental design methodology, where EDTA (10 mmol/L, pH 2.5) was selected because this chelate solution produced the highest extraction yield and exhibited the best compatibility with the mobile phase. The results demonstrated that EDTA prevents oxidation of Sb(III) to Sb(V) and maintains the stability of antimony species during the entire analytical process. The LOD and precision (RSD values obtained) for Sb(V), Sb(III), and trimethyl Sb(V) were 0.08, 0.07, and 0.9 microg/L and 5.0, 5.2, and 4.7%, respectively, for a 100 microL sample volume. The application of this method to real samples allowed extraction of 50% of total antimony content from spinach, while antimony extracted from carrots and onion samples ranged between 50 and 60 and 54 and 70%, respectively. Only Sb(V) was detected in three roots (onion and spinach) that represented 60-70% of the total antimony in the extracts.

  13. 33 CFR 117.451 - Gulf Intracoastal Waterway. (United States)


    ... § 117.451, see the List of CFR Sections Affected, which appears in the Finding Aids section of the... bridge, Algiers Alternate Route, mile 3.8 at Belle Chasse, shall open on signal; except that, from 6...

  14. 117 Standards Admitted in Civil Administration Standardization Plan

    Institute of Scientific and Technical Information of China (English)


    @@ The Ministry of Civil Administration has finalized its Standardization Plan 2007. According to this plan, the Ministry will see that 117 standards, including 8 compulsory national standards, 83 recommended national standards, and 26 professional standards, are prepared by June 2008.

  15. Analysis of CD117-negative gastrointestinal stromal tumors

    Institute of Scientific and Technical Information of China (English)

    Chin-Yuan Tzen; Bey-Liing Mau


    AIM: To identify the gastrointestinal stromal tumors(GISTs) that are negative for CD117 expression by immunohistochemistry and to characterize their malignant potential.METHODS: A total of 108 primary mesenchymal tumors of the gastrointestinal tract were screened to select CD117-negative tumors, from which KIT(exons 9, 11, 13, and 17)and PDGFRA (exons 10, 12, 14, and 18) were sequenced to identify GISTs. Tumor recurrence and distant metastasis were used as the criteria of malignancy.RESULTS: The result showed that approximately 25%(29/108) of the gastrointestinal mesenchymal tumors were negative for CD117 and approximately 6% (7/108)of the tumors were CD117-negative GISTs. All these CD117-negative tumors had a mutated KITand a wildtype PDGFRA. All CD117-negative GISTs with mutations at codons 557/558 of KIThad mitotic counts >10/50 high power field, and 75% (3/4) of them showed multiple recurrence or distant metastasis.CONCLUSION: CD1 17-negative KITmutated GISTs account for approximately 6% of the gastrointestinal mesenchymal tumors. Tumor recurrence or distant metastasis correlates to both theKITmutations at codons 557/558 and the mitotic counts, but not to the tumor size.

  16. Leachability of antimony from energy ashes. Total contents, leachability and remedial suggestions; Lakning av antimon fraan energiaskor. Totalhalter, lakbarhet samt foerslag till aatgaerder

    Energy Technology Data Exchange (ETDEWEB)

    Baeckstroem, Mattias [Oerebro Univ. (Sweden)


    In the current project total concentrations for antimony in 31 energy ashes have been compiled. The average concentration of antimony in boiler fly ash and grate boiler fly ash is 192 and 1,140 mg/kg, respectively. The corresponding antimony concentrations for boiler ashes and grate bottom ashes are 86,5 and 61,8 mg/kg, respectively. Multivariate calculations clearly pointed out waste as the major source for antimony in ashes. The difference between total antimony concentration in fly ash and bottom ash is greatest for grate boilers, in average 18 times higher in the fly ash. The difference for CFB/BFB-boilers is only slightly more than 2. However, based on amount, 75% of the total antimony inventory is recovered in the fly ashes for both CFB/BFB and grate boilers. Eleven (eight of which were bottom ashes) out of the 31 samples exceeded the guidelines for inert waste. It is clear that the higher ionic strength in the solutions from the fly ashes contribute to decrease the solubility for critical minerals retaining antimony. In addition, the fly ashes have considerably larger effective surface able to sorb trace elements. A clear and positive covariance was discovered between aluminium and antimony. Furthermore, it was noted that antimony showed no typical anionic behaviour despite the fact that it according to the geochemical calculations should be present as SbO{sub 3}{sup -}. At L/S 10, a maximum of 1% of the total antimony concentration is leached. This should be compared to chloride that had 94% of the total concentration leached at L/S 10. There was no correlation between the leached antimony concentrations and the total antimony concentrations. The sequential extractions also suggest a low leachability for antimony from the ashes. In average only 9,6% is released at pH 7, 7,3% at pH 5, 3,6% during reducing conditions and 3,2% during oxidising conditions. In total, only 24% of the total antimony concentrations is released during the four extraction steps. The

  17. Synthesis, characterization and single crystal X-ray analysis of chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III

    Directory of Open Access Journals (Sweden)

    H.P.S. Chauhan


    Full Text Available The title compound chlorobis(N,N-dimethyldithiocarbamato-S,S′antimony(III has been prepared in distilled acetonitrile and characterized by physicochemical [melting point and molecular weight determination, elemental analysis (C, H, N, S & Sb], spectral [FT–IR, far IR, NMR (1H & 13C] studies. The crystal and molecular structure was further confirmed using single crystal X-ray diffraction analysis which features a five-coordinate geometry for antimony(III within a ClS4 donor set. The distortion in the co-planarity of ClSbS3 evidences the stereochemical influence exerts by the lone pair of electrons on antimony(III. Two centrosymmetrically related molecule held together via C–H···Cl secondary interaction result in molecular aggregation of the compound.

  18. Selective liquid-liquid extraction of antimony(III from hydrochloric acid media by N-n-octylaniline in xylene

    Directory of Open Access Journals (Sweden)

    M. A. ANUSE


    Full Text Available N-n-Octylaniline in xylene was used for the extraction separation of antimony(III from hydrochloric acid media. Antimony(III was extracted quantitatively with 10 mL 4 % N-n-octylaniline in xylene. It was stripped from the organic phase with 0.5 M ammonia and estimated photometrically by the iodide method. The effect of metal ion, acid, reagent concentration and various foreign ions was investigated. The method affords binary and ternary separation of antimony(III from tellurium(IV, selenium(IV, lead(II, bismuth(III, tin(IV, germanium(IV, copper(II, gold(III, iron(III and zinc(II. The method is applicable for the analysis of synthetic mixtures, alloys and semiconductor thin films. It is fast, accurate and precise.

  19. Development and pharmacokinetic of antimony encapsulated in liposomes of phosphatidylserine using radioisotopes in experimental leishmaniasis

    International Nuclear Information System (INIS)

    Leishmaniasis are a complex of parasitic diseases caused by intra macrophage protozoa of the genus Leishmania, and is fatal if left untreated. Pentavalent antimonials, though toxic and their mechanism of action being unclear, remain the first-line drugs for treatment. Effective therapy could be achieved by delivering antileishmanial drugs to these sites of infection. Liposomes are phospholipid vesicles that promote improvement in the efficacy and action of drugs in target cell. Liposomes are taken up by the cells of mononuclear phagocytic system (MPS). The purpose of this study was to develop a preparation of meglumine antimonate encapsulated in liposomes of phosphatidylserine and to study its pharmacokinetic in healthy mice to establish its metabolism and distribution. Quantitative analysis of antimony from liposomes demonstrated that Neutron Activation Analysis was the most sensitive technique with almost 100 % of accuracy. All liposome formulations presented a mean diameter size of 150 nm. The determination of IC50 in infected macrophage showed that liposome formulations were between 10 - 63 fold more effective than the free drug, indicating higher selectivity index. By fluorescence microscopy, an increased uptake of fluorescent-liposomes was seen in infected macrophages during short times of incubation compared with non-infected macrophages. Biodistribution studies showed that meglumine antimonate irradiated encapsulated in liposomes of phosphatidylserine promoted a targeting of antimony for MPS tissues and maintained high doses in organs for a prolonged period. In conclusion, these data suggest that meglumine antimonate encapsulated in liposomes showed higher effectiveness than the non-liposomal drug against Leishmania infection. The development of liposome formulations should be a new alternative for the chemotherapy of infection diseases, especially Leishmaniasis, as they are used to sustain and target pharmaceuticals to the local of infection. (author)

  20. Lithium-antimony-lead liquid metal battery for grid-level energy storage (United States)

    Wang, Kangli; Jiang, Kai; Chung, Brice; Ouchi, Takanari; Burke, Paul J.; Boysen, Dane A.; Bradwell, David J.; Kim, Hojong; Muecke, Ulrich; Sadoway, Donald R.


    The ability to store energy on the electric grid would greatly improve its efficiency and reliability while enabling the integration of intermittent renewable energy technologies (such as wind and solar) into baseload supply. Batteries have long been considered strong candidate solutions owing to their small spatial footprint, mechanical simplicity and flexibility in siting. However, the barrier to widespread adoption of batteries is their high cost. Here we describe a lithium-antimony-lead liquid metal battery that potentially meets the performance specifications for stationary energy storage applications. This Li||Sb-Pb battery comprises a liquid lithium negative electrode, a molten salt electrolyte, and a liquid antimony-lead alloy positive electrode, which self-segregate by density into three distinct layers owing to the immiscibility of the contiguous salt and metal phases. The all-liquid construction confers the advantages of higher current density, longer cycle life and simpler manufacturing of large-scale storage systems (because no membranes or separators are involved) relative to those of conventional batteries. At charge-discharge current densities of 275 milliamperes per square centimetre, the cells cycled at 450 degrees Celsius with 98 per cent Coulombic efficiency and 73 per cent round-trip energy efficiency. To provide evidence of their high power capability, the cells were discharged and charged at current densities as high as 1,000 milliamperes per square centimetre. Measured capacity loss after operation for 1,800 hours (more than 450 charge-discharge cycles at 100 per cent depth of discharge) projects retention of over 85 per cent of initial capacity after ten years of daily cycling. Our results demonstrate that alloying a high-melting-point, high-voltage metal (antimony) with a low-melting-point, low-cost metal (lead) advantageously decreases the operating temperature while maintaining a high cell voltage. Apart from the fact that this finding

  1. The LABCG2 Transporter from the Protozoan Parasite Leishmania Is Involved in Antimony Resistance. (United States)

    Perea, Ana; Manzano, José Ignacio; Castanys, Santiago; Gamarro, Francisco


    Treatment for leishmaniasis, which is caused by Leishmania protozoan parasites, currently relies on a reduced arsenal of drugs. However, the significant increase in the incidence of drug therapeutic failure and the growing resistance to first-line drugs like antimonials in some areas of Northern India and Nepal limit the control of this parasitic disease. Understanding the molecular mechanisms of resistance in Leishmania is now a matter of urgency to optimize drugs used and to identify novel drug targets to block or reverse resistant mechanisms. Some members of the family of ATP-binding cassette (ABC) transporters in Leishmania have been associated with drug resistance. In this study, we have focused our interest to characterize LABCG2's involvement in drug resistance in Leishmania. Leishmania major parasites overexpressing the ABC protein transporter LABCG2 were generated in order to assess how LABCG2 is involved in drug resistance. Assays of susceptibility to different leishmanicidal agents were carried out. Analysis of the drug resistance profile revealed that Leishmania parasites overexpressing LABCG2 were resistant to antimony, as they demonstrated a reduced accumulation of Sb(III) due to an increase in drug efflux. Additionally, LABCG2 was able to transport thiols in the presence of Sb(III) Biotinylation assays using parasites expressing LABCG2 fused with an N-terminal green fluorescent protein tag revealed that LABCG2 is partially localized in the plasma membrane; this supports data from previous studies which suggested that LABCG2 is localized in intracellular vesicles that fuse with the plasma membrane during exocytosis. In conclusion, Leishmania LABCG2 probably confers antimony resistance by sequestering metal-thiol conjugates within vesicles and through further exocytosis by means of the parasite's flagellar pocket. PMID:27021316

  2. Highly active and stable Pt electrocatalysts promoted by antimony-doped SnO2 supports for oxygen reduction reactions

    DEFF Research Database (Denmark)

    Yin, Min; Xu, Junyuan; Li, Qingfeng;


    Alternative composite supports for platinum catalysts were synthesized from antimony doped tin dioxide (ATO) nanoparticles. In the range of the antimony content from 0 to 11mol%, the highest electrical conductivity of 1.1Scm-1 at 130°C was obtained for the 5mol% Sb ATO, from which composite...... supports composed of oxides and carbon and supported platinum catalysts were prepared. Using the pure oxide support, the Pt/ATO catalyst displayed superior specific activity and stability for the oxygen reduction reactions (ORRs). Low surface area of ATO caused poor dispersion of Pt particles compared...

  3. Separation of antimony from synthetic cloth. Application in forensic science using neutron activation analysis

    International Nuclear Information System (INIS)

    A simple ion-exchange separation procedure was developed for selective removal of antimony from synthetic cloth to facilitate determination of several trace elements frequently used to identify gunshot residues by neutron activation analysis. Radiotracers of Sb, Ba, Cu, Co, As, Zn, Hg and Ag were employed to optimize the developed procedure. The method involves the quantitative retention of the above elements, except of Sb, from 0.2M ammonium carbonate solution using Chelex 100 resin and subsequent quantitative elution of the elements of interest with 2M nitric acid for gamma-ray spectrometry. The procedure was tested by simulated gunshot residues. (author)

  4. Influence of arsenic,antimony and cobalt impurities on the cathodic process in zinc electrowinning

    Institute of Scientific and Technical Information of China (English)


    By means of an electrochemical study,the influence of arsenic,antimony and cobalt on cathodic polarization in the zinc electrowinning process,the associated kinetic equations and parameters,and the polarization mechanism have been studied.The results show that the experimental values of the kinetic parameters are in accord with the theoretical values in the ZnSO4/H2SO4 solution with a single impurity is added.In contrast,the charge transfer coefficient α is smaller than the theoretical value in the ZnSO4/H2SO4 solution when the three impurities are added together.

  5. Polymorphism and properties of Bi{sub 2}WO{sub 6} doped with pentavalent antimony

    Energy Technology Data Exchange (ETDEWEB)

    Kharitonova, E.P.; Belov, D.A. [M.V. Lomonosov Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation); Gagor, A.B.; Pietraszko, A.P. [W. Trzebiatowski Institute of Low Temperature and Structure Research, Polish Academy of Sciences, Okólna 2, 50-950 Wrocław (Poland); Alekseeva, O.A. [Shubnikov Institute of Crystallography, Russian Academy of Sciences, Leninsky pr. 59, 119333 Moscow (Russian Federation); Voronkova, V.I., E-mail: [M.V. Lomonosov Moscow State University, Leninskie Gory, 119991 Moscow (Russian Federation)


    Highlights: • The limit of Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} solid solutions is at x = 0.05. • Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} does not fully transform into high-temperature monoclinic phase. • Sb{sup 5+} has a weak effect on the temperatures of the ferroelectric transitions. • γ→γ{sup ‴} transition near 650 °C was observed as strong permittivity peak at 0.01–8 Hz. • The conductivity of Bi{sub 2}W{sub 0.96}Sb{sub 0.04}O{sub 6−y} at 800 °C reaches 0.02 S/cm. -- Abstract: Antimony-containing solid solutions isostructural with bismuth tungstate, Bi{sub 2}WO{sub 6}, have been prepared in air as polycrystalline samples by solid-state reactions and as single crystals by unseeded flux growth. The antimony in the solid solutions is in a pentavalent state and substitutes for tungsten in the structure of Bi{sub 2}WO{sub 6}. The Bi{sub 2}W{sub 1−x}Sb{sub x}O{sub 6−y} solid solutions have been shown to exist in the composition range 0 ⩽ x ⩽ 0.05. We have examined the effect of Sb{sup 5+} doping on the polymorphism and properties of Bi{sub 2}WO{sub 6}. In contrast to undoped Bi{sub 2}WO{sub 6}, antimony-substituted bismuth tungstate does not completely transform into its high-temperature, monoclinic phase at 960 °C and remains two-phase up to temperatures approaching its melting point. Antimony substitution for tungsten has a weak effect on the temperatures of the ferroelectric phase transitions. Heterovalent substitution of Sb{sup 5+} for W{sup 6+} is accompanied by the formation of extra oxygen vacancies and an increase in the electrical conductivity of the solid solutions by one to two orders of magnitude relative to undoped Bi{sub 2}WO{sub 6}.

  6. Electromagnetic absorption and shielding behavior of polyaniline-antimony oxide composites (United States)

    Faisal, Muhammad; Khasim, Syed


    This work highlights the microwave absorption and electromagnetic interference (EMI) shielding properties of synthesized polyaniline (PAni)-antimony oxide (Sb2O3) composites in the 8-12 GHz (X-band) range. These composites showed absorption dominated EMI shielding effectiveness (EMI SEA) of -34 to -40 dB (> 99 % attenuation), indicating their shielding potential throughout the X-band. Our analyses reveal that the Sb2O3 particles in PAni matrix have key impact in determining the microwave absorption properties of the composites.

  7. Determination of arsenic, selenium and antimony by neutron activation analysis. Application to hair samples

    International Nuclear Information System (INIS)

    A fast rabbit system for instrumental activation analysis with reactor neutrons is described. Its use in the determination of selenium in hair is discussed. A survey is given of the correction factors which are inherent to the use of short-lived radionuclides. An alternative to INAA is NAA based on the separation of arsenic, selenium and antimony by hydride evaporation and adsorption to active carbon. Data for some Standard Reference Materials are given. This work was done under research contract 2440/RI/RB with the IAEA

  8. Uroradiology in 117 year history of radiology

    International Nuclear Information System (INIS)

    contrast ultrasound, angioplasty, as the title is an expression of respect and reverence for explorers and those expanding on this momentous discoveries. As a natural continuation is the fourth stage, from 1980 to the present day, entitled ‘Fathers and Children’. Like the clash of different generations, are also clash with modern conventional radiology imaging (radiology). Precisely massive introduction and improvement of ultrasound, computed tomography and magnetic resonance lead to a fundamentally different approach in the current generation of radiologists, which in many cases is at the expense of a conventional radiology. Discussion: On the development of uroradiology in Bulgaria affect two factors - an institution and a person. The institution is ISUL (now University Hospital ‘Tsaritsa Yoanna – ISUL’) , founded in 1949 and disbanded in the early 80s, and person is his first rector and head of the Department of Radiology Professor Gotze Tenchov, the founder of Modern Radiology in Bulgaria. Thanks to enthusiasm and aspirations of its employees and their followers over the years, although some delay we can now report that uroradiology in Bulgaria corresponds to a satisfactory advanced level. Conclusion: Uroradiology, running forward, shows 117 years of development, passing through three centuries. Looking back, we ask the question - where is the boundary, is there a limit in development? The answer is in the future

  9. High levels of antimony in dust from e-waste recycling in southeastern China

    International Nuclear Information System (INIS)

    Environmental contamination due to uncontrolled e-waste recycling is an emerging global issue. Antimony (Sb) is a toxic element used in semiconductor components and flame retardants for circuit board within electronic equipment. When e-waste is recycled, Sb is released and contaminates the surrounding environment; however, few studies have characterized the extent of this problem. In this study, we investigated Sb and arsenic (As) distributions in indoor dust from 13 e-waste recycling villages in Guiyu, Guangdong Province, southeastern China. Results revealed significantly elevated concentrations of Sb (6.1-232 mg/kg) in dust within all villages, which were 3.9-147 times higher than those from the non e-waste sites, indicating e-waste recycling was an important source of Sb pollution. On the contrary, As concentrations (5.4-17.7 mg/kg) in e-waste dusts were similar to reference values from the control sites. Therefore, dusts emitted from e-waste recycling may be characterized by high Sb/As ratios, which may help identify the contamination due to the e-waste recycling activities. - Highlights: → Antimony and arsenic concentrations in dust from e-waste recycling were investigated. → E-waste recycling is an important emerging source of Sb pollution. → Sb/As ratios may help identify the e-waste contamination.

  10. Canine visceral leishmaniasis: comparison of in vitro leishmanicidal activity of marbofloxacin, meglumine antimoniate and sodium stibogluconate. (United States)

    Vouldoukis, Ioannis; Rougier, Sandrine; Dugas, Bernard; Pino, Paco; Mazier, Dominique; Woehrlé, Frédérique


    The control of canine leishmaniasis largely depends on the success of treatment. Drugs currently available to treat this disease are toxic and partially effective. The curative effect of marbofloxacin, a third-generation fluoroquinolone developed for veterinarian individual treatment, was evaluated in vitro in the presence of Leishmania infantum promastigotes and dog-monocyte-derived macrophages; meglumine antimoniate and sodium stibogluconate were used as comparative treatments. We observed that the killing of Leishmania promastigotes and intracellular amastigotes by marbofloxacin was dose-dependent. We demonstrated that successful treatment of canine infected macrophages for 48 h was possible with 500 microg/ml of marbofloxacin. Leishmanicidal activity acted through a TNF-alpha and nitric oxide pathway and correlated with the generation of nitric oxide (NO(2)) production by monocytes derived macrophages from infected (23+/-5 microM) or healthy (21+/-6 microM) dogs, in comparison with NO(2) concentration in infected/non-treated macrophages (Marbofloxacin was shown to be non-toxic at 500 microg/ml in vitro and no cell apoptosis was observed. The molecule was able to induce a parasitic process after significant elimination of amastigotes in leishmania-infected dog macrophages. We propose that marbofloxacin, compared to standard chemotherapeutic agents (meglumine antimoniate and sodium stibogluconate), could be an effective and pragmatic oral route alternative to treat canine leishmaniasis.

  11. Evaluation of antimony microparticles supported on biochar for application in the voltammetric determination of paraquat. (United States)

    Gevaerd, Ava; de Oliveira, Paulo R; Mangrich, Antonio S; Bergamini, Márcio F; Marcolino-Junior, Luiz H


    This work describes the construction and application of carbon paste electrodes modified with biochar and antimony microparticles (SbBCPE) for voltammetric determination of paraquat using a simple and sensitive procedure based on voltammetric stripping analysis. Some parameters such as amount of biochar and antimony used in the composition of the carbon paste and instrumental parameters were examined in detail. Under optimized conditions, an analytical curve was obtained for paraquat determination employing SbBCPE, which showed a linear response ranging from 0.2 to 2.9 μmol L(-1), with limit of detection and quantification of 34 nmol L(-1) and 113 nmol L(-1), respectively, after paraquat pre-concentration of 120 s. The repeatability study presented a RSD=2.0% for 10 consecutive measurements using the same electrode surface and the reproducibility study showed a RSD=2.7% for measurements with 10 different electrode surfaces. The proposed sensor was successfully applied for paraquat determination in tap water and citric fruit juice spiked samples and good recoveries were obtained without any sample pre-treatment, showing its promising analytical performance.

  12. Antimony retention and release from drained and waterlogged shooting range soil under field conditions. (United States)

    Hockmann, Kerstin; Tandy, Susan; Lenz, Markus; Reiser, René; Conesa, Héctor M; Keller, Martin; Studer, Björn; Schulin, Rainer


    Many soils polluted by antimony (Sb) are subject to fluctuating waterlogging conditions; yet, little is known about how these affect the mobility of this toxic element under field conditions. Here, we compared Sb leaching from a calcareous shooting range soil under drained and waterlogged conditions using four large outdoor lysimeters. After monitoring the leachate samples taken at bi-weekly intervals for >1.5 years under drained conditions, two of the lysimeters were subjected to waterlogging with a water table fluctuating according to natural rainfall water infiltration. Antimony leachate concentrations under drained conditions showed a strong seasonal fluctuation between 110 μg L(-1) in summer and soil solution indicated that this decrease in Sb(V) concentrations was attributable to the reduction of Sb(V) to Sb(III) and the stronger sorption affinity of the latter to iron (Fe) (hydr)oxide phases. Our results demonstrate the importance of considering seasonal and waterlogging effects in the assessment of the risks from Sb-contaminated sites. PMID:25592464

  13. A Black Phosphate Conversion Coating on Steel Surface Using Antimony(III)-Tartrate as an Additive (United States)

    Li, Feng; Wang, Guiping


    A novel black phosphate conversion coating was formed on steel surface through a Zn-Mn phosphating bath containing mainly ZnO, H3PO4, Mn(H2PO4)2, and Ca(NO3)2, where antimony(III)-tartrate was used as the blackening agent of phosphatization. The surface morphology and composition of the coating were characterized by scanning electron microscopy, energy dispersion spectroscopy, and x-ray photoelectron spectroscopy. Corrosion resistance of the coating was studied by potentiodynamic polarization curves and electrochemical impedance spectroscopy. The pH value of the solution had significant influence on the formation and corrosion resistance of the coating. The experimental results indicated that the Sb plays a vital role in the blackening of phosphate conversion coating. The optimal concentration of antimony(III)-tartrate in the phosphating bath used in this experiment was 1.0 g L-1, as higher values reduced the corrosion resistance of the coating. In addition, by saponification and oil seals, the corrosion duration of the black phosphate coating in a copper sulfate spot test can be as long as 20 min.

  14. Application of Hyphenated Techniques in Speciation Analysis of Arsenic, Antimony, and Thallium

    Directory of Open Access Journals (Sweden)

    Rajmund Michalski


    Full Text Available Due to the fact that metals and metalloids have a strong impact on the environment, the methods of their determination and speciation have received special attention in recent years. Arsenic, antimony, and thallium are important examples of such toxic elements. Their speciation is especially important in the environmental and biomedical fields because of their toxicity, bioavailability, and reactivity. Recently, speciation analytics has been playing a unique role in the studies of biogeochemical cycles of chemical compounds, determination of toxicity and ecotoxicity of selected elements, quality control of food products, control of medicines and pharmaceutical products, technological process control, research on the impact of technological installation on the environment, examination of occupational exposure, and clinical analysis. Conventional methods are usually labor intensive, time consuming, and susceptible to interferences. The hyphenated techniques, in which separation method is coupled with multidimensional detectors, have become useful alternatives. The main advantages of those techniques consist in extremely low detection and quantification limits, insignificant interference, influence as well as high precision and repeatability of the determinations. In view of their importance, the present work overviews and discusses different hyphenated techniques used for arsenic, antimony, and thallium species analysis, in different clinical, environmental and food matrices.

  15. Determination of Trace Antimony (III by Adsorption Voltammetry at Carbon Paste Electrode

    Directory of Open Access Journals (Sweden)

    Nongyue He


    Full Text Available This work presents a sensitive method for the determination of trace antimonybased on the antimony-pyrogallol red (PGR adsorption at a carbon paste electrode (CPE.The optimal conditions were to use an electrode containing 25% paraffin oil and 75%high purity graphite powder as working electrode, a 0.10 mol/L HCl solution containing3.0×10-5 mol/L PGR as accumulation medium and a 0.20 mol/L HCl solution aselectrolyte with an accumulation time of 150 s and a reduction time of 60 s at -0.50 Vfollowed with a sweep from -0.50 V to 0.20 V. The mechanism of the electrode reactionwas discussed. Interferences of other metal ions were studied as well. The detection limitwas 1×10-9 mol/L. The linear range was from 2.0×10-9 mol/L to 5.0×10-7 mol/L.Application of the proposed method to the determination of antimony in water andhuman hair samples gave good results.

  16. Organically complexed iron enhances bioavailability of antimony to maize (Zea mays) seedlings in organic soils. (United States)

    Ptak, Corey; McBride, Murray


    Antimony (Sb) is a metalloid belonging to group 15 of the periodic table. Chemical similarities between arsenic (As) and Sb produce concerns about potential health effects of Sb and enrichment in the environment. Antimony is found in oxic environments predominately as an oxyanionic species, antimonite (Sb[OH](6-)). As a result of its net negative charge, Sb[OH](6-) was not initially predicted to have strong interactions with natural organic matter. Oxyanionic species could bind the negatively charged organic matter via a ternary complexation mechanism, in which cationic metals mediate the strong association between organic matter functional groups and oxyanions. However, these interactions are poorly understood in how they influence the bioavailability of oxyanionic contaminants to plants. Iron (Fe) additions to organic soils have been found to increase the number of organically complexed Fe sites suitable for Sb exchange, resulting in a reduced bioavailable fraction of Sb. The bioavailability of Sb to maize seedlings as a function of organically complexed Fe was examined using a greenhouse study. A significant increase in plant tissue Sb was observed as organically complexed Fe increased, which was not predicted by methods commonly used to assess bioavailable Sb. Extraction of soils with organic acids common to the maize rhizosphere suggested that organic acid exudation can readily mobilize Sb bound by organic Fe complexes. PMID:26076768

  17. Morphology-controlled growth of crystalline antimony sulfide via a refluxing polyol process (United States)

    Zhang, Rui; Chen, Xiangying; Mo, Maosong; Wang, Zhenghua; Zhang, Meng; Liu, Xinyuan; Qian, Yitai


    By refluxing antimony trichloride (SbCl 3) and thiourea in various solvents at suitable reaction conditions, antimony sulfide (Sb 2S 3) crystallites with a diversity of well-defined morphologies were synthesized. Sb 2S 3 rods with the average diameter of 800 nm and the length of 7 μm, as well as microtubes with the average outer diameter of 1.2 μm, the average inner diameter of 800 nm and the length of 8 μm, were obtained in 1,2-propanediol at 180°C for 10 min. In contrast, a series of experiments under different conditions were carried out to investigate the influencing factors on the reaction. The as-synthesized products were characterized by powder X-ray diffraction, field-emission scanning electron microscopy, transmission electron microscope and X-ray photoelectron spectra. The results indicate Sb 2S 3 crystals with different morphologies, including rod-like, tube-like, bowknot-like, flower-like, straw-bundled-like, taken under different experimental conditions. It is found that the reaction temperature, time, solvent and poly(vinyl pyrrolidone) (as a polymer capping reagent) play important roles in the formation of the final Sb 2S 3 crystallites with different morphologies. Also, the possible growth mechanism is discussed.

  18. Organically complexed iron enhances bioavailability of antimony to maize (Zea mays) seedlings in organic soils. (United States)

    Ptak, Corey; McBride, Murray


    Antimony (Sb) is a metalloid belonging to group 15 of the periodic table. Chemical similarities between arsenic (As) and Sb produce concerns about potential health effects of Sb and enrichment in the environment. Antimony is found in oxic environments predominately as an oxyanionic species, antimonite (Sb[OH](6-)). As a result of its net negative charge, Sb[OH](6-) was not initially predicted to have strong interactions with natural organic matter. Oxyanionic species could bind the negatively charged organic matter via a ternary complexation mechanism, in which cationic metals mediate the strong association between organic matter functional groups and oxyanions. However, these interactions are poorly understood in how they influence the bioavailability of oxyanionic contaminants to plants. Iron (Fe) additions to organic soils have been found to increase the number of organically complexed Fe sites suitable for Sb exchange, resulting in a reduced bioavailable fraction of Sb. The bioavailability of Sb to maize seedlings as a function of organically complexed Fe was examined using a greenhouse study. A significant increase in plant tissue Sb was observed as organically complexed Fe increased, which was not predicted by methods commonly used to assess bioavailable Sb. Extraction of soils with organic acids common to the maize rhizosphere suggested that organic acid exudation can readily mobilize Sb bound by organic Fe complexes.

  19. Effect of antimony incorporation on structural properties of CuInS{sub 2} crystals

    Energy Technology Data Exchange (ETDEWEB)

    Ben Rabeh, M., E-mail: mohamedbenrabeh@yahoo.f [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia); Chaglabou, N., E-mail: nadia_chaglabou@yahoo.f [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia); Kanzari, M., E-mail: Mounir.Kanzari@ipeit.rnu.t [Laboratoire de Photovoltaique et Materiaux Semi-Conducteurs - ENIT BP 37, Le belvedere, 1002 Tunis (Tunisia)


    CuInS{sub 2} (CIS) single crystals doped with 1, 2, 3 and 4 atomic percent (at.%) of antimony (Sb) were grown by the horizontal Bridgman method. The effect of Sb doping on the structural properties of CIS crystal was studied by means of X-ray diffraction (XRD), energy dispersive X-ray analysis (EDAX), scanning electron microscopy (SEM) and PL measurements. X-ray diffraction data suggests that the doping of Sb in the CIS single crystals does not affect the tetragonal (chalcopyrite) crystal structure and exhibited a (1 1 2) preferred orientation. In addition, with increasing Sb concentration, the X-ray diffraction analysis show that Sb doped CIS crystals are more crystallized and the diffraction peaks of the CuInS{sub 2} phase were more pronounced in particular the (1 1 2) plane. EDAX study revealed that Sb atoms can occupy the indium site and/or occupying the sulfur site to make an acceptor. PL spectra of undoped and Sb doped CIS crystals show two emission peaks at 1.52 and 1.62 eV, respectively which decreased with increasing atomic percent antimony. Sb doped CIS crystals show p-type conductivity.

  20. Food crop accumulation and bioavailability assessment for antimony (Sb) compared with arsenic (As) in contaminated soils. (United States)

    Wilson, Susan C; Tighe, Matthew; Paterson, Ewan; Ashley, Paul M


    Field samples and a 9-week glasshouse growth trial were used to investigate the accumulation of mining derived arsenic (As) and antimony (Sb) in vegetable crops growing on the Macleay River Floodplain in Northern New South Wales, Australia. The soils were also extracted using EDTA to assess the potential for this extractant to be used as a predictor of As and Sb uptake in vegetables, and a simplified bioaccessibility extraction test (SBET) to understand potential for uptake in the human gut with soil ingestion. Metalloids were not detected in any field vegetables sampled. Antimony was not detected in the growth trial vegetable crops over the 9-week greenhouse trial. Arsenic accumulation in edible vegetable parts was risk of exposure through short-term vegetable crops is low. The data also demonstrate that uptake pathways for Sb and As in the vegetables were different with uptake strongly impacted by soil properties. A fraction of soil-borne metalloid was soluble in the different soils resulting in Sb soil solution concentration (10.75 ± 0.52 μg L(-1)) that could present concern for contamination of water resources. EDTA proved a poor predictor of As and Sb phytoavailability. Oral bioaccessibility, as measured by SBET, was risk from soil borne As and Sb in the floodplain environment.

  1. Determination of antimony in nail and hair by thermal neutron activation analysis

    International Nuclear Information System (INIS)

    The concentration of antimony in nail and hair was determined by thermal neutron activation analysis. Samples were collected from the workers of an antimony refinery, inhabitants near the refinery, and residents in control area. They were irradiated by Kyoto University 5000 kW Reactor for 1 h, and cooled for 30 to 100 days. After cooling, the concentration of Sb in nail and hair was estimated by measuring the intensity of γ-ray from 124Sb of the samples, then the samples were washed by 0.1 % aqueous solution of nonionic surface active agent in an ultrasonic cleaner. The γ-ray spectrometry was done again (after washing). The concentration of Sb in nail before washing was 730 ppm for the workers, 2.46 ppm for habitants near the refinery, and 0.19 ppm for the control; after washing, it became 230 ppm for the workers, 0.63 ppm for habitants, and 0.09 ppm for the control. The concentration of Sb in hair before and after washing was 222 ppm and 196 ppm for the workers, and 0.21 ppm and 0.15 ppm for the control, respectively. (author)

  2. One-step synthesis of antimony-doped tin dioxide nanocrystallites and their property

    Institute of Scientific and Technical Information of China (English)

    ZHENG Min; WANG Bao


    Antimony-doped tin dioxide(ATO) nanoparticles with primary diameter in the range of 9-10 nm were rapidly synthesized via a novel combustion technique, starting with antimony trichloride and tin tetrachloride as metal sources and self-assembly compounds as fuels. The combustion phenomena and characteristics of products were controlled by assembling components in fuel compounds according to appropriate molar ratio. The as-synthesized products were characterized by XRD, SEM, TEM and XPS, respectively. The electrical conductivity was evaluated through measuring the antistatic property of polyester fiber treated by the as-synthesized products. The results show that a mild combustion phenomena without release of smoke can be taken on and perfect azury rutile ATO crystal with complete substitution can be formed rapidly under the appropriate synthetic conditions. The antistatic property of the polyester fiber treated by the as-synthesized ATO products is enhanced remarkably. The triboelectricity voltage below 1.0 kV, half life below 1.0 s and surface resistance below 1.0×106 Ω can be attained.

  3. Growth of antimony doped P-type zinc oxide nanowires for optoelectronics

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Zhong Lin; Pradel, Ken


    In a method of growing p-type nanowires, a nanowire growth solution of zinc nitrate (Zn(NO.sub.3).sub.2), hexamethylenetetramine (HMTA) and polyethylenemine (800 M.sub.w PEI) is prepared. A dopant solution to the growth solution, the dopant solution including an equal molar ration of sodium hydroxide (NaOH), glycolic acid (C.sub.2H.sub.4O.sub.3) and antimony acetate (Sb(CH.sub.3COO).sub.3) in water is prepared. The dopant solution and the growth solution combine to generate a resulting solution that includes antimony to zinc in a ratio of between 0.2% molar to 2.0% molar, the resulting solution having a top surface. An ammonia solution is added to the resulting solution. A ZnO seed layer is applied to a substrate and the substrate is placed into the top surface of the resulting solution with the ZnO seed layer facing downwardly for a predetermined time until Sb-doped ZnO nanowires having a length of at least 5 .mu.m have grown from the ZnO seed layer.

  4. Preparation and characteristics of 117mSn-HEDTMP

    Institute of Scientific and Technical Information of China (English)


    Tin-117m(t1/2 14d; γ 159keV, 86%) is an ideal tracer for studyingbiological behavior of tin compounds as well as for developing clinically-useful radio-pharmaceuticals. It had been reported that Sn-117m[4+] DTPA has unexpectedlyhigh bone uptake and bone-to-blood ratio, and is potentially useful as an agent forskeletal scintigraphy and radiotherapy of bone tumors. In this work, HEDTMP [N-(2-hydroxyethyl) ethlenediamine-1,1,2-tri (methylene phosphonic acid)] was synthesized.Let it form complex with 117mSn. The formation conditions, stability and distributioncoefficient between oil and water of the complex were investigated.``

  5. Effect of Annealing on the Properties of Antimony Telluride Thin Films and Their Applications in CdTe Solar Cells

    Directory of Open Access Journals (Sweden)

    Zhouling Wang


    Full Text Available Antimony telluride alloy thin films were deposited at room temperature by using the vacuum coevaporation method. The films were annealed at different temperatures in N2 ambient, and then the compositional, structural, and electrical properties of antimony telluride thin films were characterized by X-ray fluorescence, X-ray diffraction, differential thermal analysis, and Hall measurements. The results indicate that single phase antimony telluride existed when the annealing temperature was higher than 488 K. All thin films exhibited p-type conductivity with high carrier concentrations. Cell performance was greatly improved when the antimony telluride thin films were used as the back contact layer for CdTe thin film solar cells. The dark current voltage and capacitance voltage measurements were performed to investigate the formation of the back contacts for the cells with or without Sb2Te3 buffer layers. CdTe solar cells with the buffer layers can reduce the series resistance and eliminate the reverse junction between CdTe and metal electrodes.

  6. Progress of Antimony-containing Wastewater Treatment%含锑废水处理技术研究进展

    Institute of Scientific and Technical Information of China (English)

    尹鑫; 周广柱; 王翠珍; 王世豪; 彭刚; 何双


    在锑矿的开采及冶炼加工过程中,排出了大量含锑废水,这种重金属废水对环境和人体健康构成严重威胁。本文总结了重金属锑元素的物理化学性质、毒性特点,归纳了含锑废水的处理方法,分析了含锑废水处理技术的优势和缺点,提出了工艺联合应用等高效处理含锑废水的相关建议。%A large amount of wastewater containing antimony discharged in the process of antimony ore mining,smelting and processing,which pose a serious threat to the environment and human health. In this paper we summarized the characteristics of physical and chemical properties, toxicity of antimony, and the antimony wastewater treatment. Advantages and disadvantages of these treatment crafts were compared in a table,the recommendations given out for more efficiently processing via crafts combination.

  7. Electrochemical, structural and surface characterization of nickel/zirconia solid oxide fuel cell anodes in coal gas containing antimony (United States)

    Marina, Olga A.; Pederson, Larry R.; Coyle, Christopher A.; Thomsen, Edwin C.; Nachimuthu, Ponnusamy; Edwards, Danny J.

    The interactions of antimony with the nickel-zirconia anode in solid oxide fuel cells (SOFCs) have been investigated. Tests with both anode-supported and electrolyte-supported button cells were performed at 700 and 800 °C in synthetic coal gas containing 100 ppb to 9 ppm antimony. Minor performance loss was observed immediately after Sb introduction to coal gas resulting in ca. 5% power output drop. While no further degradation was observed during the following several hundred hours of testing, cells abruptly and irreversibly failed after 800-1600 h depending on Sb concentration and test temperature. Antimony was found to interact strongly with nickel resulting in extensive alteration phase formation, consistent with expectations based on thermodynamic properties. Nickel antimonide phases, NiSb and Ni 5Sb 2, were partially coalesced into large grains and eventually affected electronic percolation through the anode support. Initial degradation was attributed to diffusion of antimony to the active anode/electrolyte interface to form an adsorption layer, while the late stage degradation was due the Ni-Sb phase formation. Assuming an average Sb concentration in coal gas of 0.07 ppmv, a 500 μm thick Ni/zirconia anode-supported cell is not expected to fail within 7 years when operated at a power output of 0.5 W cm -2 and fuel utilization above 50%.

  8. Ambulatory oesophageal pH monitoring : a comparison between antimony, ISFET, and glass pH electrodes

    NARCIS (Netherlands)

    Hemmink, Gerrit J. M.; Weusten, Bas L. A. M.; Oors, Jac; Bredenoord, Albert J.; Timmer, Robin; Smout, Andre J. P. M.


    Background and aim Ambulatory oesophageal pH-impedance monitoring is a widely used test to evaluate patients with reflux symptoms. Several types of pH electrodes are available: antimony, ion sensitive field effect transistor (ISFET), and glass electrodes. These pH electrodes have not been compared d

  9. POLICY China’s Ministry of Commerce Set the Rules for Antimony and Tungsten Export in 2005

    Institute of Scientific and Technical Information of China (English)


    <正> China’s ministry of commerce recently re-leased the rules and application procedures forthe export of antimony and tungsten productsin 2005 by the domestic producers.Based on the rules set by the ministry,China’santimony and tungsten producers providingtheir products for export must be those enter-prises authorized by the related State authori-ties.

  10. Comparative phytotoxicity of methylated and inorganic arsenic- and antimony species to Lemna minor, Wolffia arrhiza and Selenastrum capricornutum

    NARCIS (Netherlands)

    L. Duester; H.G. van der Geest; S. Moelleken; A.V. Hirner; K. Kueppers


    The alkylation of metalloids through the transfer of methyl groups is an important factor in the biogeochemical cycling of elements like arsenic and antimony. In the environment, many different organic and inorganic forms of these elements can therefore be found in soils, sediments or organisms. Stu

  11. 6^Li in the atmosphere of GJ 117

    CERN Document Server

    Christian, D J; Jevremovic, D; Hauschildt, P H; Baron, E


    We present high resolution VLT UVES observations of the active K dwarf GJ 117. 6^Li enhancement has been shown for energetic solar events, one chromospherically active binary, and several dwarf halo stars. Our analysis reveals the detection of 6^Li on this source with 6^Li/7^Li = 0.030+/-0.010. We found no significant contribution from other lines, including Ti I, in the Li profile of GJ 117 and a template star of similar spectral type and metallicity. We discuss the possibility for 6^Li production by spallation and find it to be consistent with the activity levels of the object.

  12. American cutaneous leishmaniasis caused by Leishmania (Viannia) braziliensis resistant to meglumine antimoniate, but with good response to pentamidine: a case report. (United States)

    Pimentel, Maria Inês Fernandes; Baptista, Cibele; Rubin, Evelyn Figueiredo; Vasconcellos, Erica de Camargo Ferreira e; Lyra, Marcelo Rosandiski; Salgueiro, Mariza de Matos; Saheki, Maurício Naoto; Rosalino, Cláudia Maria Valete; Madeira, Maria de Fátima; Silva, Aline Fagundes da; Confort, Eliame Mouta; Schubach, Armando de Oliveira


    This is a case report of a Brazilian soldier with cutaneous leishmaniasis. The lesion relapsed following two systemic treatments with meglumine antimoniate. The patient was treated with amphotericin B, which was interrupted due to poor tolerance. Following isolation of Leishmania sp., six intralesional infiltrations of meglumine antimoniate resulted in no response. Leishmania sp promastigotes were again isolated. The patient was submitted to intramuscular 4 mg/kg pentamidine. Parasites from the first and second biopsies were identified as Leishmania (Viannia) braziliensis; those isolated from the first biopsy were more sensitive to meglumine antimoniate in vitro than those isolated from the second biopsy. No relapse was observed. PMID:21552747

  13. American cutaneous leishmaniasis caused by Leishmania (Viannia) braziliensis resistant to meglumine antimoniate, but with good response to pentamidine: a case report. (United States)

    Pimentel, Maria Inês Fernandes; Baptista, Cibele; Rubin, Evelyn Figueiredo; Vasconcellos, Erica de Camargo Ferreira e; Lyra, Marcelo Rosandiski; Salgueiro, Mariza de Matos; Saheki, Maurício Naoto; Rosalino, Cláudia Maria Valete; Madeira, Maria de Fátima; Silva, Aline Fagundes da; Confort, Eliame Mouta; Schubach, Armando de Oliveira


    This is a case report of a Brazilian soldier with cutaneous leishmaniasis. The lesion relapsed following two systemic treatments with meglumine antimoniate. The patient was treated with amphotericin B, which was interrupted due to poor tolerance. Following isolation of Leishmania sp., six intralesional infiltrations of meglumine antimoniate resulted in no response. Leishmania sp promastigotes were again isolated. The patient was submitted to intramuscular 4 mg/kg pentamidine. Parasites from the first and second biopsies were identified as Leishmania (Viannia) braziliensis; those isolated from the first biopsy were more sensitive to meglumine antimoniate in vitro than those isolated from the second biopsy. No relapse was observed.

  14. 33 CFR 117.734 - Navesink River (Swimming River). (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Navesink River (Swimming River... BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.734 Navesink River (Swimming River). The Oceanic Bridge, mile 4.5, shall open on signal; except that, from December 1...

  15. 45 CFR 146.117 - Special enrollment periods. (United States)


    ..., and Limitations on Preexisting Condition Exclusion Periods § 146.117 Special enrollment periods. (a... enrollment in any benefit package under the plan (subject to plan eligibility rules conditioning dependent... the plan (subject to plan eligibility rules conditioning dependent enrollment on enrollment of...

  16. 27 CFR 26.117 - Action by carrier. (United States)


    ... OF THE TREASURY LIQUORS LIQUORS AND ARTICLES FROM PUERTO RICO AND THE VIRGIN ISLANDS Taxpayment of Liquors and Articles in Puerto Rico Procedure at Port of Arrival § 26.117 Action by carrier. The carrier of the merchandise specified on the Form 487B shall, at the time of unlading at the port of...

  17. 49 CFR 215.117 - Defective roller bearing adapter. (United States)


    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD FREIGHT CAR SAFETY STANDARDS Freight Car Components Suspension System § 215.117 Defective roller bearing adapter. A railroad may not place or continue in service a car, if the car has a roller bearing adapter that is— (a) Cracked or broken; (b) Not in its...

  18. 40 CFR 51.117 - Additional provisions for lead. (United States)


    ... smelters, Lead gasoline additive plants, Lead-acid storage battery manufacturing plants that produce 2,000... 40 Protection of Environment 2 2010-07-01 2010-07-01 false Additional provisions for lead. 51.117... Additional provisions for lead. In addition to other requirements in §§ 51.100 through 51.116 the...

  19. 49 CFR 227.117 - Hearing protector attenuation. (United States)


    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad Operating Employees. § 227.117 Hearing protector attenuation. (a) A railroad shall evaluate hearing... exposure to an 8-hour TWA of 90 decibels or lower, as required by § 227.115. (c) For employees who...

  20. 27 CFR 478.117 - Function outside a customs territory. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Function outside a customs... Importation § 478.117 Function outside a customs territory. In the insular possessions of the United States outside customs territory, the functions performed by U.S. Customs officers under this subpart within...

  1. 42 CFR 433.117 - Initial approval of replacement systems. (United States)


    ... and Information Retrieval Systems § 433.117 Initial approval of replacement systems. (a) A replacement system must meet all conditions of initial approval of a mechanized claims processing and information retrieval system. (b) The agency must submit a APD that includes— (1) The date the replacement system...

  2. Determination of natural isotopic variation in antimony using inductively coupled plasma mass spectrometry for an uncertainty estimation of the standard atomic weight of antimony

    International Nuclear Information System (INIS)

    The isotopic variation of industrially produced antimony was estimated using multiple-collector inductively coupled plasma mass spectrometry. A reproducible 123Sb/121Sb ratio of ±0.004% (2 standard deviations) was routinely obtained using a Sn doping mass discrimination correction technique. Only a small isotopic variation of about 0.05% was observed among industrially important Sb materials (five commercially available reagents and two ore minerals). The degree of Sb isotopic variation to determine the uncertainty in Sb atomic weight can be reduced by this new analytical technique to 0.00025 compared to the currently accepted IUPAC isotopic variation determined by conventional mass spectrometry of ±0.001. Heavy isotope enrichment of Sb in a drainage water sample from a stibnite mining area was found. This heavy isotope enrichment tendency in an aqueous environment may be useful in detecting anthropogenic Sb input from industrial emission by the smelting process via air because Sb of anthropogenic origin will have lighter isotope enrichment features. (author)

  3. Spin dynamics of complex oxides, bismuth-antimony alloys, and bismuth chalcogenides (United States)

    Sahin, Cuneyt

    The emerging field of spintronics relies on the manipulation of electron spin in order to use it in spin-based electronics. Such a paradigm change has to tackle several challenges including finding materials with sufficiently long spin lifetimes and materials which are efficient in generating pure spin currents. This thesis predicts that two types of material families could be a solution to the aforementioned challenges: complex oxides and bismuth based materials. We derived a general approach for constructing an effective spin-orbit Hamiltonian which is applicable to all nonmagnetic materials. This formalism is useful for calculating spin-dependent properties near an arbitrary point in momentum space. We also verified this formalism through comparisons with other approaches for III-V semiconductors, and its general applicability is illustrated by deriving the spin-orbit interaction and predicting spin lifetimes for strained strontium titanate (STO) and a two-dimensional electron gas in STO (such as at the LAO/STO interface). Our results suggest robust spin coherence and spin transport properties in STO related materials even at room temperature. In the second part of the study we calculated intrinsic spin Hall conductivities for bismuth-antimony (BISb) semimetals with strong spin-orbit couplings, from the Kubo formula and using Berry curvatures evaluated throughout the Brillouin zone from a tight-binding Hamiltonian. Nearly crossing bands with strong spin-orbit interaction generate giant spin Hall conductivities in these materials, ranging from 474 ((h/e)O--1cm--1) for bismuth to 96((h/e)O--1cm --1) for antimony; the value for bismuth is more than twice that of platinum. The large spin Hall conductivities persist for alloy compositions corresponding to a three-dimensional topological insulator state, such as Bi0.83Sb0.17. The spin Hall conductivity could be changed by a factor of 5 for doped Bi, or for Bi0.83Sb0.17, by changing the chemical potential by 0.5 e

  4. First-Principles Study of Antimony Doping Effects on the Iron-Based Superconductor CaFe(SbxAs1-x)2 (United States)

    Nagai, Yuki; Nakamura, Hiroki; Machida, Masahiko; Kuroki, Kazuhiko


    We study antimony doping effects on the iron-based superconductor CaFe(SbxAs1-x)2 by using the first-principles calculation. The calculations reveal that the substitution of a doped antimony atom into As of the chainlike As layers is more stable than that into FeAs layers. This prediction can be checked by experiments. Our results suggest that doping homologous elements into the chainlike As layers, which only exist in the novel 112 system, is responsible for rising up the critical temperature. We discuss antimony doping effects on the electronic structure. It is found that the calculated band structures with and without the antimony doping are similar to each other within our framework.

  5. Phytoavailability of antimony and heavy metals in arid regions: the case of the Wadley Sb district (San Luis, Potosí, Mexico). (United States)

    Levresse, G; Lopez, G; Tritlla, J; López, E Cardellach; Chavez, A Carrillo; Salvador, E Mascuñano; Soler, A; Corbella, M; Sandoval, L G Hernández; Corona-Esquivel, R


    This paper presents original results on the Sb and heavy metals contents in sediments and waste tailings, plants and water from the giant Wadley antimony mine district (San Luis Potosí State, Mexico). The dominant antimony phases in mining wastes are stibiconite, montroydite and minor hermimorphite. The waste tailings contain high concentrations of metals and metalloids (antimony, iron, zinc, arsenic, copper, and mercury). Manganese, copper, zinc, and antimony contents exceed the quality guidelines values for groundwater, plants and for waste tailings. Results indicate that peak accumulation is seasonal due to the concentration by high metabolism plants as Solanaceae Nicotiana. The metal phytoavailability in waste tailings is highly dependant on the metal speciation, its capability to be transported in water and, more particularly, the plant metabolism efficiency.

  6. Thermoelectric transport in surface- and antimony-doped bismuth telluride nanoplates (United States)

    Pettes, Michael Thompson; Kim, Jaehyun; Wu, Wei; Bustillo, Karen C.; Shi, Li


    We report the in-plane thermoelectric properties of suspended (Bi1-xSbx)2Te3 nanoplates with x ranging from 0.07 to 0.95 and thicknesses ranging from 9 to 42 nm. The results presented here reveal a trend of increasing p-type behavior with increasing antimony concentration, and a maximum Seebeck coefficient and thermoelectric figure of merit at x ˜ 0.5. We additionally tuned extrinsic doping of the surface using a tetrafluoro-tetracyanoquinodimethane (F4-TCNQ) coating. The lattice thermal conductivity is found to be below that for undoped ultrathin Bi2Te3 nanoplates of comparable thickness and in the range of 0.2-0.7 W m-1 K-1 at room temperature.

  7. Nuclear quadrupole resonance of iodine pentafluoride and its complexes with antimony pentafluoride

    International Nuclear Information System (INIS)

    The spectra of nuclear quadrupole resonance (NQR) have been obtained at 77 deg K for I127 and Sbsup(121,128) in the IF5, IF5xSbF5, IF5x2SbF5, CsIF6, and RbIF6 compounds. An agreement between quadrupole spectra and structural data have been observed. The results of studying IF5 by NQR, gamma resonance and microwave spectroscopy have been compared. It has been established that unshared electron pair of an iodine atom is stereochemically active which leads to a considerable distortion of octahedral symmetry of coordination polyhedron of the iodine atoms. The structure of complexes of iodine pentafluoride with antimony pentafluoride is given

  8. A novel composite material based on antimony(III) oxide and amorphous silica

    Energy Technology Data Exchange (ETDEWEB)

    Zemnukhova, Ludmila A. [Institute of Chemistry, Far-Eastern Branch, Russian Academy of Sciences, 690022 Vladivostok (Russian Federation); Panasenko, Alexander E., E-mail: [Institute of Chemistry, Far-Eastern Branch, Russian Academy of Sciences, 690022 Vladivostok (Russian Federation)


    The composite material nSb₂O₃·mSiO₂·xH₂O was prepared by hydrolysis of SbCl₃ and Na₂SiO₃ in an aqueous medium. It has been shown that the composition of the material is influenced by the ratio of the initial components and the acidity of the reaction medium. The morphology of the material particles and its specific surface area have been determined. The thermal and optic properties were also investigated. - Graphical abstract: Novel composite material containing amorphous silica and crystal antimony(III) oxide has been synthesized by hydrolysis of SbCl₃ and Na₂SiO₃ in an aqueous medium. Highlights: • The composite material nSb₂O₃·mSiO₂·xH₂O was prepared in an aqueous medium. • The composition of the material is controllable by a synthesis conditions. • The morphology of the material and its optic properties have been determined.

  9. Preparation and characterization of conductive antimony-doped tin oxide (ATO) nanoparticles

    Institute of Scientific and Technical Information of China (English)

    LIN; Feng; DUAN; Xue-chen; REN; Xian-jing


    In this paper, conductive antimony-doped tin oxide (ATO) composite particles is prepared by hydroxylation method of metal alcoxides. This method has many advantages such as little pollution, low cost, simple sheet and equipment. The synthesis processing and the ATO nanoparticles are characterized by means of transmission electron microscope (TEM), X-ray diffraction (XRD), thermal gravimetric and differential thermal analysis, and BET. The results show that the ATO nanoparticles is tetragonal rutile crystal structure. TEM show that the particles are monodispersed with weak aggromation. The size of the particles calcinated at 700 is about 8nm. The specific areas are 153 m2 · g-1. In addition to, ATO nanop articles have good electric properties

  10. Sequential solvent extraction for forms of antimony in five selected coals (United States)

    Qi, C.; Liu, Gaisheng; Kong, Y.; Chou, C.-L.; Wang, R.


    Abundance of antimony in bulk samples has been determined in five selected coals, three coals from Huaibei Coalfield, Anhui, China, and two from the Illinois Basin in the United States. The Sb abundance in these samples is in the range of 0.11-0.43 ??g/g. The forms of Sb in coals were studied by sequential solvent extraction. The six forms of Sb are water soluble, ion changeable, organic matter bound, carbonate bound, silicate bound, and sulfide bound. Results of sequential extraction show that silicate-bound Sb is the most abundant form in these coals. Silicate- plus sulfide-bound Sb accounts for more than half of the total Sb in all coals. Bituminous coals are higher in organic matterbound Sb than anthracite and natural coke, indicating that the Sb in the organic matter may be incorporated into silicate and sulfide minerals during metamorphism. ?? 2008 by The University of Chicago. All rights reserved.

  11. Reduced Graphene Oxide/Tin-Antimony Nanocomposites as Anode Materials for Advanced Sodium-Ion Batteries. (United States)

    Ji, Liwen; Zhou, Weidong; Chabot, Victor; Yu, Aiping; Xiao, Xingcheng


    Reduced graphene oxides loaded with tin-antimony alloy (RGO-SnSb) nanocomposites were synthesized through a hydrothermal reaction and the subsequent thermal reduction treatments. Transmission electron microscope images confirm that SnSb nanoparticles with an average size of about 20-30 nm are uniformly dispersed on the RGO surfaces. When they were used as anodes for rechargeable sodium (Na)-ion batteries, these as-synthesized RGO-SnSb nanocomposite anodes delivered a high initial reversible capacity of 407 mAh g(-1), stable cyclic retention for more than 80 cycles and excellent cycle stability at ultra high charge/discharge rates up to 30C. The significantly improved performance of the synthesized RGO-SnSb nanocomposites as Na-ion battery anodes can be attributed to the synergetic effects of RGO-based flexible framework and the nanoscale dimension of the SnSb alloy particles (batteries.

  12. Novel antimony doped tin oxide/carbon aerogel as efficient electrocatalytic filtration membrane

    Directory of Open Access Journals (Sweden)

    Zhimeng Liu


    Full Text Available A facile method was developed to prepare antimony doped tin oxide (Sb-SnO2/carbon aerogel (CA for use as an electrocatalytic filtration membrane. The preparation process included synthesis of a precursor sol, impregnation, and thermal decomposition. The Sb-SnO2, which was tetragonal in phase with an average crystallite size of 10.8 nm, was uniformly distributed on the CA surface and firmly attached via carbon-oxygen-tin chemical bonds. Preliminary filtration tests indicated that the Sb-SnO2/CA membrane had a high rate of total organic carbon removal for aqueous tetracycline owing to its high current efficiency and electrode stability.

  13. Novel fabrication of an electrochromic antimony-doped tin oxide film using a nanoparticle deposition system (United States)

    Kim, Hyungsub; Park, Yunchan; Choi, Dahyun; Ahn, Sung-Hoon; Lee, Caroline Sunyong


    Novel deposition method of Antimony-doped tin oxide (ATO) thin films was introduced using a nanoparticle deposition system (NPDS) to fabricate an electrochromic (EC) device. NPDS is a dry deposition method that simplifies the ATO deposition process by eliminating the need for solvents or binders. In this study, an ATO EC layer was deposited using NPDS. The surface morphology and electrochemical and optical transmittance properties were characterized. The optical transmittance change in the ATO EC device was ∼35% over the wavelength range of 350-800 nm, and the cyclic transmittance was stable. The ATO film deposited using NPDS, exhibited a coloration efficiency of 15.5 cm2 C-1. Therefore, our results suggest that ATO EC devices can be fabricated using a simple, cost-effective NPDS, which allows nanoparticles to be deposited directly without pre- or post-processing.

  14. Microbial diversity and community structure in an antimony-rich tailings dump. (United States)

    Xiao, Enzong; Krumins, Valdis; Dong, Yiran; Xiao, Tangfu; Ning, Zengping; Xiao, Qingxiang; Sun, Weimin


    To assess the impact of antimony (Sb) on microbial community structure, 12 samples were taken from an Sb tailings pile in Guizhou Province, Southwest China. All 12 samples exhibited elevated Sb concentrations, but the mobile and bioaccessible fractions were small in comparison to total Sb concentrations. Besides the geochemical analyses, microbial communities inhabiting the tailing samples were characterized to investigate the interplay between the microorganisms and environmental factors in mine tailings. In all samples, Proteobacteria and Actinobacteria were the most dominant phyla. At the genus level, Thiobacillus, Limnobacter, Nocardioides, Lysobacter, Phormidium, and Kaistobacter demonstrated relatively high abundances. The two most abundant genera, Thiobacillus and Limnobacter, are characterized as sulfur-oxidizing bacteria and thiosulfate-oxidizing bacteria, respectively, while the genus Lysobacter contains arsenic (As)-resistant bacteria. Canonical correspondence analysis (CCA) indicates that TOC and the sulfate to sulfide ratio strongly shaped the microbial communities, suggesting the influence of the environmental factors in the indigenous microbial communities. PMID:27188777

  15. Properties of antimony doped ZnO thin films deposited by spray pyrolysis technique

    Energy Technology Data Exchange (ETDEWEB)

    Sadananda Kumar, N., E-mail:; Bangera, Kasturi V.; Shivakumar, G. K. [National Institute of Technology Karnataka, Surathkal, Thin Films Laboratory, Department of Physics (India)


    Antimony (Sb) doped zinc oxide (ZnO) thin films were deposited on the glass substrate at 450°C using spray pyrolysis technique. Effect of Sb doping on surface morphology structural, optical and electrical properties were studied. X-ray diffraction (XRD) analysis showed that both the undoped and doped ZnO thin films are polycrystalline in nature with (101) preferred orientation. SEM analysis showed a change in surface morphology of Sb doped ZnO thin films. Doping results in a marked increase in conductivity without affecting the transmittance of the films. ZnO films prepared with 3 at % Sb shows the lowest resistivity of 0.185 Ohm cm with a Hall mobility of 54.05 cm{sup 2} V{sup –1} s{sup –1}, and a hole concentration of 6.25 × 10{sup 17} cm{sup –3}.

  16. Renal function evaluation in patients with American Cutaneous Leishmaniasis after specific treatment with pentavalent antimonial

    Directory of Open Access Journals (Sweden)

    Oliveira Rodrigo A


    Full Text Available Abstract Background Renal evaluation studies are rare in American Cutaneous Leishmaniasis (ACL. The aim of this study is to investigate whether specific treatment reverts ACL-associated renal dysfunction. Methods A prospective study was conducted with 37 patients with ACL. Urinary concentrating and acidification ability was assessed before and after treatment with pentavalent antimonial. Results The patients mean age was 35.6 ± 12 years and 19 were male. Before treatment, urinary concentrating defect (U/Posm Conclusion As previously described, urinary concentrating and acidification defects were found in an important number of patients with ACL. Present results demonstrate that only some patients recover urinary acidification capacity, while no one returned to normal urinary concentration capacity.

  17. Supermolecular template route to fabrication of well crystallized hollow antimony microspheres

    Institute of Scientific and Technical Information of China (English)

    GU Li; CHEN Shu-da; WEI Xiao-yan


    Hollow spheres of elemental antimony (Sb) with good crystallinity, high contrast and thin wall were prepared in the solutions of poly(ethylene glycol) (PEG) and oleic acid(OA) associations at the refluxed temperature. The complexes of Sb3+ with tartaric acid were used as precursors, which can avoid the hydrolysis of SbCl3 and the resulting impurity of products. The average diameter and thickness of the as-prepared hollow sphere are about 300 nm and less than 20 nm, respectively. The formation of hollow spheres depends on the template function of PEG and OA associations, which can be confirmed through the theoretical analysis and results of control experiments. The specific surface area reaches 34.669 m2/g.

  18. 锑环境健康效应的研究进展%Environmental Health Effect of Antimony: a Review of Recent Researches

    Institute of Scientific and Technical Information of China (English)

    戈兆凤; 韦朝阳


    随着锑的开采及含锑产品的广泛应用,锑所带来的污染问题已越来越严重,锑对环境与健康的危害也受到了更多的关注.该文总结了锑环境健康效应的研究进展,从医学、环境毒理学和生态毒理学的角度分别分析了锑对人、动物以及植物与土壤生物的健康效应.提示今后还需加强锑的致癌性及基因毒性研究,并需从微观与宏观尺度揭示锑的毒性效应,以期为锑的环境健康风险评估提供科学依据.%The antimony mining and widely use of antimony products have resulted in serious antimony contamination,causing hazards to both the environment and human health. The present paper summarized the research progresses on the environmental health effect of antimony. The health effects of antimony on human, animals, and plants as well as soil organisms are introduced and discussed in the view of medical science, environmental toxicology and ecological toxicology, respectively. It is suggested that more researches should be conducted on antimony earcinogenieity and genotoxicity, and the toxic effects of antimony should be explored from micro and macroscopic scales in order to provide the scientific basis for risk assessment of antimony.

  19. Successful treatment of feline leishmaniosis using a combination of allopurinol and N-methyl-glucamine antimoniate

    Directory of Open Access Journals (Sweden)

    Maria Alexandra Basso


    Full Text Available Case summary This work describes the diagnosis and successful treatment of a 2-year-old domestic cat infected with Leishmania species and presenting fever, and ulcerative and nodular skin lesions after being treated for pyodermatitis for 1 year without clinical improvement. After anamnesis the cat was submitted to a complete clinical examination. Blood was collected for determination of haematological and biochemical parameters, detection of feline leukaemia virus (FeLV, feline immunodeficiency virus (FIV, feline coronavirus (FCoV and Leishmania amastigotes. Fine-needle aspiration puncture from the skin nodules was also performed. After definitive diagnosis the animal was treated and followed up over a 2 year period. The animal tested negative for FIV-specific antibodies, FeLV antigen and feline coronavirus RNA. Leishmania amastigotes in the skin nodules were confirmed by cytology and molecular diagnosis. Treatment was initiated with allopurinol, resulting in a slight clinical improvement. Thus, N-methyl-glucamine antimoniate was added and administered for 30 days, with complete closure of the ulcerative lesions in the hindlimbs requiring a surgical approach. Close monitoring of the patient in the following 24 months indicated that combined therapy was safe and clinical cure was achieved without further relapses or side effects. Relevance and novel information Considering the increasing number of feline leishmaniosis cases and the inconsistent results of most therapeutic protocols described in the literature, the use of new approaches, especially in refractory cases, is essential. Although the use of allopurinol and N-methyl-glucamine antimoniate is off-label in cats, in this case the combination treatment was followed by an extensive analytical monitoring, supporting their safety and effectiveness.

  20. Infrared-to-red upconversion luminescence in samarium-doped antimony glasses

    International Nuclear Information System (INIS)

    A new antimony-based glass system (K2O-B2O3-Sb2O3) having low phonon energy (about 600 cm-1) doped with Sm3+ ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-Visible-near infrared (UV-Vis-NIR) absorption and photoluminescence upconversion properties with the spectrochemistry of the 15K2O-15B2O3-70Sb2O3 (mol%) glasses have been studied doping with different concentrations (0.1-1.0 wt%) of Sm2O3. UV-Vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 949 nm at room temperature. Three upconverted bands originating from the 4G5/2→6H5/2, 4G5/2→6H7/2 and 4G5/2→6H9/2 transitions are found to be centered at 566 (green, weak), 602 (orange, weak) and 636 (red, remarkably strong) nm, respectively. These bands have been explained from the evaluation of the absorption, normal (downconversion) fluorescence and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level (4G5/2) by multiphonon deexcitation effect. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm-1, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm-1)

  1. Optical properties of Eu3+-doped antimony-oxide-based low phonon disordered matrices (United States)

    Som, Tirtha; Karmakar, Basudeb


    A new series of monolithic Eu2O3-doped high antimony oxide (40-80 mol%) content disordered matrices (glasses) of low phonon energy (about 600 cm-1) in the K2O-B2O3-Sb2O3 (KBS) system was prepared by the melt-quench technique. Infrared reflection spectroscopy was used to establish the low phonon energy of the glasses. Amorphicity and devitrification of the glasses were confirmed by x-ray diffraction analysis. UV-vis absorption spectra of Eu3+ have been measured and the band positions have been justified with quantitative calculation of the nephelauxetic parameter and covalent bonding characteristics of the host. These Eu2O3-doped glasses upon excitation at 393 nm radiation exhibit six emission bands in the range 500-750 nm due to their low phonon energy. Of these, the magnetic dipole ^{5}\\mathrm {D}_{0} \\to {}^{7} \\mathrm {F_{1}} transition shows small Stark splitting while the electric dipole ^{5}\\mathrm {D}_{0} \\to {}^{7}\\mathrm {F}_{2} transition undergoes remarkable Stark splitting into two components. They have been explained by the crystal field effect. The Judd-Ofelt parameters, Ωt = 2,4,6, were also evaluated and the change of Ωt with the glass composition was correlated with the asymmetric effect at Eu3+ ion sites and the fundamental properties like covalent character and optical basicity. We are the first to report the spectroscopic properties of the Eu3+ ion in KBS low phonon antimony glasses.

  2. Optical characterization of antimony-based bismuth-doped thin films with different annealing temperatures

    Institute of Scientific and Technical Information of China (English)

    Xinmiao Lu; Yiqun Wu; Yang Wang; Jinsong Wei


    Antimony-b ased bismuth-doped thin film,a new kind of super-resolution mask layer,is prepared by magnetron sputtering.The structures and optical constants of the thin films before and after annealing are examined in detail.The as-deposited film is mainly in an amorphous state.After annealing at 170-370℃,it is converted to the rhombohedral-type of structure.The extent of crystallization increased with the annealing temperature.When the thin film is annealed,its refractive index decreased in the most visible region,whereas the extinction coefficient and reflectivity are markedly increased.The results indicate that the optical parameters of the film strongly depend on its microstructure and the bonding of the atoms.As demand for ultrahigh-density information storage continues to grow the recording mark size in optical memory is reduced to the nanometer scale [1- 4].Exceeding the optical diffraction limit with traditional optical storage technology has become a challenge[5-6].%Antimony-based bismuth-doped thin film, a new kind of super-resolution mask layer, is prepared by magnetron sputtering. The structures and optical constants of the thin films before and after annealing are examined in detail. The as-deposited film is mainly in an amorphous state. After annealing at 170-370℃, it is converted to the rhombohedral-type of structure. The extent of crystallization increased with the annealing temperature. When the thin film is annealed, its refractive index decreased in the most visible region, whereas the extinction coefficient and reflectivity are markedly increased. The results indicate that the optical parameters of the film strongly depend on its microstructure and the bonding of the atoms.

  3. Decreased antimony uptake and overexpression of genes of thiol metabolism are associated with drug resistance in a canine isolate of Leishmania infantum. (United States)

    Gómez Pérez, Verónica; García-Hernandez, Raquel; Corpas-López, Victoriano; Tomás, Ana M; Martín-Sanchez, Joaquina; Castanys, Santiago; Gamarro, Francisco


    Visceral leishmaniasis (VL) caused by the protozoan parasite Leishmania infantum, is one of the most important zoonotic diseases affecting dogs and humans in the Mediterranean area. The presence of infected dogs as the main reservoir host of L. infantum is regarded as the most significant risk for potential human infection. We have studied the susceptibility profile to antimony and other anti-leishmania drugs (amphotericin B, miltefosine, paromomycin) in Leishmania infantum isolates extracted from a dog before and after two therapeutic interventions with meglumine antimoniate (subcutaneous Glucantime(®), 100 mg/kg/day for 28 days). After the therapeutic intervention, these parasites were significantly less susceptible to antimony than pretreatment isolate, presenting a resistance index of 6-fold to Sb(III) for promastigotes and >3-fold to Sb(III) and 3-fold to Sb(V) for intracellular amastigotes. The susceptibility profile of this resistant L. infantum line is related to a decreased antimony uptake due to lower aquaglyceroporin-1 expression levels. Additionally, other mechanisms including an increase in thiols and overexpression of enzymes involved in thiol metabolism, such as ornithine decarboxylase, trypanothione reductase, mitochondrial tryparedoxin and mitochondrial tryparedoxin peroxidase, could contribute to the resistance as antimony detoxification mechanisms. A major contribution of this study in a canine L. infantum isolate is to find an antimony-resistant mechanism similar to that previously described in other human clinical isolates. PMID:27317865

  4. Relativistic mean field study of the properties of Z=117 nucleus and the decay chains of $^{293,294}$117 isotopes

    CERN Document Server

    Bhuyan, M


    We have calculated the binding energy, root-mean-square radius and quadrupole deformation parameter for the recently synthesized superheavy element Z=117, using the axially deformed relativistic mean field (RMF) model. The calculation is extended to various isotopes of Z=117 element, strarting from A=286 till A=310. We predict almost spherical structures in the ground state for almost all the isotopes. A shape transition appears at about A=292 from prolate to a oblate shape structures of Z=117 nucleus in our mean field approach. The most stable isotope (largest binding energy per nucleon) is found to be the $^{288}$117 nucleus. Also, the Q-value of $\\alpha$-decay $Q_\\alpha$ and the half-lives $T_{\\alpha}$ are calculated for the $\\alpha$-decay chains of $^{293}$117 and $^{294}$117, supporting the magic numbers at N=172 and/ or 184.

  5. 40 CFR 117.13 - Applicability to discharges from publicly owned treatment works and their users. (United States)


    ... SUBSTANCES Applicability § 117.13 Applicability to discharges from publicly owned treatment works and their... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Applicability to discharges from publicly owned treatment works and their users. 117.13 Section 117.13 Protection of...

  6. 21 CFR 111.117 - What quality control operations are required for equipment, instruments, and controls? (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false What quality control operations are required for equipment, instruments, and controls? 111.117 Section 111.117 Food and Drugs FOOD AND DRUG ADMINISTRATION... and Process Control System: Requirements for Quality Control § 111.117 What quality control...

  7. 33 CFR 117.821 - Atlantic Intracoastal Waterway, Albermarle Sound to Sunset Beach. (United States)


    ..., Albermarle Sound to Sunset Beach. 117.821 Section 117.821 Navigation and Navigable Waters COAST GUARD... § 117.821 Atlantic Intracoastal Waterway, Albermarle Sound to Sunset Beach. (a) The drawbridges across... this paragraph: (1) Onslow Beach Swing Bridge, mile 240.7, at Cap Lejeune, NC, between 7 a.m. and 7...

  8. 41 CFR 102-117.280 - What aspects of the TSP's performance are important to measure? (United States)


    ...) Percentage of customer satisfaction reports on carrier performance. ...'s performance are important to measure? 102-117.280 Section 102-117.280 Public Contracts and... § 102-117.280 What aspects of the TSP's performance are important to measure? Important TSP...

  9. 41 CFR 102-117.220 - What choices do I have to ship HHG? (United States)


    ... Management Program (CHAMP); (3) Contracting directly with a TSP, (including a relocation company that offers... to ship HHG? 102-117.220 Section 102-117.220 Public Contracts and Property Management Federal...-TRANSPORTATION MANAGEMENT Shipping Household Goods § 102-117.220 What choices do I have to ship HHG? (a) You...

  10. 25 CFR 117.2 - Payment of taxes of adult Indians. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Payment of taxes of adult Indians. 117.2 Section 117.2... COMPETENCY § 117.2 Payment of taxes of adult Indians. The superintendent may cause to be paid out of any money heretofore accrued or hereafter accruing to the credit of any adult Indian all taxes of every...

  11. 21 CFR 163.117 - Cocoa with dioctyl sodium sulfosuccinate for manufacturing. (United States)


    ... manufacturing. 163.117 Section 163.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND... Standardized Cacao Products § 163.117 Cocoa with dioctyl sodium sulfosuccinate for manufacturing. (a) Description. Cocoa with dioctyl sodium sulfosuccinate for manufacturing is the food additive complying...

  12. 29 CFR 780.117 - “Production, cultivation, growing.” (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false âProduction, cultivation, growing.â 780.117 Section 780.117... General Scope of Agriculture âproduction, Cultivation, Growing, and Harvestingâ of Commodities § 780.117 “Production, cultivation, growing.” (a) The words “production, cultivation, growing” describe actual...

  13. Sodium Antimony Gluconate Induces Generation of Reactive Oxygen Species and Nitric Oxide via Phosphoinositide 3-Kinase and Mitogen-Activated Protein Kinase Activation in Leishmania donovani-Infected Macrophages


    Mookerjee Basu, Jayati; Mookerjee, Ananda; Sen, Prosenjit; Bhaumik, Suniti; Sen, Pradip; Banerjee, Subha; Naskar, Ksudiram; Choudhuri, Soumitra K.; Saha, Bhaskar; Raha, Sanghamitra; Roy, Syamal


    Pentavalent antimony complexes, such as sodium stibogluconate and sodium antimony gluconate (SAG), are still the first choice for chemotherapy against various forms of leishmaniasis, including visceral leishmaniasis, or kala-azar. Although the requirement of a somewhat functional immune system for the antileishmanial action of antimony was reported previously, the cellular and molecular mechanism of action of SAG was not clear. Herein, we show that SAG induces extracellular signal-regulated k...

  14. Remediation of antimony-rich mine waters: Assessment of antimony removal and shifts in the microbial community of an onsite field-scale bioreactor. (United States)

    Sun, Weimin; Xiao, Enzong; Kalin, Margarete; Krumins, Valdis; Dong, Yiran; Ning, Zengping; Liu, Tong; Sun, Min; Zhao, Yanlong; Wu, Shiliang; Mao, Jianzhong; Xiao, Tangfu


    An on-site field-scale bioreactor for passive treatment of antimony (Sb) contamination was installed downstream of an active Sb mine in Southwest China, and operated for one year (including a six month monitoring period). This bioreactor consisted of five treatment units, including one pre-aerobic cell, two aerobic cells, and two microaerobic cells. With the aerobic cells inoculated with indigenous mine water microflora, the bioreactor removed more than 90% of total soluble Sb and 80% of soluble antimonite (Sb(III)). An increase in pH and decrease of oxidation-reduction potential (Eh) was also observed along the flow direction. High-throughput sequencing of the small subunit ribosomal RNA (SSU rRNA) gene variable (V4) region revealed that taxonomically diverse microbial communities developed in the bioreactor. Metal (loid)-oxidizing bacteria including Ferrovum, Thiomonas, Gallionella, and Leptospirillum, were highly enriched in the bioreactor cells where the highest total Sb and Sb(III) removal occurred. Canonical correspondence analysis (CCA) indicated that a suite of in situ physicochemical parameters including pH and Eh were substantially correlated with the overall microbial communities. Based on an UPGMA (Unweighted Pair Group Method with Arithmetic Mean) tree and PCoA (Principal Coordinates Analysis), the microbial composition of each cell was distinct, indicating these in situ physicochemical parameters had an effect in shaping the indigenous microbial communities. Overall, this study was the first to employ a field-scale bioreactor to treat Sb-rich mine water onsite and, moreover, the findings suggest the feasibility of the bioreactor in removing elevated Sb from mine waters. PMID:27208755

  15. 40 CFR 117.3 - Determination of reportable quantities. (United States)


    ...) Benzoyl chloride C 1,000 (454) Benzyl chloride B 100 (45.4) Beryllium chloride X 1 (0.454) Beryllium... Determination of reportable quantities. Each substance in Table 117.3 that is listed in Table 302.4, 40 CFR part... cyanohydrin A 10 (4.54) Acetyl bromide D 5,000 (2,270) Acetyl chloride D 5,000 (2,270) Acrolein X 1...

  16. International Space Station (ISS) Configuration Post STS-117 Mission (United States)


    Eight days of construction resumed on the International Space Station (ISS), as STS-117 astronauts and mission specialists and the Expedition 15 crew completed installation of the second and third starboard truss segments (S3 and S4). Back dropped by the blackness of space, its newly expanded configuration is revealed as pilot Lee Archambault conducts a fly around upon departure from the station on June 19, 2007.

  17. Cyanide and antimony thermodynamic database for the aqueous species and solids for the EPA-MINTEQ geochemical code

    Energy Technology Data Exchange (ETDEWEB)

    Sehmel, G.A.


    Thermodynamic data for aqueous species and solids that contain cyanide and antimony were tabulated from several commonly accepted, published sources of thermodynamic data and recent journal article. The review does not include gases or organic complexes of either antimony or cyanide, nor does the review include the sulfur compounds of cyanide. The basic thermodynamic data, f,298//sup o/, f,298//sup o/, and S/sub f//sup o/ values, were chosen to represent each solid phase and aqueous species for which data were available in the appropriate standard state. From these data the equilibrium constants (log K/sub r,298//sup o/) and enthalpies of reaction ( r,298//sup o/) at 298 K (25/degree/C) were calculated for reactions involving the formation of these aqueous species and solids from the basic components. 34 refs., 14 tabs.

  18. Antimony incorporation in InAs quantum dots grown on GaAs substrate by molecular beam epitaxy (United States)

    Rihani, J.; Sallet, V.; Christophe, H. J.; Oueslati, M.; Chtourou, R.


    We have grown InAs(Sb) quantum dots (QDs) on GaAs (0 0 1) substrates by molecular beam epitaxy (MBE) using two different antimony exposures ( ΦSb). Atomic force microscopy (AFM) and photoluminescence (PL) spectroscopy were carried out to investigate the dot size evolution as function of the incorporated antimony content in InAs/GaAs QDs material. Anomalous asymmetric-band feature was observed in room temperature photoluminescence (RTPL) spectra of the investigated QD samples grown at relatively high temperature (490 °C). From the temperature-dependent PL measurements, it was found that the asymmetric-band feature is associated with the ground-states transitions from QDs with bimodal size distribution. The analysis of the pump power dependent PL spectra allows us to suggest a type II band lineup for the InAsSb/GaAs QDs materials system.

  19. Interest of lymphoscintigraphy with 99sup(m)Tc-labelled antimony sulfide in the arms after breast carcinoma treatment

    International Nuclear Information System (INIS)

    2 mCi of antimony sulfide colloid labelled with sup(99m)Tc were injected subcutaneously between the digits in 25 patients with postoperative lymphoedema of the arm for breast carcinoma. The two arms are examined successively, the normal one being used as control. The lymphoscintigraphy is realised with a gamma camera during an hour. The information obtained is threefoled; on the peripheral block's importance, the place where the lymphatic flow is stopped, and the presence in 40% of patients of axillary lymph nodes. The diminution of the lymphatic flow is not in correlation with the lymphoedema's importance. Lymphoscintigraphy with sup(99m)Tc antimony sulfide colloid is a simple examination but some side effects may occur. In 7 patients, post-injection lymphangitis was observed, with favorable evolution under antibiotic treatment. The lymphoscintigraphy can give some interesting information on the evolution of treated lymphoedema

  20. Co-administration of glycyrrhizic acid with the antileishmanial drug sodium antimony gluconate (SAG) cures SAG-resistant visceral leishmaniasis. (United States)

    Bhattacharjee, Amrita; Majumder, Saikat; Majumdar, Suchandra Bhattacharyya; Choudhuri, Soumitra Kumar; Roy, Syamal; Majumdar, Subrata


    Since there are very few affordable antileishmanial drugs available, antimonial resistance has crippled antileishmanial therapy, thereby emphasising the need for development of novel therapeutic strategies. This study aimed to evaluate the antileishmanial role of combined therapy with sodium antimony gluconate (SAG) and the triterpenoid glycyrrhizic acid (GA) against infection with SAG-resistant Leishmania (GE1F8R). Combination therapy with GA and SAG successfully limited infection with SAG-resistant Leishmania in a synergistic manner (fractional inhibitory concentration index resistant Leishmania and co-treated with GA and SAG exhibited a significant reduction in hepatic and splenic parasite burden. In probing the mechanism, it was observed that GA treatment suppressed the expression and efflux activity of P-glycoprotein (P-gp) and multidrug resistance-associated protein 1 (MRP1), two host ABC transporters responsible for antimony efflux from host cells infected with SAG-resistant parasites. This suppression correlated with greater intracellular antimony retention during SAG therapy both in vitro and in vivo, which was reflected in the reduced parasite load. Furthermore, co-administration of GA and SAG induced a shift in the cytokine balance towards a Th1 phenotype by augmenting pro-inflammatory cytokines (such as IL-12, IFNγ and TNFα) and inducing nitric oxide generation in GE1F8R-infected macrophages as well as GE1F8R-infected mice. This study aims to provide an affordable leishmanicidal alternative to expensive antileishmanial drugs such as miltefosine and amphotericin B. Furthermore, this report explores the role of GA as a resistance modulator in MRP1- and P-gp-overexpressing conditions. PMID:25600891

  1. Exploring screen printing technology on thermoelectric energy harvesting with printing copper-nickel and bismuth-antimony thermocouples


    Cao, Zhuo; Koukharenko, Elena; Torah, R; Beeby, SP


    This paper reports the fabrication and testing of copper (Cu) - nickel (Ni) and bismuth (Bi) - antimony (Sb) based thermocouples fabricated using screen printing technology. The transport properties of the printed thermoelectric material were measured in room temperature while the Seebeck voltage and power output of the printed thermocouples were tested under a variety temperature gradient. Initial thermoelectric materials have been integrated in inks and then deposited on substrate by the si...

  2. The Potential Impact of Biofield Energy Treatment on the Atomic and Physical Properties of Antimony Tin Oxide Nanopowder


    Trivedi, Mahendra Kumar


    Antimony tin oxide (ATO) is known for its high thermal conductivity, optical transmittance, and wide energy band gap, which makes it a promising material for the display devices, solar cells, and chemical sensor industries. The present study was undertaken to evaluate the effect of biofield energy treatment on the atomic and physical properties of ATO nanopowder. The ATO nanopowder was divided into two parts: control and treated. The treated part was subjected to Mr. Trivedi’s biofield ...

  3. The influence of remelting on the properties of AlSi6Cu4 alloy modified by antimony


    D. Medlen; D. Bolibruchova


    The paper deals with the problem of multiple remelting influence on AlSi6Cu4 alloy modified by antimony on chosen mechanical characteristics, microstructure and gas content. This foundry alloy is used mostly in automotive industry. Foundry Aluminum-Silicon alloys are also used in number of industrial weight sensitive applications because of their low weight and very good castability and good mechanical properties. Modifiers are usually added to molten aluminum-silicon alloys to refine the eut...



    Iwasaki, Y.; Fujimoto, K


    A sharp grain boundary peak appears in both 2 and 3% silicon-iron alloys due to a substitutional solute of silicon. This peak is highly sensitive to the segregation of the third element of antimony and, contrary to orthodox solute peaks in binary and ternary alloys, largely decreases in magnitude on heating after a segregation treatment. The subsequent measurement on cooling returns the peak to the ordinary magnitude. As a function of annealing time at a temperature of segregation, the height...

  5. Evaluation of potential dietary toxicity of heavy metals in some common Nigerian beverages: A look at antimony, tin and mercury

    Directory of Open Access Journals (Sweden)

    I.I. Roberts


    Full Text Available There is currently little information on the composition of heavy metals in beverages imported and locally produced in Nigeria. The study quantitatively determined the composition of antimony (Sb, tin (Sn and mercury (Hg in 50 different beverage samples and evaluated the extent of violation of guideline values. Analysis of the beverage samples for the presence of Sb, Sn, and Hg was carried out using an atomic absorption spectrophotometer (AAS 929. The mean values detected for mercury, tin and antimony (±SE in fruit juices and soft drinks were 2.39±0.25, 3.66±0.22 and 0.49±0.048 μg/l; 2.93±0.34, 3.60±0.46 and 0.49±0.10 μg/l in dairy drinks and 0.94±0.02, 4.34±0.48 and 0.48±0.05 μg/l in bottled water samples respectively. While antimony detected in all products was below guideline values, mercury and tin were above the acceptable levels established by the World Health Organization, United States Environmental Protection Agency and European Union in most samples tested.

  6. Precipitation of antimony from the solution of sodium thioantimonite by air oxidation in the presence of catalytic agents

    Institute of Scientific and Technical Information of China (English)

    杨天足; 赖琼琳; 唐建军; 楚广


    The behavior of antimony oxidation in the solution of sodium thioantimonite was studied in the presence of catalytic agents. The catalytic effects of the respective addition of cupric sulfate, sodium tartrate, potassium permanganate, phenol, 1,2-dihydroxybenzene and their combination on the oxidation of sodium thioantimonite were investigated. A pilot test was carried out. The results show that the respective use of sodium tartrate, cupric sulfate, potassium permanganate, phenol and 1,2-dihydroxybenzene have little catalytic effect on the oxidation of sodium thioantimonite. However there exists obvious catalytic oxidation by the combination of 0.25 g/L 1,2-dihydroxybenzene, 0.5 g/L potassium permanganate and 1.0 g/L phenol. Moreover, high blast intensity, the increase of temperature and NaOH concentration favor the oxidation of antimony. The oxidation process of antimony has such advantages as quick reaction and low operation costs. The results of the pilot test are consistent with those of laboratory experiments.

  7. Separation of Lead from Crude Antimony by Pyro-Refining Process with NaPO3 Addition (United States)

    Ye, Longgang; Hu, Yuejie; Xia, Zhimei; Chen, Yongming


    The main purpose of this study was to separate lead from crude antimony through an oxidation pyro-refining process and by using sodium metaphosphate as a lead elimination reagent. The process parameters that will affect the refining results were optimized experimentally under controlled conditions, such as the sodium metaphosphate charging dosage, the refining temperature and duration, and the air flow rate, to determine their effect on the lead content in refined antimony and the lead removal rate. A minimum lead content of 0.0522 wt.% and a 98.6% lead removal rate were obtained under the following optimal conditions: W_{{{NaPO}_{{3}} }} = 15% W Sb (where W represents weight), a refining temperature of 800°C, a refining time of 30 min, and an air flow rate of 3 L/min. X-ray diffractometry and scanning electron microscopy showed that high-purity antimony was obtained. The smelting operation is free from smoke or ammonia pollution when using monobasic sodium phosphate or ammonium dihydrogen phosphate as the lead elimination reagent. However, this refining process can also remove a certain amount of sulfur, cobalt, and silicon simultaneously, and smelting results also suggest that sodium metaphosphate can be used as a potential lead elimination reagent for bismuth and copper refining.


    LYRA, Marcelo Rosandiski; PASSOS, Sonia Regina Lambert; PIMENTEL, Maria Inês Fernandes; BEDOYA-PACHECO, Sandro Javier; VALETE-ROSALINO, Cláudia Maria; VASCONCELLOS, Erica Camargo Ferreira; ANTONIO, Liliane Fatima; SAHEKI, Mauricio Naoto; SALGUEIRO, Mariza Mattos; SANTOS, Ginelza Peres Lima; RIBEIRO, Madelon Noato; CONCEIÇÃO-SILVA, Fatima; MADEIRA, Maria Fatima; SILVA, Jorge Luiz Nunes; FAGUNDES, Aline; SCHUBACH, Armando Oliveria


    SUMMARY American tegumentary leishmaniasis is an infectious disease caused by a protozoan of the genus Leishmania. Pentavalent antimonials are the first choice drugs for cutaneous leishmaniasis (CL), although doses are controversial. In a clinical trial for CL we investigated the occurrence of pancreatic toxicity with different schedules of treatment with meglumine antimoniate (MA). Seventy-two patients were allocated in two different therapeutic groups: 20 or 5 mg of pentavalent antimony (Sb5+)/kg/day for 20 or 30 days, respectively. Looking for adverse effects, patients were asked about abdominal pain, nausea, vomiting or anorexia in each medical visit. We performed physical examinations and collected blood to evaluate serum amylase and lipase in the pre-treatment period, and every 10 days during treatment and one month post-treatment. Hyperlipasemia occurred in 54.8% and hyperamylasemia in 19.4% patients. Patients treated with MA 20 mg Sb5+ presented a higher risk of hyperlipasemia (p = 0.023). Besides, higher MA doses were associated with a 2.05 higher risk ratio (p = 0.003) of developing more serious (moderate to severe) hyperlipasemia. The attributable fraction was 51% in this group. Thirty-six patients presented abdominal pain, nausea, vomiting or anorexia but only 47.2% of those had hyperlipasemia and/ or hyperamylasemia. These findings suggest the importance of the search for less toxic therapeutic regimens for the treatment of CL. PMID:27680173

  9. A study on low cost-high conducting fluorine and antimony-doped tin oxide thin films

    International Nuclear Information System (INIS)

    Thin films of undoped, fluorine- and antimony-doped tin oxide on glass at 400 deg. C was prepared by spray pyrolysis technique. Tin chloride (SnCl2), ammonium fluoride (NH4F), and antimony trichloride (SbCl3) were used as source for tin (Sn), fluorine (F), and antimony (Sb), respectively. To ensure the control of solution concentration on growth rate, fluorine-doped tin oxide (SnO2:F) thin films were first prepared with different amount of tin precursor, in the range of 5-12g, which has resulted in deposition of films with different thickness values. The optimum amount of tin precursor found from this study (11g) was fixed constant for preparing SnO2 films with different doping levels of F and Sb. From the X-ray diffraction analyses, it is understood that the preferred orientation of SnO2:F films is dependent on their thickness and the solution concentration. The variation in the solution concentration and orientation of the films was reflected in their morphology as examined by scanning electron microscopy (SEM) and atomic force microscopy (AFM). SEM studies showed that the variation in the solution concentration lead to different grain shapes for different orientations. The AFM study showed that the RMS roughness of undoped films reduced considerably from 86 to 24nm due to fluorine doping (15wt.%), whereas the antimony doping (2wt.%) has no significance effect on RMS roughness (93nm). The electrical properties of the films were examined by a Hall measurements setup in van der Pauw configuration. A minimum sheet resistance of 1.75 and 2.17Ω/ were obtained for F and Sb doped films, respectively. From the optical studies, it is found that the transmittance of undoped films increased from 42% to a maximum 85% on 30wt.% fluorine doping, whereas that has been decreased to a minimum of 12% on 4wt.% antimony doping (800nm). A discussion on the effect of type of dopants and their concentration on the structural, electrical and optical properties of the SnO2 film have

  10. Preparation of antimony sulfide semiconductor nanoparticles by pulsed laser ablation in liquid

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Ren-De, E-mail: [Research & Development Institute, High Performance Plastics Company, Sekisui Chemical Co., Ltd. 2-1 Hyakuyama, Shimamoto-Cho, Mishima-Gun, Osaka, 618-0021 (Japan); Tsuji, Takeshi [Interdisciplinary Graduate School of Science and Engineering, Shimane University, 1060 Nishikawatsu-Cho, Matsue, 690-8504 (Japan)


    Highlights: • Pulsed laser ablation in liquid (LAL) was applied to prepare antimony sulfide nanoparticles (Sb{sub 2}S{sub 3} NPs). • Sb{sub 2}S{sub 3} NPs with a stoichiometric composition were successfully prepared by LAL in water without using any surfactants or capping agents. • Thus-prepared Sb{sub 2}S{sub 3} NPs showed low-temperature crystallization and melting at a temperature low as 200 °C. • The NPs-coated Sb{sub 2}S{sub 3} thin film showed comparable semiconductor properties (carrier mobility and carrier density) to the vacuum deposited one. • Byproducts such as CS{sub 2}, CH{sub 4} and CO were detected by GC-MS analysis when LAL was performed in organic solvent. • The LAL-induced decomposition mechanism of Sb{sub 2}S{sub 3} and organic solvents was discussed based on the GC-MS results. - Abstract: In this paper, we report on the synthesis of antimony sulfide (Sb{sub 2}S{sub 3}) semiconductor nanoparticles by pulsed laser ablation in liquid without using any surfactants or capping agents. Different results were obtained in water and organic solvents. In the case of water, Sb{sub 2}S{sub 3} nanoparticles with chemical compositions of stoichiometry were successfully prepared when laser irradiation was performed under the condition with the dissolved oxygen removed by argon gas bubbling. It was shown that thus-obtained Sb{sub 2}S{sub 3} nanoparticles exhibit features of not only low-temperature crystallization but also low-temperature melting at a temperature as low as 200 °C. Nanoparticle-coated Sb{sub 2}S{sub 3} thin films were found to show good visible light absorption and satisfying semiconductor properties (i.e., carrier mobility and density), which are essential for photovoltaic application. On the other hand, in the case of organic solvents (e.g., acetone, ethanol), such unexpected byproducts as CS{sub 2}, CO and CH{sub 4} were detected from the reaction system by GC-MS analysis, which suggests that both Sb{sub 2}S{sub 3} and organic

  11. Infrared-to-red upconversion luminescence in samarium-doped antimony glasses

    Energy Technology Data Exchange (ETDEWEB)

    Som, Tirtha [Glass Technology Laboratory, Glass Division, Central Glass and Ceramic Research Institute, 196 Raja S.C. Mullick Road, Kolkata 700 032 (India); Karmakar, Basudeb [Glass Technology Laboratory, Glass Division, Central Glass and Ceramic Research Institute, 196 Raja S.C. Mullick Road, Kolkata 700 032 (India)], E-mail:


    A new antimony-based glass system (K{sub 2}O-B{sub 2}O{sub 3}-Sb{sub 2}O{sub 3}) having low phonon energy (about 600 cm{sup -1}) doped with Sm{sup 3+} ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-Visible-near infrared (UV-Vis-NIR) absorption and photoluminescence upconversion properties with the spectrochemistry of the 15K{sub 2}O-15B{sub 2}O{sub 3}-70Sb{sub 2}O{sub 3} (mol%) glasses have been studied doping with different concentrations (0.1-1.0 wt%) of Sm{sub 2}O{sub 3}. UV-Vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 949 nm at room temperature. Three upconverted bands originating from the {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 5/2}, {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 7/2} and {sup 4}G{sub 5/2}{yields}{sup 6}H{sub 9/2} transitions are found to be centered at 566 (green, weak), 602 (orange, weak) and 636 (red, remarkably strong) nm, respectively. These bands have been explained from the evaluation of the absorption, normal (downconversion) fluorescence and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level ({sup 4}G{sub 5/2}) by multiphonon deexcitation effect. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm{sup -1}, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm{sup -1})

  12. Inhibition of Leishmania donovani promastigote DNA topoisomerase I and human monocyte DNA topoisomerases I and II by antimonial drugs and classical antitopoisomerase agents. (United States)

    Walker, John; Saravia, Nancy G


    We have compared the inhibitor sensitivities of DNA topoisomerase I (TOPI) from Leishmania donovani promastigotes and TOPs I and II of human monocytes using pentavalent and trivalent antimonials (SbV, SbIII) and classical TOP inhibitors. Bis-benzimidazoles (Hoechst-33258 and -33342) were potent inhibitors of both parasite and human TOPI, but Hoechst-33342 was markedly less cytotoxic to promastigotes than to monocytes in vitro. Leishmania donovani was also considerably less sensitive than monocytes to camptothecin, both at enzyme and cellular levels. Sodium stibogluconate (SSG) was the only antimonial to inhibit TOPI, exhibiting a significant (P donovani enzyme but showed low cytotoxicities against intact promastigotes. The SbV meglumine antimoniate failed to inhibit TOPI and showed negligible cytotoxicities, whereas SbIII drugs were lethal to parasites and monocytes yet poor inhibitors of TOPI. Monocyte TOPII was inhibited by bis-benzimidazoles and insensitive to antimonials and camptothecin. The disparity between the high leishmanicidal activity and low anti-TOPI potency of SbIII indicates that in vivo targeting of L. donovani TOPI by the reductive pathway of antimonial activation is improbable. Nevertheless, the potent direct inhibition of TOPI by SSG and the differential interactions of camptothecin with L. donovani and human TOPI support the possibility of developing parasite-specific derivatives. PMID:15562618

  13. Chronic exposure to arsenic in drinking water can lead to resistance to antimonial drugs in a mouse model of visceral leishmaniasis (United States)

    Perry, Meghan R.; Wyllie, Susan; Raab, Andrea; Feldmann, Joerg; Fairlamb, Alan H.


    The Indian subcontinent is the only region where arsenic contamination of drinking water coexists with widespread resistance to antimonial drugs that are used to treat the parasitic disease visceral leishmaniasis. We have previously proposed that selection for parasite resistance within visceral leishmaniasis patients who have been exposed to trivalent arsenic results in cross-resistance to the related metalloid antimony, present in the pentavalent state as a complex in drugs such as sodium stibogluconate (Pentostam) and meglumine antimonate (Glucantime). To test this hypothesis, Leishmania donovani was serially passaged in mice exposed to arsenic in drinking water at environmentally relevant levels (10 or 100 ppm). Arsenic accumulation in organs and other tissues was proportional to the level of exposure and similar to that previously reported in human liver biopsies. After five monthly passages in mice exposed to arsenic, isolated parasites were found to be completely refractory to 500 μg⋅mL−1 Pentostam compared with the control passage group (38.5 μg⋅mL−1) cultured in vitro in mouse peritoneal macrophages. Reassessment of resistant parasites following further passage for 4 mo in mice without arsenic exposure showed that resistance was stable. Treatment of infected mice with Pentostam confirmed that resistance observed in vitro also occurred in vivo. We conclude that arsenic contamination may have played a significant role in the development of Leishmania antimonial resistance in Bihar because inadequate treatment with antimonial drugs is not exclusive to India, whereas widespread antimonial resistance is. PMID:24167266

  14. Chronic exposure to arsenic in drinking water can lead to resistance to antimonial drugs in a mouse model of visceral leishmaniasis. (United States)

    Perry, Meghan R; Wyllie, Susan; Raab, Andrea; Feldmann, Joerg; Fairlamb, Alan H


    The Indian subcontinent is the only region where arsenic contamination of drinking water coexists with widespread resistance to antimonial drugs that are used to treat the parasitic disease visceral leishmaniasis. We have previously proposed that selection for parasite resistance within visceral leishmaniasis patients who have been exposed to trivalent arsenic results in cross-resistance to the related metalloid antimony, present in the pentavalent state as a complex in drugs such as sodium stibogluconate (Pentostam) and meglumine antimonate (Glucantime). To test this hypothesis, Leishmania donovani was serially passaged in mice exposed to arsenic in drinking water at environmentally relevant levels (10 or 100 ppm). Arsenic accumulation in organs and other tissues was proportional to the level of exposure and similar to that previously reported in human liver biopsies. After five monthly passages in mice exposed to arsenic, isolated parasites were found to be completely refractory to 500 μg · mL(-1) Pentostam compared with the control passage group (38.5 μg · mL(-1)) cultured in vitro in mouse peritoneal macrophages. Reassessment of resistant parasites following further passage for 4 mo in mice without arsenic exposure showed that resistance was stable. Treatment of infected mice with Pentostam confirmed that resistance observed in vitro also occurred in vivo. We conclude that arsenic contamination may have played a significant role in the development of Leishmania antimonial resistance in Bihar because inadequate treatment with antimonial drugs is not exclusive to India, whereas widespread antimonial resistance is.

  15. Leaching of Antimony (Sb)from Municipal Solid Waste Incineration (MSWI) Residues

    Energy Technology Data Exchange (ETDEWEB)

    Herrmann, Inga


    The mobility of antimony (Sb) in municipal solid waste incineration (MSWI) residues often exceeds the limit values stipulated by the European Union. As an ash treatment by washing is conceivable, this work investigated the Sb release from Swedish bottom ash and fly ash when mixed with water. The leaching experiments revealed the factors significantly (a = 0.05) affecting Sb release from the ashes. The following factors were investigated: Liquid to solid ratio (L/S), time, pH, carbonation (treatment with CO{sub 2}), ultrasonics and temperature. The data were evaluated using multiple linear regression (MLR). The impact of the factors could be quantified. The maximum Sb release calculated was 13 mg/kg DM for bottom ash and 51 mg/kg DM for fly ash. The derived models explained the observed data well. Nevertheless, the calculated values were subject to a high uncertainty. For bottom ash, a lowering of the Sb total content of approximately 22% could be achieved. If this also involves a sufficient lowering of the Sb mobility to meet EU limit values could not yet be assessed. Chemical equilibrium calculations were performed to explain the empirical results. However, no solid phases controlling Sb release from the ashes could be identified.

  16. Synthesis of Copper-Antimony-Sulfide Nanocrystals for Solution-Processed Solar Cells. (United States)

    Suehiro, Satoshi; Horita, Keisuke; Yuasa, Masayoshi; Tanaka, Tooru; Fujita, Katsuhiko; Ishiwata, Yoichi; Shimanoe, Kengo; Kida, Tetsuya


    The p-type nanocrystals (NCs) of copper-based chalcogenides, such as CuInSe2 and Cu2ZnSnS4, have attracted increasing attention in photovoltaic applications due to their potential to produce cheap solution-processed solar cells. Herein, we report the synthesis of copper-antimony-sulfide (CAS) NCs with different crystal phases including CuSbS2, Cu3SbS4, and Cu12Sb4S13. In addition, their morphology, crystal phase, and optical properties were characterized using transmission electron microscopy, X-ray diffractometry, UV-vis-near-IR spectroscopy, and photoemission yield spectroscopy. The morphology, crystal phase, and electronic structure were significantly dependent on the chemical composition in the CAS system. Devices were fabricated using particulate films consisting of CAS NCs prepared by spin coating without a high-temperature treatment. The CAS NC-based devices exhibited a diode-like current-voltage characteristic when coupled with an n-type CdS layer. In particular, the CuSbS2 NC devices exhibited photovoltaic responses under simulated sunlight, demonstrating its applicability for use in solution-processed solar cells. PMID:26237216

  17. Direct Band Gap Gallium Antimony Phosphide (GaSbxP(1-x)) Alloys. (United States)

    Russell, H B; Andriotis, A N; Menon, M; Jasinski, J B; Martinez-Garcia, A; Sunkara, M K


    Here, we report direct band gap transition for Gallium Phosphide (GaP) when alloyed with just 1-2 at% antimony (Sb) utilizing both density functional theory based computations and experiments. First principles density functional theory calculations of GaSbxP(1-x) alloys in a 216 atom supercell configuration indicate that an indirect to direct band gap transition occurs at x = 0.0092 or higher Sb incorporation into GaSbxP(1-x). Furthermore, these calculations indicate band edge straddling of the hydrogen evolution and oxygen evolution reactions for compositions ranging from x = 0.0092 Sb up to at least x = 0.065 Sb making it a candidate for use in a Schottky type photoelectrochemical water splitting device. GaSbxP(1-x) nanowires were synthesized by reactive transport utilizing a microwave plasma discharge with average compositions ranging from x = 0.06 to x = 0.12 Sb and direct band gaps between 2.21 eV and 1.33 eV. Photoelectrochemical experiments show that the material is photoactive with p-type conductivity. This study brings attention to a relatively uninvestigated, tunable band gap semiconductor system with tremendous potential in many fields. PMID:26860470

  18. Direct Band Gap Gallium Antimony Phosphide (GaSbxP1-x) Alloys (United States)

    Russell, H. B.; Andriotis, A. N.; Menon, M.; Jasinski, J. B.; Martinez-Garcia, A.; Sunkara, M. K.


    Here, we report direct band gap transition for Gallium Phosphide (GaP) when alloyed with just 1-2 at% antimony (Sb) utilizing both density functional theory based computations and experiments. First principles density functional theory calculations of GaSbxP1-x alloys in a 216 atom supercell configuration indicate that an indirect to direct band gap transition occurs at x = 0.0092 or higher Sb incorporation into GaSbxP1-x. Furthermore, these calculations indicate band edge straddling of the hydrogen evolution and oxygen evolution reactions for compositions ranging from x = 0.0092 Sb up to at least x = 0.065 Sb making it a candidate for use in a Schottky type photoelectrochemical water splitting device. GaSbxP1-x nanowires were synthesized by reactive transport utilizing a microwave plasma discharge with average compositions ranging from x = 0.06 to x = 0.12 Sb and direct band gaps between 2.21 eV and 1.33 eV. Photoelectrochemical experiments show that the material is photoactive with p-type conductivity. This study brings attention to a relatively uninvestigated, tunable band gap semiconductor system with tremendous potential in many fields.

  19. Adsorption behavior of antimony(III) oxyanions on magnetite surface in aqueous organic acid environment (United States)

    Mittal, Vinit K.; Bera, Santanu; Narasimhan, S. V.; Velmurugan, S.


    Antimony(III) adsorption is observed on magnetite (Fe3O4) surface under acidic and reducing condition through surface hydroxyl (SOH) groups bonding on Fe3O4 surface. Desorption of adsorbed Sb(III) is observed from Fe3O4 surface along with iron release in organic acid at 85 °C after 5 h of experiment. Tartaric acid (TA) shows minimum Sb(III) adsorption on Fe3O4 among the organic acid studied. The reason is TA having two sets of adjacent functional groups viz. Odbnd Csbnd OH and Csbnd OH which are responsible for the formation of five-membered bidendate chelate with Sb(III). Other oxyanions, cations or complexing agents along with TA influences the Sb(III) adsorption on Fe3O4. The surface of magnetite is modified by the addition of fatty acids viz. Lauric acid, benzoic acid to bind the Ssbnd OH groups present on the surface. This results in delaying the process of adsorption without changing the quantity of saturation adsorption of Sb(III) on Fe3O4 surface.

  20. Large anharmonic effect and thermal expansion anisotropy of metal chalcogenides: The case of antimony sulfide (United States)

    Gan, Chee Kwan; Soh, Jian Rui; Liu, Yun


    We derive a compact matrix expression for the linear thermal expansion coefficients (TECs) for a general orthorhombic system which relates elastic properties and integrated quantities based on deformation and mode dependent Grüneisen parameters and mode dependent heat capacities. The density of Grüneisen parameters Γ (ν ) as a function of frequency ν , weighted by the number of phonon modes, is introduced and found to be illuminating in interpreting the TEC results. Using density functional perturbation theory and Grüneisen formalism for thermal expansion, we illustrate the general usefulness of this method by calculating the linear and volumetric TECs of a low-symmetry orthorhombic compound antimony sulfide (Sb2S3 ), which belongs to a large class of technologically and fundamentally important materials. Even though negative Grüneisen parameters are found for deformations in all three crystal directions, the Γ (ν ) data rule out the occurrences of negative TECs at all temperatures. Sb2S3 exhibits a large thermal expansion anisotropy where the TEC in the b direction can reach as high as 13 ×10-6 K-1 at high temperatures, about two and seven times larger than the TECs in the c and a direction, respectively. Our work suggests a general and practical first-principles approach to calculate the thermal properties of other complicated low-symmetry systems.

  1. Controlled n-doping in chemical vapour deposition grown graphene by antimony

    International Nuclear Information System (INIS)

    We have studied the effects of antimony (Sb) doping on graphene grown by chemical vapour deposition without any significant change in its electrical properties. By increasing the metal thickness from 1 to 5 nm, we found a shift in the wave numbers of Raman G and two-dimensional (2D) peaks consistent with n-doping and a change in the Fermi level of the graphene into the conduction band. The relative intensity of the D peak to the G peak did not show a significant change and that of the 2D peak to the G peak remained at a large enough number as a function of metal thickness, implying little degradation by the metal dopants. Transport measurements also confirm the n-doping of graphene through a shift of Dirac point in the transfer characteristics and the quality preservation with little changes in mobility. We also report on the formation of a p–n junction by metal doping on selected areas of the graphene and their electrical properties with transfer characteristics and Hall measurements. (paper)

  2. Evaluation of atmospheric inputs as possible sources of antimony in pregnant women from urban areas. (United States)

    Fort, Marta; Grimalt, Joan O; Querol, Xavier; Casas, Maribel; Sunyer, Jordi


    Antimony and copper are common components of brake linings. The occurrence of these two metals in urban atmospheric aerosols has been related to vehicular use. Urine samples (n=466) taken during the 32nd week of pregnancy were analyzed for Sb and Cu in pregnant women from an urban area (Sabadell, Catalonia, Spain). The geometric mean levels were 0.28 and 13 μg/g creatinine, respectively. Positive significant associations between urine concentrations of Sb and seasonality, intensity of physical exercise, working activities and traffic intensity at their home streets were observed. Cu showed the same trends but without statistical significance. In both cases, the estimated dietary ingestion of these two metals was larger than the inhalation inputs but the difference was much higher for Cu than for Sb. While Sb has no dietary role, Cu is an essential element which is also incorporated into humans through diet. The results suggest that inhalation of atmospheric particles may also constitute a source of Sb in pregnant women and general population of urban areas. PMID:26657384

  3. Partitioning geochemistry of arsenic and antimony, El Tatio Geyser Field, Chile

    Energy Technology Data Exchange (ETDEWEB)

    Landrum, J.T. [Department of Geological Sciences, The University of Texas, Austin, TX 78759 (United States); Bennett, P.C., E-mail: [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States); Engel, A.S. [Department of Geology and Geophysics, Louisiana State University, Baton Rouge, LA 70803 (United States); Alsina, M.A.; Pasten, P.A. [Departamento de Ingenieria Hidraulica y Ambiental, Pontificia Universidad Catolica de Chile, Santiago (Chile); Milliken, K. [Department of Geological Sciences, University of Texas, Austin, TX 78759 (United States)


    The abundance of As and Sb in aqueous, mineral and biological reservoirs was examined at El Tatio Geyser Field, a unique hydrothermal basin located in the Atacama Desert region of Chile. Here the concentration of total As and Sb in hydrothermal springs and discharge streams are the highest reported for a natural surface water, and the geyser basin represents a significant source of toxic elements for downstream users across Region II, Chile. The geyser waters are near neutral Na:Cl type with {approx}0.45 and 0.021 mmol L{sup -1} total As and Sb, respectively, primarily in the reduced (III) redox state at the discharge with progressive oxidation downstream. The ferric oxyhydroxides associated with the microbial mats and some mineral precipitates accumulate substantial As that was identified as arsenate by XAS analysis (>10 wt% in the mats). This As is easily mobilized by anion exchange or mild dissolution of the HFO, and the ubiquitous microbial mats represent a significant reservoir of As in this system. Antimony, in contrast, is not associated with the mineral ferric oxides or the biomats, but is substantially enriched in the silica matrix of the geyserite precipitates, up to 2 wt% as Sb{sub 2}O{sub 3}. Understanding the mobility and partitioning behavior of these metalloids is critical for understanding their eventual impact on regional water management.

  4. Spark Plasma Sintering and Densification Mechanisms of Antimony-Doped Tin Oxide Nanoceramics

    Directory of Open Access Journals (Sweden)

    Junyan Wu


    Full Text Available Densification of antimony-doped tin oxide (ATO ceramics without sintering aids is very difficult, due to the volatilization of SnO2, formation of deleterious phases above 1000°C, and poor sintering ability of ATO particles. In this paper, monodispersed ATO nanoparticles were synthesized via sol-gel method, and then ATO nanoceramics with high density were prepared by spark plasma sintering (SPS technology using the as-synthesized ATO nanoparticles without the addition of sintering aids. The effect of Sb doping content on the densification was investigated, and the densification mechanisms were explored. The results suggest that ATO nanoparticles derived from sol-gel method show good crystallinity with a crystal size of 5–20 nm and Sb is incorporated into the SnO2 crystal structure. When the SPS sintering temperature is 1000°C and the Sb doping content is 5 at.%, the density of ATO nanoceramics reaches a maximum value of 99.2%. Densification mechanisms are explored in detail.

  5. A new method for antimony speciation in plant biomass and nutrient media using anion exchange cartridge. (United States)

    Tisarum, Rujira; Ren, Jing-Hua; Dong, Xiaoling; Chen, Hao; Lessl, Jason T; Ma, Lena Q


    A selective separation method based on anion exchange cartridge was developed to determine antimony (Sb) speciation in biological matrices by graphite furnace atomic absorption spectrophotometry (GFAAS). The selectivity of the cartridge towards antimonite [Sb(III)] and antimonate [Sb(V)] reversed in the presence of deionized (DI) water and 2mM citric acid. While Sb(V) was retained by the cartridge in DI water, Sb(III) was retained in citric acid media. At pH 6, Sb(III) and Sb(V) formed Sb(III)- and Sb(V)-citrate complexes, but the cartridge had higher affinity towards the Sb(III)-citrate complex. Separation of Sb(III) was tested at various concentrations in fresh and spent growth media and plant tissues. Our results showed that cartridge-based Sb speciation was successful in plant tissues, which was confirmed by HPLC-ICP-MS. The cartridge retained Sb(III) and showed 92-104% Sb(V) recovery from arsenic hyperaccumulator Pteris vittata roots treated with Sb(III) and Sb(V). The cartridge procedure is an effective alternative for Sb speciation, offering low cost, reproducible results, and simple Sb analysis using GFAAS.

  6. Antimony release from contaminated mine soils and its migration in four typical soils using lysimeter experiments. (United States)

    Shangguan, Yu-Xian; Zhao, Long; Qin, Yusheng; Hou, Hong; Zhang, Naiming


    Antimony (Sb) can pose great risks to the environment in mining and smelting areas. The migration of Sb in contaminated mine soil was studied using lysimeter experiments. The exchangeable concentration of soil Sb decreased with artificial leaching. The concentrations of Sb retained in the subsoil layers (5-25cm deep) were the highest for Isohumosol and Ferrosol and the lowest for Sandy soil. The Sb concentrations in soil solutions decreased with soil depth, and were adequately simulated using a logarithmic function. The Sb migration pattern in Sandy soil was markedly different from the patterns in the other soils which suggested that Sb may be transported in soil colloids. Environmental factors such as water content, soil temperature, and oxidation-reduction potential of the soil had different effects on Sb migration in Sandy soil and Primosol. The high Fe and Mn contents in Ferrosol and Isohumosol significantly decreased the mobility of Sb in these soils. The Na and Sb concentrations in soils used in the experiments positively correlated with each other (Psoil solutions, the Sb chemical fraction patterns, and the Sb/Na ratios decreased in the order Sandy soil>Primosol>Isohumosol>Ferrosol, and we concluded that the Sb mobility in the soils also decreased in that order. PMID:27395817

  7. Synthesis of Copper-Antimony-Sulfide Nanocrystals for Solution-Processed Solar Cells. (United States)

    Suehiro, Satoshi; Horita, Keisuke; Yuasa, Masayoshi; Tanaka, Tooru; Fujita, Katsuhiko; Ishiwata, Yoichi; Shimanoe, Kengo; Kida, Tetsuya


    The p-type nanocrystals (NCs) of copper-based chalcogenides, such as CuInSe2 and Cu2ZnSnS4, have attracted increasing attention in photovoltaic applications due to their potential to produce cheap solution-processed solar cells. Herein, we report the synthesis of copper-antimony-sulfide (CAS) NCs with different crystal phases including CuSbS2, Cu3SbS4, and Cu12Sb4S13. In addition, their morphology, crystal phase, and optical properties were characterized using transmission electron microscopy, X-ray diffractometry, UV-vis-near-IR spectroscopy, and photoemission yield spectroscopy. The morphology, crystal phase, and electronic structure were significantly dependent on the chemical composition in the CAS system. Devices were fabricated using particulate films consisting of CAS NCs prepared by spin coating without a high-temperature treatment. The CAS NC-based devices exhibited a diode-like current-voltage characteristic when coupled with an n-type CdS layer. In particular, the CuSbS2 NC devices exhibited photovoltaic responses under simulated sunlight, demonstrating its applicability for use in solution-processed solar cells.

  8. Semiconductor nanocrystals functionalized with antimony telluride zintl ions for nanostructured thermoelectrics. (United States)

    Kovalenko, Maksym V; Spokoyny, Boris; Lee, Jong-Soo; Scheele, Marcus; Weber, Andrew; Perera, Susanthri; Landry, Daniel; Talapin, Dmitri V


    The energy efficiency of heat engines could be improved by the partial recovery of waste heat using thermoelectric (TE) generators. We show the possibility of designing nanostructured TE materials using colloidal inorganic nanocrystals functionalized with molecular antimony telluride complexes belonging to the family of Zintl ions. The unique advantage of using Zintl ions as the nanocrystal surface ligands is the possibility to convert them into crystalline metal chalcogenides, thus linking individual nanobuilding blocks into a macroscopic assembly of electronically coupled functional modules. This approach allows preserving the benefits of nanostructuring and quantum confinement while enabling facile charge transport through the interparticle boundaries. A developed methodology was applied for solution-based fabrication of nanostructured n- and p-type Bi(2-x)Sb(x)Te(3) alloys with tunable composition and PbTe-Sb(2)Te(3) nanocomposites with controlled grain size. Characterization of the TE properties of these materials showed that their Seebeck coefficients, electrical and thermal conductivities, and ZT values compared favorably with those of previously reported solution-processed TE materials.

  9. Assessment and distribution of antimony in soils around three coal mines, Anhui, China (United States)

    Qi, C.; Liu, Gaisheng; Kang, Y.; Lam, P.K.S.; Chou, C.


    Thirty-three soil samples were collected from the Luling, Liuer, and Zhangji coal mines in the Huaibei and Huainan areas of Anhui Province, China. The samples were analyzed for antimony (Sb) by inductively coupled plasmaoptical emission spectrometry (ICP-OES) method. The average Sb content in the 33 samples was 4 mg kg-1, which is lower than in coals from this region (6.2 mg kg-1). More than 75% of the soils sampled showed a significant degree of Sb pollution (enrichment factors [EFs] 5-20). The soils collected near the gob pile and coal preparation plant were higher in Sb content than those collected from residential areas near the mines. The gob pile and tailings from the preparation plant were high in mineral matter content and high in Sb. They are the sources of Sb pollution in surface soils in the vicinity of coal mines. The spatial dispersion of Sb in surface soil in the mine region shows that Sb pollution could reach out as far as 350 m into the local environment conditions. Crops in rice paddies may adsorb some Sb and reduce the Sb content in soils from paddyfields. Vertical distribution of Sb in two soil profiles indicates that Sb is normally relatively immobile in soils. ?? 2011 Air & Waste Management Association.

  10. DFT Study on the Carrier Concentration and Temperature-Dependent Thermoelectric Properties of Antimony Selenide

    Directory of Open Access Journals (Sweden)

    Aditya Jayaraman


    Full Text Available We present the thermoelectric properties of Antimony Selenide (Sb2Se3 obtained using first principles calculations. We investigated the electronic band structure using the FP-LAPW method within the sphere of the density functional theory. Thermoelectric properties were calculated using BoltzTrap code using the constant relaxation time (τ approximation at three different temperatures 300 K, 600 K, and 800 K. Seebeck coefficient (S was found to decrease with increasing temperature, electrical conductivity (σ/τ was almost constant in the entire temperature range, and electronic thermal conductivity (κ/τ increased with increasing temperature. With increase in temperature S decreased from 1870 μV/K (at 300 K to 719 μV/K (at 800 K, electronic thermal conductivity increased from 1.56 × 1015 W/m K s (at 300 K to 3.92 × 1015 W/m K s (at 800 K, and electrical conductivity decreased from 22 × 1019/Ω m s (at 300 K to 20 × 1019/Ω m s (at 800 K. The thermoelectric properties were also calculated for different hole concentrations and the optimum concentration for a good thermoelectric performance over a large range of temperatures (from 300 K to 1000 K was found for hole concentration around 1019 cm−3.

  11. Comparison of arsenic and antimony biogeochemical behavior in water, soil and tailings from Xikuangshan, China. (United States)

    Fu, Zhiyou; Wu, Fengchang; Mo, Changli; Deng, Qiujing; Meng, Wei; Giesy, John P


    Although similar geochemical behaviors of arsenic (As) and antimony (Sb) in the environment has been assumed and widely reported, growing evidence suggests the two elements cannot, under some conditions, be assumed to behave similarly. In this four-year study (samples collected in each year), comparative investigation of the biogeochemistry of As and Sb in water/fish, soil/vegetable, tailings/plant samples were carried out at the world's largest active Sb mine area (Xikuangshan, China). Depending on duration the tailings had been stacked, significant differences in spatial distributions between As and Sb were found, and these were associated with change in pH over time. Bio-accumulation factors (BAFs) of As were approximately 10-fold greater than those of Sb in fish/water, plant/tailing, and vegetable/soil systems. Sb had higher BAF in non-fatty tissues such as gills of fishes and shells of crabs. BAFs of Sb in vegetable/soil exhibited insignificantly, but different from As, positive correlation with pH in soil. PMID:26356182

  12. Validation of methodology and uncertainty assessment of antimony determination in environmental materials using Neutron Activation Analysis

    International Nuclear Information System (INIS)

    Antimony is an element found in low concentrations in the environment. However, its determination has attracted great interest because of the knowledge of its toxicity and increasing application. Neutron activation analysis (NAA) is a suitable method for the determination of several elements in different types, but in case of Sb, the analysis presents some difficulties due to spectral interferences. The objective of this research was to validate the method of NAA and uncertainty assessment for Sb determination in environmental samples. The experimental procedure consisted of irradiating twelve certified reference samples of different kind of matrices. The samples were irradiated in the nuclear research reactor IEA R1 IPEN/CNEN/SP followed by measurement of induced radioactivity, using a hyperpure germanium detector coupled to a gamma ray spectrometry. The radioisotopes 122Sb and 124Sb were measured and the Sb concentrations with their respective uncertainties were obtained by the comparative method. Relative errors and values of Z scores were calculated to evaluate the accuracy of the results for Sb determination in certified reference materials. The evaluation of the components that contribute to uncertainty measurement of the Sb concentration, showed that the major uncertainty contribution is due to statistical counting. The results also indicated that the uncertainty value of the combined standard uncertainty depends on the radioisotope measured and the decay time used for counting. (author)

  13. Antimony-Doped Tin Oxide Thin Films Grown by Home Made Spray Pyrolysis Technique (United States)

    Yusuf, Gbadebo; Babatola, Babatunde Keji; Ishola, Abdulahi Dimeji; Awodugba, Ayodeji O.; Solar cell Collaboration


    Transparent conducting antimony-doped tin oxide (ATO) films have been deposited on glass substrates by home made spray pyrolysis technique. The structural, electrical and optical properties of the ATO films have been investigated as a function of Sb-doping level and annealing temperature. The optimum target composition for high conductivity and low resistivity was found to be 20 wt. % SnSb2 + 90 wt. ATO. Under optimized deposition conditions of 450oC annealing temperature, electrical resistivity of 5.2×10-4 Ω -cm, sheet resistance of 16.4 Ω/sq, average optical transmittance of 86% in the visible range, and average optical band-gap of 3.34eV were obtained. The film deposited at lower annealing temperature shows a relatively rough, loosely bound slightly porous surface morphology while the film deposited at higher annealing temperature shows uniformly distributed grains of greater size. Keywords: Annealing, Doping, Homemade spray pyrolysis, Tin oxide, Resistivity

  14. A density-functional study on the electronic and vibrational properties of layered antimony telluride (United States)

    Stoffel, Ralf P.; Deringer, Volker L.; Simon, Ronnie E.; Hermann, Raphaël P.; Dronskowski, Richard


    We present a comprehensive survey of electronic and lattice-dynamical properties of crystalline antimony telluride (Sb2Te3). In a first step, the electronic structure and chemical bonding have been investigated, followed by calculations of the atomic force constants, phonon dispersion relationships and densities of states. Then, (macroscopic) physical properties of Sb2Te3 have been computed, namely, the atomic thermal displacement parameters, the Grüneisen parameter γ, the volume expansion of the lattice, and finally the bulk modulus B. We compare theoretical results from three popular and economic density-functional theory (DFT) approaches: the local density approximation (LDA), the generalized gradient approximation (GGA), and a posteriori dispersion corrections to the latter. Despite its simplicity, the LDA shows excellent performance for all properties investigated—including the Grüneisen parameter, which only the LDA is able to recover with confidence. In the absence of computationally more demanding hybrid DFT methods, the LDA seems to be a good choice for further lattice dynamical studies of Sb2Te3 and related layered telluride materials.

  15. Gold and Antimony Mixed Flotation on a Micrite Gold Antimony ore in Guizhou%贵州某泥晶灰岩型含锑金矿金锑混浮试验

    Institute of Scientific and Technical Information of China (English)

    石贵明; 周意超


    贵州某泥晶灰岩型含锑金矿石为块状构造,金属矿物主要为黄铁矿、针铁矿,含量小于1%,非金属矿物以方解石为主,另有少量石英、有机质等;金含量为6.04 g/t,显微镜下未见自然金粒,74.34%的金赋存在硫化矿中,游离金仅占总金的7.14%;硅酸盐、碳酸盐包裹金分别占11.96%和6.56%;锑主要以辉锑矿的形式存在。为高效、低成本回收矿石中的金、锑,对混合浮选工艺进行了试验研究。结果表明,在一段磨矿细度为-0.074 mm占71%的情况下1粗2扫混浮、尾矿再磨细度为-0.074 mm占92.7%的情况下再1粗2扫混浮、两粗精矿合并后3次精选、中矿顺序返回流程处理,最终获得了金品位为47.60 g/t、锑品位为9.81%、金回收率为76.68%、锑回收率为85.22%的金锑混合精矿,金锑混浮效果较理想。尾矿中金的回收及金锑分离工艺研究将另文介绍。%The micrite type antimony-containing gold ore in Guizhou is in blocky construction. Its metallic minerals are mainly pyrite and goethite,with content of less than 1%. Non-metallic minerals are calcite,and few of quartz,organic matter, etc. It contains gold of 6. 04 g/t,and natural gold grains were not seen in microscope,74. 34% of the gold occurred in sulfide ore,free gold accounted for only 7. 14%,wrapped gold in silicate and carbonate accounted for 11. 96% and 6. 56% respective-ly. Antimony mainly existed in the form of stibnite. Bulk flotation process was studied to make high efficient recovery of gold and antimony at low costs. The results indicated that,at the grinding fineness of 71% passing 0. 074 mm,through one roughing and two scavenging bulk flotation,one roughing and two scavenging bulk flotation after regrinding the tailings to 92. 7% passing 0. 074 mm,three cleaning flotation for the two mixed rough concentrate,and then middles back to the flow-sheet in turn,rough gold-antimony concentrate with gold grade of 47. 60 g

  16. Nitrogen Monitoring of West Hackberry 117 Cavern Wells.

    Energy Technology Data Exchange (ETDEWEB)

    Bettin, Giorgia; Lord, David


    U.S. Strategic Petroleum Reserve (SPR) oil storage cavern West Hackberry 117 was tested under extended nitrogen monitoring following a successful mechanical integrity test in order to validate a newly developed hydrostatic column model to be used to differentiate between normal "tight" well behavior and small-leak behavior under nitrogen. High resolution wireline pressure and temperature data were collected during the test period and used in conjunction with the hydrostatic column model to predict the nitrogen/oil interface and the pressure along the entire fluid column from the bradenhead flange nominally at ground surface to bottom of brine pool. Results here and for other SPR caverns have shown that wells under long term nitrogen monitoring do not necessarily pressurize with a relative rate (P N2 /P brine) of 1. The theoretical relative pressure rate depends on the well configuration, pressure and the location of the nitrogen-oil interface and varies from well to well. For the case of WH117 the predicted rates were 0.73 for well A and 0.92 for well B. The measured relative pressurization rate for well B was consistent with the model prediction, while well A rate was found to be between 0.58-0.68. A number of possible reasons for the discrepancy between the model and measured rates of well A are possible. These include modeling inaccuracy, measurement inaccuracy or the possibility of the presence of a very small leak (below the latest calculated minimum detectable leak rate).

  17. Quantitative HPLC-ICP-MS analysis of antimony redox speciation in complex sample matrices: new insights into the Sb-chemistry causing poor chromatographic recoveries

    DEFF Research Database (Denmark)

    Hansen, Claus; Schmidt, Bjørn; Larsen, Erik Huusfeldt;


    In solution antimony exists either in the pentavalent or trivalent oxidation state. As Sb(III) is more toxic than Sb(V), it is important to be able to perform a quantitative speciation analysis of Sb’s oxidation state. The most commonly applied chromatographic methods used for this redox speciation...... analysis do, however, often show a low chromatographic Sb recovery when samples of environmental or biological origin are analysed. In this study we explored basal chemistry of antimony and found that formation of macromolecules, presumably oligomeric and polymeric Sb(V) species, is the primary cause...... of low chromatographic recoveries. A combination of HPLC-ICP-MS, AFFF-ICP-MS and spinfiltration was applied for analysis of model compounds and biological samples. Quantitative chromatographic Sb redox speciation analysis was possible by acidic hydrolysis of the antimony polymers prior to analysis...

  18. 9 CFR 113.117 - Pasteurella Multocida Bacterin, Avian Isolate, Type 1. (United States)



  19. Minerogenetic Mechanism of the Songxi Silver—Antimony Deposit of Northeastern Guangdong—Ore—Controlling Role of Organic Matter

    Institute of Scientific and Technical Information of China (English)

    胡凯; 肖振宇; 等


    Organic geochemistry and comparisons of characteristics of the organic matter in wall rocks of the ore-controlling strata and ores of the Lower Jurassic Songling black shale formation and the related Songxi silver-antimony deposit of northeastern Guangdong have been studied in this paper.The results show that the Lower Jurassic Songling shale formation is a suite of biologic-rich and organic-rich ore-bearing marine sedimentary rocks.Micro-components of the organic matter in the Songling black shale formation consists primarily of algae,amorphous marine kerogen,solid bitument,and pyrobitument.The thermal evolution of organic matter is at the over-maturity stage.There is a general positive correlation between total organic carbon(CO)and metallogenetic elements such as Ag and Sb in the black shale formation.Organic matter in the host rocks in the Songxi ore deposit played a role in controlling the silver-antimony depositing environment during the forming process of the black shale ore-bearing formation.In the absence of vitrinite,the relative level of thermal maturity calculated by solid bitument reflectance indicates that the ore-forming temperatute of the Songxi silver-antimony deposit was about 150-170℃,which was considered as an epithermally reworked ore deposit.The roles of organic matter in the formation of the Sonxi ore deposit are a primitive accumulation of the metallogenetic elements(Ag,Sb) in the sea-water cycle system for ore source and a concentration of metals by ion exchange of chelation as well as reductionn of the oxidzed metals.

  20. Clinical and Parasitological Features of Patients with American Cutaneous Leishmaniasis that Did Not Respond to Treatment with Meglumine Antimoniate (United States)

    Robayo, Marta L.; Lopez, Myriam C.; Daza, Carlos D.; Bedoya, Angela; Mariño, Maria L.; Saavedra, Carlos H.


    Background American cutaneous leishmaniasis (ACL) is a complicated disease producing about 67.000 new cases per year. The severity of the disease depends on the parasite species; however in the vast majority of cases species confirmation is not feasible. WHO suggestion for ACL produced by Leishmania braziliensis, as first line treatment, are pentavalent antimonial derivatives (Glucantime or Sodium Stibogluconate) under systemic administration. According to different authors, pentavalent antimonial derivatives as treatment for ACL show a healing rate of about 75% and reasons for treatment failure are not well known. Methods In order to characterise the clinical and parasitological features of patients with ACL that did not respond to Glucantime, a cross-sectional observational study was carried out in a cohort of 43 patients recruited in three of the Colombian Army National reference centers for complicated ACL. Clinical and paraclinical examination, and epidemiological and geographic information were recorded for each patient. Parasitological, histopathological and PCR infection confirmation were performed. Glucantime IC50 and in vitro infectivity for the isolated parasites were estimated. Results Predominant infecting Leishmania species corresponds to L. braziliensis (95.4%) and 35% of the parasites isolated showed a significant decrease in in vitro Glucanatime susceptibility associated with previous administration of the medicament. Lesion size and in vitro infectivity of the parasite are negatively correlated with decline in Glucantime susceptibility (Spearman: r = (-)0,548 and r = (-)0,726; respectively). Conclusion A negative correlation between lesion size and parasite resistance is documented. L. braziliensis was found as the main parasite species associated to lesion of patients that underwent treatment failure or relapse. The indication of a second round of treatment in therapeutic failure of ACL, produced by L. braziliensis, with pentavalent antimonial

  1. Cobalt doped antimony oxide nano-particles based chemical sensor and photo-catalyst for environmental pollutants

    Energy Technology Data Exchange (ETDEWEB)

    Jamal, Aslam [Centre for Advanced Materials and Nano-Engineering (CAMNE) and Department of Chemistry, Faculty of Sciences and Arts, Najran University, P. O. Box 1988, Najran 11001 (Saudi Arabia); Rahman, Mohammed M. [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Khan, Sher Bahadar, E-mail: [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Faisal, Mohd. [Centre for Advanced Materials and Nano-Engineering (CAMNE) and Department of Chemistry, Faculty of Sciences and Arts, Najran University, P. O. Box 1988, Najran 11001 (Saudi Arabia); Akhtar, Kalsoom [Division of Nano Sciences and Department of Chemistry, Ewha Womans University, Seoul 120-750 (Korea, Republic of); Rub, Malik Abdul; Asiri, Abdullah M.; Al-Youbi, Abdulrahman O. [Center of Excellence for Advanced Materials Research (CEAMR), King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia); Chemistry Department, Faculty of Science, King Abdulaziz University, P.O. Box 80203, Jeddah 21589 (Saudi Arabia)


    Graphical abstract: A dichloromethane chemical sensor using cobalt antimony oxides has been fabricated. This sensor showed high sensitivity and will be a useful candidate for environmental and health monitoring. Also it showed high photo-catalytic activity and can be a good candidate as a photo-catalyst for organic hazardous materials. Highlights: Black-Right-Pointing-Pointer Reusable chemical sensor. Black-Right-Pointing-Pointer Green environmental and eco-friendly chemi-sensor. Black-Right-Pointing-Pointer High sensitivity. Black-Right-Pointing-Pointer Good candidate for environmental and health monitoring. - Abstract: Cobalt doped antimony oxide nano-particles (NPs) have been synthesized by hydrothermal process and structurally characterized by utilizing X-ray diffraction (XRD), field emission scanning electron microscopy (FE-SEM) and Fourier transforms infrared spectrophotometer (FT-IR) which revealed that the synthesized cobalt antimony oxides (CoSb{sub 2}O{sub 6}) are well crystalline nano-particles with an average particles size of 26 {+-} 10 nm. UV-visible absorption spectra ({approx}286 nm) were used to investigate the optical properties of CoSb{sub 2}O{sub 6}. The chemical sensing of CoSb{sub 2}O{sub 6} NPs have been primarily investigated by I-V technique, where dichloromethane is used as a model compound. The analytical performance of dichloromethane chemical sensor exhibits high sensitivity (1.2432 {mu}A cm{sup -2} mM{sup -1}) and a large linear dynamic range (1.0 {mu}M-0.01 M) in short response time (10 s). The photo catalytic activity of the synthesized CoSb{sub 2}O{sub 6} nano-particles was evaluated by degradation of acridine orange (AO), which degraded 58.37% in 200 min. These results indicate that CoSb{sub 2}O{sub 6} nano-particles can play an excellent research impact in the environmental field.

  2. Comparative Efficacies of Two Antimony Regimens To Treat Leishmania braziliensis-Induced Cutaneous Leishmaniasis in Rhesus Macaques (Macaca mulatta)▿ (United States)

    Grimaldi, G.; Porrozzi, R.; Friedrich, K.; Teva, A.; Marchevsky, R. S.; Vieira, F.; Miekeley, N.; Paumgartten, F. J. R.


    This study compared the efficacies of two N-methylglucomine antimoniate (MA) dose regimens for treating macaques with Leishmania braziliensis-induced chronic skin disease. Whereas all animals treated with the full dose (20 mg MA/kg/day) were cured, 50% of the monkeys receiving a low-dose regimen (5 mg MA/kg/day) relapsed. The antimony concentrations in macaque plasma and tissue samples were greater in the full-dose group than in that receiving a subtherapeutic MA regimen. Our data also suggest the presence of drug-induced hepatic pathology. PMID:19822700

  3. Influence of antimony on the mechanical properties and gas content of alloy AlSi6Cu4


    D. Medlen; D. Bolibruchova


    Aluminium alloys based on Al-Si are used in automotive and aerospace industries. AlSi6Cu4 alloy is used the complicated castings, whichmust comply high strength requirements. Strength characteristics can also be affected by the modifiers: Na, Sr, Sb. In the li terature ismentioned, that AlSi6Cu4 modified by sodium and strontium has negative effect - increases of the gas absorption. Modification of AlSi6Cu4 alloy by antimony, is still not mentioned in the literature. The article gives the effe...

  4. The influence of remelting on the properties of AlSi6Cu4 alloy modified by antimony

    Directory of Open Access Journals (Sweden)

    D. Medlen


    Full Text Available The paper deals with the problem of multiple remelting influence on AlSi6Cu4 alloy modified by antimony on chosen mechanical characteristics, microstructure and gas content. This foundry alloy is used mostly in automotive industry. Foundry Aluminum-Silicon alloys are also used in number of industrial weight sensitive applications because of their low weight and very good castability and good mechanical properties. Modifiers are usually added to molten aluminum-silicon alloys to refine the eutectic phase particle shape and improve the mechanical properties of the final cast products and Al-Si alloys cast properties.

  5. Flow analysis-hydride generation-gas phase derivative molecular absorption spectrophotometric determination of antimony in antileishmanial drugs

    Directory of Open Access Journals (Sweden)

    Máximo Gallignani


    Full Text Available In the present work, the development of a method based on the coupling of flow analysis (FA, hydride generation (HG, and derivative molecular absorption spectrophotometry (D-EAM in gas phase (GP, is described in order to determine total antimony in antileishmanial products. Second derivative order (D²224nm of the absorption spectrum (190 - 300 nm is utilized as measurement criterion. Each one of the parameters involved in the development of the proposed method was examined and optimized. The utilization of the EAM in GP as detection system in a continuous mode instead of atomic absorption spectrometry represents the great potential of the analytic proposal.

  6. Effect of external energy on atomic, crystalline and powder characteristics of antimony and bismuth powders

    Indian Academy of Sciences (India)

    Vikram V Dabhade; Rama Mohan R Tallapragada; Mahendra Kumar Trivedi


    Next to atoms and molecules the powders are the smallest state of matter available in high purities and large quantities. The effect of any external energy on the shape, morphology and structure can thus be studied with relative ease. The present investigation deals with the effect of a non-contact external energy on the powders of antimony and bismuth. The characteristics of powders treated by external energy are compared with the as received powders (control). The average particle sizes, 50 and 99, the sizes below which 99% of the particles are present showed significant increase and decrease indicating that the energy had caused deformation and fracture as if the powders have been subjected to high energy milling. To be able to understand the reasons for these changes the powders are characterized by techniques such as X-ray diffraction (XRD), surface area determination (BET), thermal analytical techniques such as DTA–DTG, DSC–TGA and SDTA and scanning electron microscopy (SEM). The treated powder samples exhibited remarkable changes in the powder characteristics at all structural levels starting from polycrystalline particles, through single crystal to atoms. The external energy had changed the lattice parameters of the unit cell which in turn changed the crystallite size and density. The lattice parameters are then used to compute the weight and effective nuclear charge of the atom which showed significant variation. It is speculated that the external energy is acting on the nucleus through some reversible weak interaction of larger cross section causing changes in the proton to neutron ratios. Thus the effect is felt by all the atoms, and hence the unit cell, single crystal grain and grain boundaries. The stresses generated in turn may have caused deformation or fracture of the weak interfaces such as the crystallite and grain boundaries.

  7. Contamination of bottled waters with antimony leaching from polyethylene terephthalate (PET) increases upon storage. (United States)

    Shotyk, William; Krachler, Michael


    Antimony concentrations were determined in 132 brands of bottled water from 28 countries. Two of the brands were at or above the maximum allowable Sb concentration for drinking water in Japan (2 microg/L). Elevated concentrations of Sb in bottled waters are due mainly to the Sb2O3 used as the catalyst in the manufacture of polyethylene terephthalate (PET(E)). The leaching of Sb from PET(E) bottles shows variable reactivity. In 14 brands of bottled water from Canada, Sb concentrations increased on average 19% during 6 months storage at room temperature, but 48 brands of water from 11 European countries increased on average 90% under identical conditions. A mineral water from France in PET(E), purchased in Germany, yielded 725 ng/L when first tested, but 1510 ng/L when it was stored for 6 months at room temperature; the same brand of water, purchased in Hong Kong, yielded 1990 ng/L Sb. Pristine groundwater containing 1.7+/-0.4 ng/L Sb (n = 6) yielded 26.6+/-2.3 ng/L Sb (n = 3) after storage in PET(E) bottles from Canada for 6 months versus 281+/-38 ng/L Sb (n = 3) in PET(E) bottles from Germany. Tap water bottled commercially in PET(E) in December 2005 contained 450+/-56 ng/L Sb (n = 3) versus 70.3+/-0.3 ng/L Sb (n = 3) when sampled from a household faucet in the same village (Bammental, Germany), and 25.7+/-1.5 ng/L Sb (n = 3) from a local artesian flow. PMID:17396641

  8. Uptake, translocation and transformation of antimony in rice (Oryza sativa L.) seedlings. (United States)

    Cai, Fei; Ren, Jinghua; Tao, Shu; Wang, Xilong


    Antimony (Sb), as a toxic metalloid, has been gaining increasing research concerns due mainly to its severe pollution in many places. Rice has been identified to be the dominant intake route of Sb by residents close to the Sb mining areas. A hydroponic experiment was conducted to investigate the difference in uptake, translocation and transformation of Sb in rice seedlings of four cultivars exposed to 0.2 or 1.0 mg/L of Sb(V). The results showed that mass concentration of iron plaque (mg/kg FW) formed at the root surfaces of cultivar N was the highest among all tested cultivars at both low and high exposure levels of Sb(V). The accumulated Sb concentration in iron plaque significantly increased with an increase in mass concentration of iron plaque formed at the rice root. The total amount of iron plaque (mg/pot) at rice root generally increased with increasing exposed Sb(V) concentration, which was closely associated with the increasing lipid peroxidation in roots. Concentration percentage of Sb in rice root significantly reduced as the corresponding value in the iron plaque increased, suggesting that iron plaque formation strongly suppressed uptake of Sb by rice root. Sb concentration in rice tissues followed an order: root > stem, leaf. The japonica rice (cultivars N and Z) exhibited a stronger translocation tendency of Sb from root to stem than indica hybrid rice (cultivars F and G). Translocation of Sb from root of cultivar F to its stem and leaf was sharply enhanced with increasing Sb exposure concentration. Sb(V) could be reduced to Sb(III) in rice tissues, especially in stems (10-26% of the total Sb). For the sake of food safety, the difference in uptake, translocation and transformation of Sb in rice species planted in Sb-contaminated soils should be taken into consideration.

  9. Association of drinking-water source and use characteristics with urinary antimony concentrations. (United States)

    Makris, Konstantinos C; Andra, Syam S; Herrick, Lisa; Christophi, Costas A; Snyder, Shane A; Hauser, Russ


    Environmental factors, such as storage time, frequency of bottle reuse and temperature, have been shown to facilitate antimony (Sb) leaching from water- and food-packaging materials. The globally escalating consumption of water packaged in Sb-containing bottles, such as that of polyethylene terephthalate (PET), could increase human daily Sb doses. This study set out to investigate the relationship between drinking-water source, use characteristics, and urinary Sb concentrations (U-Sb) accompanied with survey responses of a healthy (n=35) Cypriot participant pool. One spot urine sample was collected during administration of questionnaire, while a second spot urine sample was collected from the same individual about 7 days later. Urinary and water Sb concentrations were measured with an inductively coupled plasma mass spectrometer. Survey responses showed that bottled water summed over various volumes and plastic types, such as polycarbonate and PET contributed to an average 61% of daily water consumption. Water sources such as tap, mobile stations (explained in a following section), and well water contributed to 24%, 14%, and 2% of an individual's daily water consumption pattern, respectively. Average daily potable water use of both bottled and tap water by individuals consisted of 65% drinking-water, while the remaining 35% was water used for preparing cold and hot beverages, such as, tea, coffee, and juices. A significant (P=0.02) association between per capita water consumption from PET bottles and urinary creatinine-unadjusted concentrations was observed, but this relationship did not remain after inclusion of covariates in a multivariate regression model. In the creatinine-adjusted regression model, only gender (female) was a significant (P<0.01) predictor of U-Sb, after adjusting for several covariates. It is proposed that consumption data collection on various water uses and sources among individuals could perhaps decrease the uncertainty associated with

  10. Effects of Residual Elements Arsenic, Antimony, and Tin on Surface Hot Shortness (United States)

    Yin, Lan; Sridhar, Seetharaman


    Scrap-based electric arc furnace (EAF) steelmaking is limited by a surface cracking problem in the recycled steel products, which is known as surface hot shortness. This problem originates from the excessive amount of copper (Cu) in the steel scrap, which enriches during the oxidation of iron (Fe) and consequently melts and penetrates into the austenite grain boundaries. In this article, the effects of arsenic (As), antimony (Sb), and tin (Sn) on surface hot shortness were investigated. A series of Fe-0.3 wt pct Cu- x wt pct (As, Sb, or Sn) alloys with x content ranging from 0.06 to 0.10 wt pct was oxidized in air at 1423 K (1150 °C) for 60, 300, and 600 seconds inside the chamber of a thermogravimety analyzer (TGA) where heat is supplied through infrared radiation. Scanning electron microscopy (SEM) investigations show that (1) the presence of Sb and Sn results in severe grain boundary cracking, whereas the presence of As does not, (2) open cracks with Fe oxides were found beneath the oxide/metal interface in the Sb and Sn alloys, and (3) the oxide/metal interfaces for all As, Sb, and Sn alloys are planar. Penetration experiments of pure Cu and Cu-30 wt pct Sn liquid were also conducted in the chamber of a hot-stage confocal laser scanning microscopy (CLSM) in nonoxidizing atmosphere: (1) on the Fe-35 wt pct manganese (Mn) alloys to study the correlation between cracking and grain boundary characters, and (2) on the pure Fe substrates to exclude the bulk segregation effects of Sn on grain boundary cracking. It was found that grain boundary cracking rarely took place on low-energy grain boundaries. The results also suggest that the bulk segregation of Sn in the substrate is not necessary to promote significant grain boundary cracking, and as long as the liquid phase contains Sn, it will be highly embrittling.

  11. Green and red fluorescence upconversion in neodymium-doped low phonon antimony glasses

    International Nuclear Information System (INIS)

    A new K2O-B2O3-Sb2O3 (KBS) glass system having low phonon energy (about 600 cm-1) doped with Nd3+ ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-visible-near infrared (UV-vis-NIR) absorption and photoluminescence upconversion properties with special emphasis on the spectrochemistry of the 15K2O-15B2O3-70Sb2O3 (mol%) glass have been studied doping with different concentrations (0.1-1.0 wt%) of Nd2O3. UV-vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 805 nm at room temperature. Two upconverted bands originating from the 4G7/2 → 4I9/2 and 4G7/2 → 4I13/2 transitions are found to be centered at 540 nm (green, medium) and 650 nm (red, strong), respectively. These bands have been explained from the evaluation of the absorption and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET), cooperative energy transfer (CET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level (4G7/2) by effects of multiphonon deexcitation and thermal population. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm-1, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm-1).

  12. EPR, optical absorption and luminescence studies of Cr3+-doped antimony phosphate glasses (United States)

    De Vicente, F. S.; Santos, F. A.; Simões, B. S.; Dias, S. T.; Siu Li, M.


    Antimony phosphate glasses (SbPO) doped with 3 and 6 mol% of Cr3+ were studied by Electron Paramagnetic Resonance (EPR), UV-VIS optical absorption and luminescence spectroscopy. The EPR spectra of Cr3+-doped glasses showed two principal resonance signals with effective g values at g = 5.11 and g = 1.97. UV-VIS optical absorption spectra of SbPO:Cr3+ presented four characteristics bands at 457, 641, 675, and 705 nm related to the transitions from 4A2(F) to 4T1(F), 4T2(F), 2T1(G), and 2E(G), respectively, of Cr3+ ions in octahedral symmetry. Optical absorption spectra of SbPO:Cr3+ allowed evaluating the crystalline field Dq, Racah parameters (B and C) and Dq/B. The calculated value of Dq/B = 2.48 indicates that Cr3+ ions in SbPO glasses are in strong ligand field sites. The optical band gap for SbPO and SbPO:Cr3+ were evaluated from the UV optical absorption edges. Luminescence measurements of pure and Cr3+-doped glasses excited with 350 nm revealed weak emission bands from 400 to 600 nm due to the 3P1 → 1S0 electronic transition from Sb3+ ions. Cr3+-doped glasses excited with 415 nm presented Cr3+ characteristic luminescence spectra composed by two broad bands, one band centered at 645 nm (2E → 4A2) and another intense band from 700 to 850 nm (4T2 → 4A2).

  13. Metagenomic approach reveals variation of microbes with arsenic and antimony metabolism genes from highly contaminated soil.

    Directory of Open Access Journals (Sweden)

    Jinming Luo

    Full Text Available Microbes have great potential for arsenic (As and antimony (Sb bioremediation in heavily contaminated soil because they have the ability to biotransform As and Sb to species that have less toxicity or are more easily removed. In this study, we integrated a metagenomic method with physicochemical characterization to elucidate the composition of microbial community and functional genes (related to As and Sb in a high As (range from 34.11 to 821.23 mg kg-1 and Sb (range from 226.67 to 3923.07 mg kg-1 contaminated mine field. Metagenomic analysis revealed that microbes from 18 phyla were present in the 5 samples of soil contaminated with high As and Sb. Moreover, redundancy analysis (RDA of the relationship between the 18 phyla and the concentration of As and Sb demonstrated that 5 phyla of microbes, i.e. Actinobacteria, Firmicutes, Nitrospirae, Tenericutes and Gemmatimonadetes were positively correlated with As and Sb concentration. The distribution, diversity and abundance of functional genes (including arsC, arrA, aioA, arsB and ACR3 were much higher for the samples containing higher As and Sb concentrations. Based on correlation analysis, the results showed a positive relationship between arsC-like (R2 = 0.871 and aioA-like (R2 = 0.675 gene abundance and As concentration, and indicated that intracellular As(V reduction and As(III oxidation could be the dominant As detoxification mechanism enabling the microbes to survive in the environment. This study provides a direct and reliable reference on the diversity of microbial community and functional genes in an extremely high concentration As- and Sb-contaminated environment.

  14. Drilling technology for Wei 117 sidetracked horizontal well%卫117侧平井钻井技术

    Institute of Scientific and Technical Information of China (English)

    王自民; 刘春林; 张宏威; 刘志华; 李宁; 王玉敏


    To develop the remaining oil and enhance oil recovery, Zhongyuan Oilfield arranged the treatment of drilling the Wei 117 well. Wei 117 well was featured by large extension, difficultly controlled trajectory, high demand of lubrication to prevent plugging, and difficult drilling and completion treatment. Because of the large extension, the profile type of "direct-up-slow-up-horizontal" was taken. The treatments of monitoring while drilling and trajectory prediction were strengthened to adjust the drilling mode timely and to improve the profile coincidence rate. High speed roller bit and single curve screw were matched to drilling the well. BHA and drilling parameters were optimized to guarantee the control of directional profile. The silanol drilling fluid was taken, and the flowing pattern was adjusted timely, to improve the lubrication and suspension capacity of drilling fluid, what is more, to make sure the stable wellbore. Regular short trip was taken to remove sands, safe operation and completion preparing treatment were stressed, to guarantee safe completion. The success on the well supply a reference for the treatment on the similar wells.%为挖潜增效、提高采收率,中原油田部署了卫117侧平井.该井具有井斜位移大、井眼轨迹不易控制、钻井液润滑防卡性能要求高、安全钻完井施工难度大等特点.根据靶前位移长特点,采用“直-增-稳-增-水平”剖面类型,加强随钻监控,加密测量做好轨迹预测,及时调整钻进方式,提高了实钴剖面符合率;使用高速牙轮钻头配合单弯螺杆钻进,优选合适的钻具组合、钻井参数,保证了定向工具面易于控制;采用硅醇钻井液体系,及时调整流型,提高钻井液润滑防塌与悬浮携带能力,保证井壁稳定;采取定期短起下钻清砂,强化安全操作和各项完井准备措施,为安全交井提供保障.该井的成功实施,对指导此类井施工具有一定的借鉴作用.

  15. 21 CFR 139.117 - Enriched macaroni products with fortified protein. (United States)


    ... this section is “Enriched Wheat ___ Macaroni Product—with Fortified Protein”, the blank being filled in... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Enriched macaroni products with fortified protein. 139.117 Section 139.117 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND...

  16. 37 CFR 1.17 - Patent application and reexamination processing fees. (United States)


    ....17, see the List of CFR Sections Affected, which appears in the Finding Aids section of the printed... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Patent application and reexamination processing fees. 1.17 Section 1.17 Patents, Trademarks, and Copyrights UNITED STATES PATENT...

  17. 34 CFR 403.117 - What definitions apply to the Postsecondary and Adult Vocational Education Programs? (United States)


    ... 34 Education 3 2010-07-01 2010-07-01 false What definitions apply to the Postsecondary and Adult Vocational Education Programs? 403.117 Section 403.117 Education Regulations of the Offices of the Department... definitions apply to the Postsecondary and Adult Vocational Education Programs? For the purposes of §§...

  18. 26 CFR 521.117 - Claims in cases of double taxation. (United States)


    ... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Claims in cases of double taxation. 521.117...) REGULATIONS UNDER TAX CONVENTIONS DENMARK General Income Tax Taxation of Nonresident Aliens Who Are Residents of Denmark and of Danish Corporations § 521.117 Claims in cases of double taxation. Under Article...

  19. 25 CFR 117.7 - Disbursement or expenditure of surplus funds. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Disbursement or expenditure of surplus funds. 117.7... AND EXPENDITURE OF INDIVIDUAL FUNDS OF MEMBERS OF THE OSAGE TRIBE OF INDIANS WHO DO NOT HAVE CERTIFICATES OF COMPETENCY § 117.7 Disbursement or expenditure of surplus funds. Except as provided in...

  20. 23 CFR 230.117 - Reimbursement procedures (Federal-aid highway construction projects only). (United States)


    ... 23 Highways 1 2010-04-01 2010-04-01 false Reimbursement procedures (Federal-aid highway construction projects only). 230.117 Section 230.117 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF... construction projects only). (a) On-the-job special training provisions. State highway agencies will...

  1. 46 CFR 117.205 - Survival craft-vessels operating on limited coastwise routes. (United States)


    ... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on limited coastwise... PASSENGERS LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.205 Survival craft... the survival craft required by §§ 117.204 (a) through (d) of this part, as applicable. (b) Each...

  2. 29 CFR 4.117 - Work subject to requirements of Walsh-Healey Act. (United States)


    ... 29 Labor 1 2010-07-01 2010-07-01 true Work subject to requirements of Walsh-Healey Act. 4.117... Application of the McNamara-O'Hara Service Contract Act Specific Exclusions § 4.117 Work subject to... work required to be done in accordance with the provision of the Walsh-Healey Public Contracts Act”...

  3. 40 CFR 65.117 - Alternative means of emission limitation: Batch processes. (United States)


    ... 40 Protection of Environment 15 2010-07-01 2010-07-01 false Alternative means of emission limitation: Batch processes. 65.117 Section 65.117 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... is visible, audible, or olfactory evidence of fluid loss. (ii) For pressure tests using a liquid,...

  4. Nutritional status in patients with cutaneous leishmaniasis and a study of the effects of zinc supplementation together with antimony treatment

    Directory of Open Access Journals (Sweden)

    Miguel Guzman-Rivero


    Full Text Available Background: The role of micronutrient status for the incidence and clinical course of cutaneous leishmaniasis is not much studied. Still zinc supplementation in leishmaniasis has shown some effect on the clinical recovery, but the evidence in humans is limited. Objective: To compare biochemical nutritional status in cutaneous leishmaniasis patients with that in controls and to study the effects of zinc supplementation for 60 days. Design: Twenty-nine patients with cutaneous leishmaniasis were treated with antimony for 20 days. Fourteen of them got 45 mg zinc daily and 15 of them got placebo. Biomarkers of nutritional and inflammatory status and changes in size and characteristics of skin lesions were measured. Results: The level of transferrin receptor was higher in patients than in controls but otherwise no differences in nutritional status were found between patients and controls. No significant effects of zinc supplementation on the clinical recovery were observed as assessed by lesion area reduction and characteristics or on biochemical parameters. Conclusions: It is concluded that nutritional status was essentially unaffected in cutaneous leishmaniasis and that oral zinc supplementation administered together with intramuscular injection of antimony had no additional clinical benefit.

  5. Detection of pathogenic bacteria in skin lesions of patients with chiclero's ulcer: reluctant response to antimonial treatment

    Directory of Open Access Journals (Sweden)

    Isaac-Márquez Angélica Patricia


    Full Text Available We investigated the bacterial flora present in skin lesions of patients with chiclero's ulcer from the Yucatan peninsula of Mexico using conventional culture methods (11 patients, and an immunocolorimetric detection of pathogenic Streptococcus pyogenes (15 patients. Prevalence of bacteria isolated by culture methods was 90.9% (10/11. We cultured, from chiclero's ulcers (60%, pathogenic bacterial such as Staphylococcus aureus (20%, S. pyogenes (1.6%, Pseudomonas aeruginosa (1.6%, Morganella morganii (1.6%, and opportunist pathogenic bacteria such as Klebsiella spp. (20.0%, Enterobacter spp. (20%, and Enterococcus spp. (20%. We also cultured coagulase-negative staphylococci in 40% (4/10 of the remaining patients. Micrococcus spp. and coagulase-negative staphylococci constituted the bacterial genuses more frequently isolated in the normal skin of patients with chiclero's ulcer and healthy individuals used as controls. We also undertook another study to find out the presence of S. pyogenes by an immunocolorimetric assay. This study indicated that 60% (9/15 of the ulcerated lesions, but not normal controls, were contaminated with S. pyogenes. Importantly, individuals with purulent secretion and holding concomitant infections with S. pyogenes, S. aureus, P. aeruginosa, M. morganii, and E. durans took longer to heal Leishmania (L. mexicana infections treated with antimonial drugs. Our results suggest the need to eliminate bacterial purulent infections, by antibiotic treatment, before starting antimonial administration to patients with chiclero's ulcer.

  6. Complement activation-related pseudoallergy in dogs following intravenous administration of a liposomal formulation of meglumine antimoniate

    Directory of Open Access Journals (Sweden)

    Raul R. Ribeiro


    Full Text Available The increasing use of nanotechnologies in advanced therapies has allowed the observation of specific adverse reactions related to nanostructures. The toxicity of a novel liposome formulation of meglumine antimoniate in dogs with visceral leishmaniasis after single dose has been investigated. Groups of 12 animals received by the intravenous route a single dose of liposomal meglumine antimoniate (group I [GI], 6.5 mg Sb/kg, empty liposomes (GII or isotonic saline (GIII. Evaluation of hematological and biochemical parameters showed no significant changes 4 days after administration. No undesired effects were registered in the GIII. However, adverse reactions were observed in 67.7% of dogs from both groups that received liposomal formulations. The side effects began moments after bolus administration and disappeared during the first 15 minutes after treatment. Prostation, sialorrhea and defecation were the most frequent clinical signs, registered in 33.3% and 41.6 % of animals from the groups GI and GII, respectively. Tachypnea, mydriasis, miosis, vomiting and cyanosis were also registered in both groups. The adverse reactions observed in this study were attributed to the activation of the complement system by lipid vesicles in a phenomenon known as Complement Activation-Related Pseudoallergy (CARPA. The influence of the physical-chemical characteristics of liposomal formulation in the triggering of CARPA is discussed.

  7. Determination of Antimony (III in Real Samples by Anodic Stripping Voltammetry Using a Mercury Film Screen-Printed Electrode

    Directory of Open Access Journals (Sweden)

    Olga Domínguez-Renedo


    Full Text Available This paper describes a procedure for the determination of antimony (III by differential pulse anodic stripping voltammetry using a mercury film screen-printed electrode as the working electrode. The procedure has been optimized using experimental design methodology. Under these conditions, in terms of Residual Standard Deviation (RSD, the repeatability (3.81 % and the reproducibility (5.07 % of the constructed electrodes were both analyzed. The detection limit for Sb (III was calculated at a value of 1.27×10–8 M. The linear range obtained was between 0.99 × 10–8 – 8.26 × 10–8 M. An analysis of possible effects due to the presence of foreign ions in the solution was performed and the procedure was successfully applied to the determination of antimony levels in pharmaceutical preparations and sea water samples.

  8. Antimony doped tin oxides and their composites with tin pyrophosphates as catalyst supports for oxygen evolution reaction in proton exchange membrane water electrolysis

    DEFF Research Database (Denmark)

    Xu, Junyuan; Li, Qingfeng; Hansen, Martin Kalmar;


    Proton exchange membrane water electrolysers operating at typically 80 °C or at further elevated temperatures suffer from insufficient catalyst activity and durability. In this work, antimony doped tin oxide nanoparticles were synthesized and further doped with an inorganic proton conducting phase...

  9. Real-world emission factors for antimony and other brake wear related trace elements: size-segregated values for light and heavy duty vehicles. (United States)

    Bukowiecki, Nicolas; Lienemann, Peter; Hill, Matthias; Figi, Renato; Richard, Agnes; Furger, Markus; Rickers, Karen; Falkenberg, Gerald; Zhao, Yongjing; Cliff, Steven S; Prevot, Andre S H; Baltensperger, Urs; Buchmann, Brigitte; Gehrig, Robert


    Hourly trace element measurements were performed in an urban street canyon and next to an interurban freeway in Switzerland during more than one month each, deploying a rotating drum impactor (RDI) and subsequent sample analysis by synchrotron radiation X-ray fluorescence spectrometry (SR-XRF). Antimony and other brake wear associated elements were detected in three particle size ranges (2.5-10, 1-2.5, and 0.1-1 microm). The hourly measurements revealed that the effect of resuspended road dust has to be taken into account for the calculation of vehicle emission factors. Individual values for light and heavy duty vehicles were obtained for stop-and-go traffic in the urban street canyon. Mass based brake wear emissions were predominantly found in the coarse particle fraction. For antimony, determined emission factors were 11 +/- 7 and 86 +/- 42 microg km(-1) vehicle(-1) for light and heavy duty vehicles, respectively. Antimony emissions along the interurban freeway with free-flowing traffic were significantly lower. Relative patterns for brake wear related elements were very similar for both considered locations. Beside vehicle type specific brake wear emissions, road dust resuspension was found to be a dominant contributor of antimony in the street canyon. PMID:19924925

  10. HSPC117 deficiency in cloned embryos causes placental abnormality and fetal death

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yingying [Department of Reproduction and Development, Kunming Institute of Zoology and Kunming Primate Research Center, Chinese Academy of Sciences, Kunming 650223 (China); State Key Laboratory of Reproductive Biology, Institute of Zoology, Chinese Academy of Sciences, Beijing 100080 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Hai, Tang; Liu, Zichuan; Zhou, Shuya; Lv, Zhuo [State Key Laboratory of Reproductive Biology, Institute of Zoology, Chinese Academy of Sciences, Beijing 100080 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Ding, Chenhui; Liu, Lei [State Key Laboratory of Reproductive Biology, Institute of Zoology, Chinese Academy of Sciences, Beijing 100080 (China); Niu, Yuyu [Department of Reproduction and Development, Kunming Institute of Zoology and Kunming Primate Research Center, Chinese Academy of Sciences, Kunming 650223 (China); Zhao, Xiaoyang; Tong, Man [State Key Laboratory of Reproductive Biology, Institute of Zoology, Chinese Academy of Sciences, Beijing 100080 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Wang, Liu [State Key Laboratory of Reproductive Biology, Institute of Zoology, Chinese Academy of Sciences, Beijing 100080 (China); Jouneau, Alice [INRA, UMR 1198, ENVA, CNRS, FRE 2857, Biologie du Developpement et Reproduction, Jouy en Josas F-78350 (France); Zhang, Xun [Neuroendocrine Unit, Massachusetts General Hospital and Harvard Medical School, Boston, MA 02114 (United States); Ji, Weizhi, E-mail: [Department of Reproduction and Development, Kunming Institute of Zoology and Kunming Primate Research Center, Chinese Academy of Sciences, Kunming 650223 (China); Zhou, Qi, E-mail: [State Key Laboratory of Reproductive Biology, Institute of Zoology, Chinese Academy of Sciences, Beijing 100080 (China)


    Somatic cell nuclear transfer (SCNT) has been successfully used in many species to produce live cloned offspring, albeit with low efficiency. The low frequency of successful development has usually been ascribed to incomplete or inappropriate reprogramming of the transferred nuclear genome. Elucidating the genetic differences between normal fertilized and cloned embryos is key to understand the low efficiency of SCNT. Here, we show that expression of HSPC117, which encodes a hypothetical protein of unknown function, was absent or very low in cloned mouse blastocysts. To investigate the role of HSPC117 in embryo development, we knocked-down this gene in normal fertilized embryos using RNA interference. We assessed the post-implantation survival of HSPC117 knock-down embryos at 3 stages: E9 (prior to placenta formation); E12 (after the placenta was fully functional) and E19 (post-natal). Our results show that, although siRNA-treated in vivo fertilized/produced (IVP) embryos could develop to the blastocyst stage and implanted without any difference from control embryos, the knock-down embryos showed substantial fetal death, accompanied by placental blood clotting, at E12. Furthermore, comparison of HSPC117 expression in placentas of nuclear transfer (NT), intracytoplasmic sperm injection (ICSI) and IVP embryos confirmed that HSPC117 deficiency correlates well with failures in embryo development: all NT embryos with a fetus, as well as IVP and ICSI embryos, had normal placental HSPC117 expression while those NT embryos showing reduced or no expression of HSPC117 failed to form a fetus. In conclusion, we show that HSPC117 is an important gene for post-implantation development of embryos, and that HSPC117 deficiency leads to fetal abnormalities after implantation, especially following placental formation. We suggest that defects in HSPC117 expression may be an important contributing factor to loss of cloned NT embryos in vivo.

  11. Monitoring of copper, arsenic and antimony levels in agricultural soils impacted and non-impacted by mining activities, from three regions in Chile. (United States)

    De Gregori, Ida; Fuentes, Edwar; Rojas, Mariela; Pinochet, Hugo; Potin-Gautier, Martine


    This paper reports a comparative study of the concentration of three important environmental elements that are often found together in mineral deposits and then associated with mining activities; copper, arsenic and antimony. These elements were determined in 26 different agricultural soils from regions I, II and V in Chile, zones where the most important and biggest copper industries of this country are located. As background levels of these elements in soils have not been well established, in this study, both, impacted and non-impacted agricultural soils from different regions were considered. The relationships between the concentrations of these elements in soils were also examined. The concentration ranges for copper, arsenic and antimony were 11-530; 2.7-202 and 0.42-11 mg kg(-1) respectively. The copper concentrations in non-polluted soils from the north and central zone of Chile were similar. However, three sites from the north region have copper concentration as higher as 100 mg kg(-1), values that exceed the critical concentration for copper in soils. The concentration of arsenic and antimony in the north soils were higher than in non-impacted ones and, in the case of arsenic, greatly exceeded the world average concentration reported for this element in soils. The highest arsenic and antimony concentrations were found in Calama and Quillagua soils, two different sites in the Loa valley. The arsenic/antimony concentration ratio was higher in Quillagua soil. The high concentrations of three elements determined in impacted soils from region V (Puchuncaví and Catemu valleys) clearly shows the impact produced in this zone by the industrial and mining activities developed in their proximities. At Puchuncaví valley a clear decrease was observed in copper, arsenic and antimony concentrations in soils on the function of the distance from the industrial complex "Las Ventanas", and all concentrations exceeded the reported critical values for this matrix. Instead at

  12. Correlation models between environmental factors and bacterial resistance to antimony and copper.

    Directory of Open Access Journals (Sweden)

    Zunji Shi

    Full Text Available Antimony (Sb and copper (Cu are toxic heavy metals that are associated with a wide variety of minerals. Sb(III-oxidizing bacteria that convert the toxic Sb(III to the less toxic Sb(V are potentially useful for environmental Sb bioremediation. A total of 125 culturable Sb(III/Cu(II-resistant bacteria from 11 different types of mining soils were isolated. Four strains identified as Arthrobacter, Acinetobacter and Janibacter exhibited notably high minimum inhibitory concentrations (MICs for Sb(III (>10 mM,making them the most highly Sb(III-resistant bacteria to date. Thirty-six strains were able to oxidize Sb(III, including Pseudomonas-, Comamonas-, Acinetobacter-, Sphingopyxis-, Paracoccus- Aminobacter-, Arthrobacter-, Bacillus-, Janibacter- and Variovorax-like isolates. Canonical correspondence analysis (CCA revealed that the soil concentrations of Sb and Cu were the most obvious environmental factors affecting the culturable bacterial population structures. Stepwise linear regression was used to create two predictive models for the correlation between soil characteristics and the bacterial Sb(III or Cu(II resistance. The concentrations of Sb and Cu in the soil was the significant factors affecting the bacterial Sb(III resistance, whereas the concentrations of S and P in the soil greatly affected the bacterial Cu(II resistance. The two stepwise linear regression models that we derived are as follows: MIC(Sb(III=606.605+0.14533 x C(Sb+0.4128 x C(Cu and MIC((Cu(II=58.3844+0.02119 x C(S+0.00199 x CP [where the MIC(Sb(III and MIC(Cu(II represent the average bacterial MIC for the metal of each soil (μM, and the C(Sb, C(Cu, C(S and C(P represent concentrations for Sb, Cu, S and P (mg/kg in soil, respectively, p<0.01]. The stepwise linear regression models we developed suggest that metals as well as other soil physicochemical parameters can contribute to bacterial resistance to metals.

  13. Green and red fluorescence upconversion in neodymium-doped low phonon antimony glasses

    Energy Technology Data Exchange (ETDEWEB)

    Som, Tirtha [Glass Technology Laboratory, Central Glass and Ceramic Research Institute (Council of Scientific and Industrial Research), 196 Raja S.C. Mullick Road, Kolkata 700032 (India); Karmakar, Basudeb [Glass Technology Laboratory, Central Glass and Ceramic Research Institute (Council of Scientific and Industrial Research), 196 Raja S.C. Mullick Road, Kolkata 700032 (India)], E-mail:


    A new K{sub 2}O-B{sub 2}O{sub 3}-Sb{sub 2}O{sub 3} (KBS) glass system having low phonon energy (about 600 cm{sup -1}) doped with Nd{sup 3+} ions has been developed. Infrared reflection spectroscopic (IRRS) studies have been employed to establish its low phonon energy. Ultraviolet-visible-near infrared (UV-vis-NIR) absorption and photoluminescence upconversion properties with special emphasis on the spectrochemistry of the 15K{sub 2}O-15B{sub 2}O{sub 3}-70Sb{sub 2}O{sub 3} (mol%) glass have been studied doping with different concentrations (0.1-1.0 wt%) of Nd{sub 2}O{sub 3}. UV-vis-NIR absorption band positions have been justified with quantitative calculation of nephelauxetic parameter and covalent bonding characteristics of the host. NIR to visible upconversion has been investigated by exciting at 805 nm at room temperature. Two upconverted bands originating from the {sup 4}G{sub 7/2} {yields} {sup 4}I{sub 9/2} and {sup 4}G{sub 7/2} {yields} {sup 4}I{sub 13/2} transitions are found to be centered at 540 nm (green, medium) and 650 nm (red, strong), respectively. These bands have been explained from the evaluation of the absorption and excitation spectra. The upconversion processes have been explained by the excited state absorption (ESA), energy transfer (ET), cooperative energy transfer (CET) and cross-relaxation (CR) mechanisms involving population of the metastable (storage) energy level ({sup 4}G{sub 7/2}) by effects of multiphonon deexcitation and thermal population. It is evident from the IRRS study that the upconversion phenomena are expedited by the low multiphonon relaxation rate in antimony glasses owing to their low phonon energy (602 cm{sup -1}, the main and highest intensity Sb-O-Sb stretching band) which is very close to that of fluoride glasses (500-600 cm{sup -1})

  14. Novel organo-colloidal synthesis, optical properties, and structural analysis of antimony sesquioxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Validzic, Ivana Lj., E-mail:; Abazovic, Nadica D.; Mitric, Miodrag [University of Belgrade, ' Vinca' Institute of Nuclear Sciences (Serbia); Lalic, Milan V. [Universidade Federal de Sergipe, Departamento de Fisica (Brazil); Popovic, Zoran S. [University of Belgrade, ' Vinca' Institute of Nuclear Sciences (Serbia); Vukajlovic, Filip R. [' Vinca' Institute of Nuclear Sciences (Serbia)


    We report the novel colloidal syntheses in organic media of antimony sesquioxide ( Sb{sub 2}O{sub 3} ) spherical nanoparticles (30-250 nm) and octahedron micro- and nanocrystals (100nm - 4{mu}) depending on the synthetic method conditions. It is observed that small differences in the synthetic procedure cause large differences in the very changeable morphology. The structure of Sb{sub 2}O{sub 3} powders was refined down to the R-factors of 9.57, 7.44, 9.19, 9.78, and 8.30 %. The refinement showed that Sb{sub 2}O{sub 3} powder belongs to the cubic crystal type with space group Fd 3-bar m (No. 227). The values of estimated standard deviations, as well as reliability factors, confirmed that the structure of Sb{sub 2}O{sub 3} was well refined. Ultraviolet and visible (UV-Vis) absorption spectroscopy and diffuse reflectance measurements (DRS) reveal that the optical band gap energies found for the Sb{sub 2}O{sub 3} octahedrons and nanoparticles, micro- and nanocrystals, respectively, are quite independent of the synthetic method conditions and synthesized morphology and is found to be between 4.1-4.4 eV. No peaks in both photoluminescence (PL) emission and excitation spectra have been observed for a broad spectral range, typical for this material. In order to discriminate between conflicting experimental results concerning the band gap energy of this compound, we investigated theoretically the electronic structure and optical properties of one of the cubic sesquioxide Sb{sub 2}O{sub 3} samples synthesized here. This has been done on the basis of density functional theory (DFT) with the generalized gradient approximation (GGA) and improved version of exchange potential suggested recently by Tran and Blaha (TB-mBJ). The main characteristic of the calculated TB-mBJ electronic structure is the significant improvement of the band gap value, which is in perfect agreement with our experimental measurements. The real and imaginary parts of the dielectric tensor are also

  15. The presence and leachability of antimony in different wastes and waste handling facilities in Norway. (United States)

    Okkenhaug, G; Almås, Å R; Morin, N; Hale, S E; Arp, H P H


    The environmental behaviour of antimony (Sb) is gathering attention due to its increasingly extensive use in various products, particularly in plastics. Because of this it may be expected that plastic waste is an emission source for Sb in the environment. This study presents a comprehensive field investigation of Sb concentrations in diverse types of waste from waste handling facilities in Norway. The wastes included waste electrical and electronic equipment (WEEE), glass, vehicle fluff, combustibles, bottom ash, fly ash and digested sludge. The highest solid Sb concentrations were found in WEEE and vehicle plastic (from 1238 to 1715 mg kg(-1)) and vehicle fluff (from 34 to 4565 mg kg(-1)). The type of acid used to digest the diverse solid waste materials was also tested. It was found that HNO3:HCl extraction gave substantially lower, non-quantitative yields compared to HNO3:HF. The highest water-leachable concentration for wastes when mixed with water at a 1 : 10 ratio were observed for plastic (from 0.6 to 2.0 mg kg(-1)) and bottom ash (from 0.4 to 0.8 mg kg(-1)). For all of the considered waste fractions, Sb(v) was the dominant species in the leachates, even though Sb(iii) as Sb2O3 is mainly used in plastics and other products, indicating rapid oxidation in water. This study also presents for the first time a comparison of Sb concentrations in leachate at waste handling facilities using both active grab samples and DGT passive samples. Grab samples target the total suspended Sb, whereas DGT targets the sum of free- and other chemically labile species. The grab sample concentrations (from 0.5 to 50 μg L(-1)) were lower than the predicted no-effect concentration (PNEC) of 113 μg L(-1). The DGT concentrations were substantially lower (from 0.05 to 9.93 μg L(-1)) than the grab samples, indicating much of the Sb is present in a non-available colloidal form. In addition, air samples were taken from the chimney and areas within combustible waste incinerators, as

  16. Growth, photosynthesis, and defense mechanism of antimony (Sb)-contaminated Boehmeria nivea L. (United States)

    Chai, Li-Yuan; Mubarak, Hussani; Yang, Zhi-Hui; Yong, Wang; Tang, Chong-Jian; Mirza, Nosheen


    Ramie (Boehmeria nivea L.) is the oldest cash fiber crop in China and is widely grown in antimony (Sb) mining areas. To evaluate the extent of Sb resistance and tolerance, the growth, tolerance index (TI), Sb content in plant parts and in Hoagland solution, bioaccumulation factor (BF), photosynthesis, and physiological changes in Sb-contaminated B. nivea (20, 40, 80, and 200 mg L(-1) Sb) grown hydroponically were investigated. The Sb tolerance and resistance of ramie were clearly revealed by growth inhibition, a TI between 13 and 99 %, non-significant changes in the maximum quantum efficiency of photosystem (F v /F m ), energy-harvesting efficiency (photosystem II (PSII)) and single-photon avalanche diode (SPAD) value, a significant increase in Sb in plant parts, BF >1, and an increase in catalase (CAT) and malondialdehyde (MDA) at 200 mg L(-1) Sb. Under increasing Sb stress, nearly the same non-significant decline in the maximum quantum efficiency of photosystem (F v /F m ), energy-harvesting efficiency (PSII), relative quantum yield of photosystem II (φPSII), and photochemical quenching (qP), except for F v /F m at 20 mg L(-1) Sb, were recorded. SPAD values for chlorophyll under Sb stress showed an increasing trend, except for a slight decrease, i.e., continuous increase in MDA, superoxide dismutase (SOD), peroxidase (POD), and CAT activities were suppressed under Sb addition up to 40 mg L(-1) Sb and the addition of Sb enhanced enzyme production at 80 and 200 mg L(-1) Sb. A continuous decrease in SOD, POD, and CAT up to 40 mg L(-1) Sb and enhancements at ≥80 mg L(-1), along with the continuous enhancement of MDA activity and inhibited biomass production, clearly reveal the roles of these enzymes in detoxifying Sb stress and the defense mechanism of ramie at 80 mg L(-1) Sb. Thus, B. nivea constitutes a promising candidate for Sb phytoremediation at mining sites. PMID:26711292

  17. Synthesis and Properties of Light-tolerant Organic Antimony%耐光型有机锑的合成及其性能研究

    Institute of Scientific and Technical Information of China (English)

    高勇; 韩永和; 李建丰; 袁余斌; 王爱红


    硫醇锑稳定剂由于其耐紫外光性能很差,在存储、运输和使用方面受到很大的限制。为解决这一问题,试探性以三氯化锑和巯基酯为原料,引入抗紫外线活性基团TBP-1(2,4-二羟基二苯甲酮),合成了“晒不黑”的有机锑热稳定剂。用红外光谱对产品结构进行了确认,光敏性实验表明其7周内不变色;静态热稳定性实验结果表明其与硫醇锑热稳定剂相当。%Because of its poor ultraviolet resistance , the storage , transportation and use of antimony mercaptide stabilizer was greatly limited.In order to solve this problem , a kind of synthesized organic antimony thermal stabilizer was prepared, which was light -tolerant with antimony trichloride , isooctyl thioglycollat as raw materials and TBP -1(2,4-dihydroxybenzophenone ) , with an anti-ultraviolet agent added in.The light-tolerant performance and thermal stability of product tested showed that the color of organic antimony as -synthesized was unchangeable when under the impact of direct sunlight for 7 weeks by infrared spectroscopy spectrum that was confirmed for structure of product , and the static experimental results showed that the thermal stability was nearly equivalent to antimony mercaptide.

  18. Identification of the Broad Solar Emission Features Near 117 nm

    CERN Document Server

    Avrett, E H; Loeser, R; Avrett, Eugene H.; Kurucz, Robert L.; Loeser, Rudolf


    Wilhelm et al. have recently called attention to the unidentified broad emission features near 117 nm in the solar spectrum. They discuss the observed properties of these features in detail but do not identify the source of this emission. We show that the broad autoionizing transitions of neutral sulfur are responsible for these emission features. Autoionizing lines of \\ion{S}{i} occur throughout the spectrum between Lyman alpha and the Lyman limit. Sulfur is a normal contributor to stellar spectra. We use non-LTE chromospheric model calculations with line data from the Kurucz 2004 \\ion{S}{i} line list to simulate the solar spectrum in the range 116 to 118 nm. We compare the results with SUMER disk-center observations from Curdt et al. and limb observations from Wilhelm et al. Our calculations generally agree with the SUMER observations of the broad autoionizing \\ion{S}{i} emission features, the narrow \\ion{S}{i} emission lines, and the continuum in this wavelength region, and agree with basic characteristics...

  19. Synthesis of a new element with Z=117 (United States)

    Hamilton, Joseph


    The synthesis of new elements with neutron number (N) approaching 184 provide important tests of nuclear structure models used to predict closed spherical shells in the heaviest elements. Earlier, elements with Z=113-116, and 118 were synthesized in reactions of ^48Ca with actinide targets at JINR. The synthesis of previously unknown Z=117 can provide additional crucial tests of the shell structure near the predicted Island of Stability with N=184. Here we report the synthesis of ^293,294117 (N=176,177) in the ^48Ca + ^249Bk 4n and 3n reactions. The ^249Bk was produced at ORNL in the High Flux Isotope Reactor and chemically separated at the Radiochemical Engineering Development Center at ORNL. Six arc-shaped targets of 0.31 mg/cm^2 of ^249Bk were made at the Research Institute of Atomic Reactors (Dimitrovgrad). The experiments were performed employing the Dubna Gas-Filled Recoil Separator and the heavy-ion cyclotron U-400 at JINR, Russia. Separated evaporation residues were registered by a time-of-fight system and implanted in a 4 cm x 12 cm Si-detector array with 12 vertical position-sensitive strips surrounded by eight 4 cm x 4 cm side detectors. Irradiation at 252 MeV for 70 days starting July 27, with a total beam dose of 2.4 x 10^19 yielded five position-correlated (heavy elements and their place in the Periodic Table.

  20. Clinical analysis on 117 cases of amniotic fluid%羊水过少117例临床分析

    Institute of Scientific and Technical Information of China (English)



    目的:探讨羊水过少现象出现的原因以及相关因素。方法:对117例羊水过少患者临床资料进行分析。结果:40周以后是羊水过少现象的高发阶段;B超检查准确率高达95%,妊高征和胎儿宫内生长迟缓是出现频率最高的妊娠并发症;相比于对照组,羊水过少脐带缠绕、脐带过短情况发生概率以及新生儿窒息率要稍高一些(P<0.01)。随着羊水量的逐渐减少,羊水粪染率、胎儿窘迫情况发生的概率会越来越高。结论:在明确了羊水量之后,应采用剖宫产的方式结束分娩。%Objective:To investigate the causes and related factors on the phenomenon of amniotic fluid.Methods:117 cases with amniotic fluid were selected,then their clinical data was analyzed.Results:The high incidence of amniotic fluid was at the stage of 40 weeks after pregnancy;ultrasonography accuracy rate was as high as 95% ;pregnancy induced hypertension(PIH) and fetal intrauterine growth retardation were the highest frequency of pregnancy complications;compared with the control group, oligohydramnios umbilical cord entanglement,umbilical cord too short occurrence probability and neonatal asphyxia rate is slightly higher(P<0.01).With the gradual decrease of amniotic fluid volume,the probability occurrence of stained amniotic fluid and fetal distress would be more and more high.Conclusion:After the amniotic fluid volume clarify a diagnosis,cesarean section should be taken to terminate the pregnancy.

  1. 40 CFR 93.117 - Criteria and procedures: Compliance with PM10 and PM2.5 control measures. (United States)


    ... with PM10 and PM2.5 control measures. 93.117 Section 93.117 Protection of Environment ENVIRONMENTAL....117 Criteria and procedures: Compliance with PM10 and PM2.5 control measures. The FHWA/FTA project must comply with any PM10 and PM2.5 control measures in the applicable implementation plan....

  2. 42 CFR 442.117 - Termination of certification for ICFs/MR whose deficiencies pose immediate jeopardy. (United States)


    ... deficiencies pose immediate jeopardy. 442.117 Section 442.117 Public Health CENTERS FOR MEDICARE & MEDICAID... ICFs/MR § 442.117 Termination of certification for ICFs/MR whose deficiencies pose immediate jeopardy... chapter. (2) The facility's deficiencies pose immediate jeopardy to residents' health and safety....

  3. 41 CFR 102-117.300 - Do the decisions on temporary nonuse, suspension and debarment go beyond the agency? (United States)


    ... temporary nonuse, suspension and debarment go beyond the agency? 102-117.300 Section 102-117.300 Public...) Performance § 102-117.300 Do the decisions on temporary nonuse, suspension and debarment go beyond the agency? (a) Temporary nonuse does not go beyond the agency. (b) GSA compiles and maintains a current list...

  4. Research advances in microbial mechanism of antimony%微生物对锑的代谢机制研究进展

    Institute of Scientific and Technical Information of China (English)

    李明顺; 李洁; 王革娇


    锑(Sb)是一种自然界普遍存在的剧毒重金属,随着工业生产的日趋发展,我国部分地区土壤、水体及农产品受到严重的锑污染.作为环境污染物,锑中毒会导致人类心肌衰竭,肝坏死等疾病.自然界中的某些生物,特别是微生物却可以在极高锑浓度下生长,甚至可以利用这种元素作为能源物质,因此,微生物在锑的地球物质循环中起着重要的作用.研究生物对锑的代谢机制,对于保护环境与人体健康具有重要的现实意义.本文对锑在环境中的分布、污染状况、微生物对锑的代谢以及生物修复等方面的研究现状进行了综述.同时建议今后应加强以下三方面的研究:(1)筛选更多抗锑微生物或氧化锑的微生物;(2)发掘更多锑抗性基因或氧化基因;(3)开发锑污染土壤及水体的微生物修复技术.%Antimony (Sb) is a highly toxic heavy metal which widespreadly exists in nature.With the increasing development of industry,the soil,water and agricultural products are severely polluted by antimony in some regions of our country.As an environmental pollutant,antimony poisoning can lead to heart failure,human diseases such as liver necrosis.Some organisms in nature,especially the microorganisms can grow in the high concentration of antimony,and can even use the element as an energy material,so the microorganisms play an important role in the cycle of earth's materials.Study on metabolic mechanism of antimony has important practical significance to protect environment and human health.This study reviewed the researches of Sb distribution in the environment,the pollution status,microbial metabolism of antimony and bioremediation.At the same time it suggests that future researches should strengthen the following three aspects:(1) isolating more antimony resistance or antimony oxidizing microorganisms; (2) identifying more antimony resistant or oxidizing genes; (3) exploring microbial techniques to remediate

  5. Enhanced Removal of Arsenic and Antimony in the Mining Site by Calcined γ-Fe2O3/Layered Double Hydroxide Nanocomposite (United States)

    Lee, Sang-Ho; Choi, Heechul; Kim, Kyoung-Woong


    Arsenic (As) and Antimony (Sb) have been recognized as harmful contaminants in aquatic environment due to its high toxicity and carcinogenicity. Especially, the contamination of arsenic in the mining areas is considered as a serious emerging environmental issue in Korea. Due to the hazardous effect of arsenic, the United States Environmental Protection Agency (US EPA) regulated maximum contamination level of arsenic to 10 μg/L in drinking water. The harmful effect on human health by excessive intake of antimony was also reported by previous studies, and severe contamination level (100 - 7,000 μg/L) of antimony reported in surface and groundwater of abandoned mining area in China and Slovakia. Therefore, US EPA regulated maximum contaminants level of antimony in drinking water to 6 μg/L. In order to remove anionic contaminants in drinking water, various type of nanomaterials have been developed. Layered double hydroxide (LDH) is the artificial anionic clay that is based on the layered structure of positively charged brucite-like layers with interlayers of anions. The LDH is one of the promising nanomaterials for the removal of anionic contaminants because it has high selectivity for arsenic, phosphate, chromium and antimony. However, the biggest problem of LDH for wastewater treatment is that the particles cannot be easily separated after the removal of contaminants. In this study, magnetic nanoparticles (γ-Fe2O3) supported LDH nanocomposite (γ-Fe2O3/LDH) was investigated to enhance magnetic particle recovery and removal efficiency for arsenic and antimony. The calcined γ-Fe2O3/LDH nanocomposites synthesized by co-precipitation method, and the crystallographic properties of maghemite (γ-Fe2O3) and layered structure of LDH were confirmed by X-ray diffraction. The nano-sized γ-Fe2O3 (30 to 50 nm) was stably attached on the surface of LDH (100 to 150 nm) and O1s spectrum by X-ray photoelectron spectroscopy (XPS) explained that there are both physical and

  6. Synthesis and characterization of nanostructured Mn(II) doped antimony-tin oxide (ATO) films on glass

    International Nuclear Information System (INIS)

    Sol–gel Mn(II) doped antimony tin oxide films were developed with precursor of atomic ratio range, Sn:Sb:Mn = 68–72:23–25:9–3. The X-ray diffraction patterns depict tetragonal cassiterite phase of SnO2. Transmission electron microscopy images suggest the nanostructured form of the doped materials. The increase in crystallite size with Mn(II) concentration is reflected by the larger band gap values (4.61–4.73 eV) arising from the excitonic transitions which also respond to PL emissions. Hall effect measurements show that the carrier concentration increases but mobility decreases for Mn(II) doping. Room temperature ferromagnetism with different saturation magnetic moments (Ms) has been observed for all dopant concentrations, 3–9 at%.

  7. The chemistry and behaviour of antimony in the soil environment with comparisons to arsenic: A critical review

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Susan C., E-mail: [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia); Lockwood, Peter V., E-mail: [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia); Ashley, Paul M., E-mail: [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia); Tighe, Matthew, E-mail: [School of Environmental and Rural Science, University of New England, Armidale, NSW 2351 (Australia)


    This article provides a critical review of the environmental chemistry of inorganic antimony (Sb) in soils, comparing and contrasting findings with those of arsenic (As). Characteristics of the Sb soil system are reviewed, with an emphasis on speciation, sorption and phase associations, identifying differences between Sb and As behaviour. Knowledge gaps in environmentally relevant Sb data for soils are identified and discussed in terms of the limitations this imposes on understanding the fate, behaviour and risks associated with Sb in environmental soil systems, with particular reference to mobility and bioavailability. - A critical and comparative review of Sb and As chemistry and associations in soil systems identifies research directions needed for better understanding of risks.

  8. Antimony (SbIII) reduces growth, declines photosynthesis, and modifies leaf tissue anatomy in sunflower (Helianthus annuus L.). (United States)

    Vaculík, Marek; Mrázová, Anna; Lux, Alexander


    The role of antimony (Sb)--a non-essential trace metalloid--in physiological processes running in crops is still poorly understood. Present paper describes the effect of Sb tartrate (SbIII) on growth, Sb uptake, photosynthesis, photosynthetic pigments, and leaf tissue organization in young sunflower plants grown in hydroponics. We found that growth of below- and aboveground part was reduced with increasing concentration of Sb in the medium. Although Sb was mostly taken up by sunflower roots and only small part (1-2%) was translocated to the shoots, decline in photosynthesis, transpiration, and decreased content of photosynthetic pigments were observed. This indicates that despite relatively low mobility of Sb in root-shoot system, Sb in shoot noticeably modifies physiological status and reduced plant growth. Additionally, leaf anatomical changes indicated that Sb reduced the size of intercellular spaces and made leaf tissue more compact. PMID:26194244

  9. Conjugative plasmid in Corynebacterium flaccumfaciens subsp. oortii that confers resistance to arsenite, arsenate, and antimony(III)

    Energy Technology Data Exchange (ETDEWEB)

    Hendrick, C.A.; Haskins, W.P.; Vidaver, A.K.


    Gene transfer systems for phytopathogenic corynebacteria have not been reported previously. In this paper a conjugative 46-megadalton plasmid (pDG101) found in Corynebacterium flaccumfaciens subsp. oorii CO101 is described that mediates resistance to arsenite, arsenate, and antimony(III). Transfer of the plasmid from CO101 to four other strains from the C. flaccumfaciens group occurred between cells immobilized on nitrocellulose filters or on agar surfaces. Transconjugant strains expressed the same levels of metal resistance as the donor strain and were able to act as donor strains in subsequent matings. The physical presence of the plasmid was detected by agarose gel electrophoresis. Arsenite-sensitive derivatives of the donor and transconjugant strains were obtained after heat treatment; these were cured of pDG101.

  10. Construction of spongy antimony-doped tin oxide/graphene nanocomposites using commercially available products and its excellent electrochemical performance (United States)

    Zhao, Xiaowei; Zhang, Jingwei; Zhang, Jiwei; Gong, Chunhong; Gu, Xiufang; Ma, Zhihua; Zhou, Jingfang; Yu, Laigui; Zhang, Zhijun


    We construct successfully a porous antimony-doped tin oxide (ATO)/nitrogen-doped graphene 3-dimensional (3D) frameworks (denoted as ATO/NG/TEPA; TEPA refers to tetraethylenepentamine) by a one-pot hydrothermal process, with which TEPA aqueous solution is adopted to easily re-disperse commercial ATO precursor forming a transparent hydrosol. The results show that TEPA plays a key role in the construction of ATO/NG/TEPA, not only acting as a peptization reagent to re-disperse ATO precursor nanoparticles, and as a linker to combine ATO with graphene sheets. The as-fabricated ATO/NG/TEPA hybrid as the negative electrode of lithium ion batteries exhibits excellent lithium storage capacity and cycling stability. With the advantage of easily re-dispersing commercial ATO, the present synthetic route may be put into use for the large-scale production of the titled nanocomposites as the anode material of lithium ion batteries.

  11. Fabrication of superhydrophobic and heat-insulating antimony doped tin oxide/polyurethane films by cast replica micromolding. (United States)

    Feng, Jie; Huang, Baoyuan; Zhong, Mingqiang


    A novel process for fabricating superhydrophobic and heat-insulating polymeric nanocomposite films was developed. Briefly, antimony doped tin oxide (ATO) nanoparticles that commonly endow coats heat-insulating and transparent functions were mixed into commercial waterborne polyurethane (WPU) suspensions to obtain ATO/WPU suspensions, which were then cast onto poly(dimethylsiloxane) (PDMS) stamps replicated from fresh lotus leaves. After being dried and peeled off from stamps, ATO/PU films with superhydrophobic surface and heat-insulating property were created, while PU films without ATO only showed high hydrophobicity. Scanning electron microscopy (SEM) imaging showed the surface of ATO/PU superhydrophobic films had unique micro- and nano-structures similar with those on the lotus leaf. On the contrary, no obvious nano-structures were found on the surface of pure PU films, demonstrating mixing functional nanoparticles into polymers is a necessary and feasible step in creating superhydrophobic and functional films by replica molding method. PMID:19394955


    Directory of Open Access Journals (Sweden)

    Funda Kahraman


    Full Text Available Modification of Al-Si cast alloys can be achieved in two different ways, namely by additions of certain eleınents orwith rapid cooling rate. Modifications of the Al-Si al1oys are carried out extensivcly in industry to improve themechanical properties, particularly ductility. In this study, the effects of antiınony addition.s and growth rate on theınicrostructure and eutectic morphology on the directionally solidified Al- 1 2.5°/o Si cutectic all oy has beeninvestigated. The results showed that antimony can be identified as a grain refıner. Over modification occurs in Al-12.5 °/oSi alloy when modifier is present in the amount of 1 %Sb results in AISb compound.

  13. Antimony (SbIII) reduces growth, declines photosynthesis, and modifies leaf tissue anatomy in sunflower (Helianthus annuus L.). (United States)

    Vaculík, Marek; Mrázová, Anna; Lux, Alexander


    The role of antimony (Sb)--a non-essential trace metalloid--in physiological processes running in crops is still poorly understood. Present paper describes the effect of Sb tartrate (SbIII) on growth, Sb uptake, photosynthesis, photosynthetic pigments, and leaf tissue organization in young sunflower plants grown in hydroponics. We found that growth of below- and aboveground part was reduced with increasing concentration of Sb in the medium. Although Sb was mostly taken up by sunflower roots and only small part (1-2%) was translocated to the shoots, decline in photosynthesis, transpiration, and decreased content of photosynthetic pigments were observed. This indicates that despite relatively low mobility of Sb in root-shoot system, Sb in shoot noticeably modifies physiological status and reduced plant growth. Additionally, leaf anatomical changes indicated that Sb reduced the size of intercellular spaces and made leaf tissue more compact.

  14. Super-resolution readout property of bismuth-doped antimony-based thin film as a functional mask for read-only memory (United States)

    Lu, Xinmiao; Wu, Yiqun; Wang, Yang; Wei, Jingsong


    Bismuth-doped antimony-based (Sb100- x Bi x , x=2.46) thin films were presented as a functional mask for super-resolution readout of read-only memory (ROM). The pit size of the ROM was 390 nm, and super-resolution readout was realized on a dynamic tester with laser wavelength of 780 nm and the numerical aperture of the focusing objective lens of 0.45. The carrier-to-noise ratio (CNR) of 22 dB, readout threshold power of 0.8 mW and super-resolution readout cycles of 2×104 was achieved. The influence of film thickness and readout power on CNR was investigated. The reflectivity and transmittance of the film with different temperature at wavelength of 780 nm were detected, and the super-resolution mechanism of the bismuth-doped antimony-based thin films as the functional mask layer was discussed.

  15. Ultra-low carrier concentration and surface-dominant transport in antimony-doped Bi2Se3 topological insulator nanoribbons (United States)

    Hong, Seung Sae; Cha, Judy J.; Kong, Desheng; Cui, Yi


    A topological insulator is the state of quantum matter possessing gapless spin-locking surface states across the bulk band gap, which has created new opportunities from novel electronics to energy conversion. However, the large concentration of bulk residual carriers has been a major challenge for revealing the property of the topological surface state by electron transport measurements. Here we report the surface-state-dominant transport in antimony-doped, zinc oxide-encapsulated Bi2Se3 nanoribbons with suppressed bulk electron concentration. In the nanoribbon with sub-10-nm thickness protected by a zinc oxide layer, we position the Fermi levels of the top and bottom surfaces near the Dirac point by electrostatic gating, achieving extremely low two-dimensional carrier concentration of 2×1011 cm-2. The zinc oxide-capped, antimony-doped Bi2Se3 nanostructures provide an attractive materials platform to study fundamental physics in topological insulators, as well as future applications.

  16. Antimoniais empregados no tratamento da leishmaniose: estado da arte Antimonials employed in the treatment of leishmaniaisis: the state of the art


    Susanne Rath; Luciano Augusto Trivelin; Talitha Rebecca Imbrunito; Daniela Maria Tomazela; Marcelo Nunes de Jesús; Percy Calvo Marzal; Heitor Franco de Andrade Junior; André Gustavo Tempone


    Antimony preparations are the drugs of choice for the treatment of leishmaniasis over 90 years, a disease that currently affects 12 million people worldwide. Its introduction was based on 19th century concepts of therapeutic effects of metal salts as arsenicals and other metals, most of them abandoned due to toxic effects or better drugs. In the last three decades, there was a great improvement in the knowledge of cell biology and immunology of those infections, but chemotherapy has not been ...

  17. Decreased antimony uptake and overexpression of genes of thiol metabolism are associated with drug resistance in a canine isolate of Leishmania infantum


    Verónica Gómez Pérez; Raquel García-Hernandez; Victoriano Corpas-López; Tomás, Ana M.; Joaquina Martín-Sanchez; Santiago Castanys; Francisco Gamarro


    Visceral leishmaniasis (VL) caused by the protozoan parasite Leishmania infantum, is one of the most important zoonotic diseases affecting dogs and humans in the Mediterranean area. The presence of infected dogs as the main reservoir host of L. infantum is regarded as the most significant risk for potential human infection. We have studied the susceptibility profile to antimony and other anti-leishmania drugs (amphotericin B, miltefosine, paromomycin) in Leishmania infantum isolates extracted...

  18. Arsenic and antimony determination in refined and unrefined table salts by means of hydride generation atomic absorption spectrometry--comparison of sample decomposition and determination methods


    AKSUNER, Nur; TİRTOM, Vedia Nüket; HENDEN, Emür


    An evaluation was made of different digestion methods for the determination of arsenic and antimony in table salt samples prior to hydride generation atomic absorption spectrometric analysis. Microwave acid digestion, classical wet digestion, dry ashing, and fusion were applied to the decomposition of salt samples and optimum conditions were investigated. Samples were decomposed by changing heating time, digestion techniques, and the amount and composition of acid, and then the concen...

  19. Antimony determination in seawater and pore water of marine sediments by means of coprecipitation with Mg(OH)2 and atomic absorption spectrometry

    International Nuclear Information System (INIS)

    The study of biogeochemical cycling of trace elements in inshore marine environment is of basic importance in order to understand the long-term distribution of both conventional and radioactive pollutants among the ecosystem components. Antimony is of radio- ecological interest, and its determination in some environmental matrices (seawater, pore water, biota) is always difficult from the analytical point of view. A quick method for antimony determination in seawater and interstitial water of marine sediments, by coprecipitation with Mg(OH)2 and subsequent atomic absorption measurement, is reported. Coprecipitation recovery (about 80% in optimal conditions) was evaluated using both radiotracers and the addition of known amounts of stable element, and turned out to depend on several parameters (percentage of precipitated Mg as compared to the natural content in seawater, ageing of Mg(OH)2, concomitant Fe and Mn concentrations, etc.). The total standard deviation of the proposed method is about 10%. The variance analysis showed that about 90% of total variance is due to the preconcentration procedure (sample handling and random contaminations) and only about 10% is due to the instrumental measurement. The results of antimony determinations in seawater and pore water of marine sediments collected at Montalto di Castro (Central Mediterranean Sea) are presented and discussed

  20. 原子荧光光谱法测定环境空气中锑%Antimony Determination by Atomic Fluorescence Spectrometry

    Institute of Scientific and Technical Information of China (English)



    采用过氯乙烯滤膜采集环境空气中锑,盐酸-氢氟酸混酸体系微波消解滤膜,原子荧光光谱法测定锑。方法前处理操作过程简单、省时、酸用量少、环境污染小,方法的灵敏度和准确度都有很大的提高。采样体积为300L时,空气中锑的最低检出质量浓度为0.002mg/m3。%Antimony in air was sampled using perchloroethylene filter.The filter was dipped into hydrochloric acid and hydrofluoric acid system and digested by microwave.Atomic fluorescence spectrometry was used to detect anti-mony after.This process is simple and time-saving with easy pretreatment,less amount of acid,and less negative impacts on environment.In addition,the accuracy and precision of the process is better than previous methods. The detection limit of antimony in air is 0.002mg/m3 when the volume of air sample is 300 liters when this process was applied.